4QJPA

Crystal structure of human carbonic anhydrase isozyme xiii with inhibitor
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
Knots found
sequence length
258
structure length
258
Chain Sequence
SWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase/lyase inhibitor
molecule keywords Carbonic anhydrase 13
publication title Functionalization of Fluorinated Benzenesulfonamides and Their Inhibitory Properties toward Carbonic Anhydrases
pubmed doi rcsb
source organism Homo sapiens
total genus 78
structure length 258
sequence length 258
chains with identical sequence B
other databases KnotProt 2.0: S +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2014-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 4qjpA00
4YX4A 5SZ7A 4QSBA 3P3JA 3MHMA 3S78B 1CALA 3ZP9A 3P44A 1URTA 1CCSA 4PYYA 1UGCA 4QIYA 2Q1QA 3S74B 1UGEA 5SZ2A 5JEGB 1CCTA 3F7BA 4N0XB 1YO1A 1BNNA 3M5TA 3MNKA 5DSNA 2FMZA 4E3DA 4BCWA 3C7PA 4KNNA 3BL0A 1ZSBA 4PQ7A 3OIKA 4YVYA 1YDBA 4C3TA 4RUZA 1CAHA 5EH5A 5SZ5A 3T5ZA 4E49A 3U3AX 2NNGA 4QY3A 5DRSA 4M2VA 1TG9A 3M2XA 4CACA 4E3GA 1AVNA 2CBCA 5AMLA 5IPZA 2WEOA 4ZWYA 4RIVA 3SAXA 3RZ1B 5DSPA 2GD8A 5JGTB 1DCAA 1LUGA 1DCBA 3OY0A 4Q08A 2FOYA 3P5LA 1CNCA 2WD3A 2X7TA 3Q31A 3T85A 3KOIA 4HEYA 4Q6EA 2Q38A 4WW8A 3S76A 5FLRA 2CBEA 1RZDA 4ETQC 5JGSB 5E2NA 1Z9YA 1CANA 8CA2A 1ZSAA 1I9QA 1RZCA 1ZSCA 2HFWA 1FQNA 2FMGA 4L5WA 3MYQA 4Q8ZA 3V3HB 1RJ6A 5JESB 3V3JA 4HEWA 1ZE8A 3RYYA 3U47A 3F4XA 3KIGA 3DBUA 1YDAA 3FFPX 3T5UA 3S72B 5E2SA 1CVCA 4YXOA 2QO8A 5E2RA 2NMXA 2NWOA 1KWRA 3V7XA 1ZGEA 3MNJA 4QJMA 4MTYA 1CAIA 3OILA 5FNHA 4X5SA 1G53A 4COQA 1LG6A 1BNMA 2WD2A 1BNWA 3S73B 3UYQA 4MDGA 2HD6A 2EU3A 1FQLA 1MOOA 2NXTA 3DD8A 5DOGA 3KONA 4ITPA 1FLJA 4RFDA 5JQ0A 5FLSA 3HKNA 1A42A 1IF6A 4KP8A 1CNKA 4HT2A 4KUWA 4E9OX 3BL1A 5AMGA 3W6HA 4XIWA 3TMJA 1JV0A 2VVBX 1F2WA 12CAA 1CNIA 4N16A 3V3IB 2ZNCA 3RYXB 1CNYA 4IWZA 4Q07A 3IBUA 1KOPA 3OIMA 2NXSA 2OSFA 4CNWA 4MDLA 5FL5A 3EFIA 3MHLA 3HKQA 4HBAA 1G0EA 3D0NA 1LZVA 4ZAOA 4M2UA 3RZ0B 2X7UA 4YXIA 5DSRA 3S9TA 1IF4A 5CA2A 4Q0LA 1CAYA 3RGEA 1BNVA 5L6KA 3B1BA 4PXXA 1KOQA 3M14A 4Z1JA 2NWYA 2VVAX 1CNHA 5EIJA 3JXFA 2POUA 3D8WA 3RG3A 4Q06A 5DSMA 5JEPB 1TH9A 4Q87A 3HKTA 3HLJA 3HKUA 3D93A 2ABEA 3P5AA 3PYKA 5FNMA 3IBIA 1CAJA 3M1JA 3KS3A 1I9OA 1I90A 4YXUA 2HL4A 3DC3A 1OKLA 4QSAA 4CNRA 4Q7VA 2NNOA 4JSZA 5DSOA 2AW1A 5EHEA 4ZWXA 4YHAA 1BICA 5SZ3A 3P58A 2IT4A 5EOIA 5DSJA 3M1WA 1YO0A 1G3ZA 2NXRA 1FQMA 2WEJA 1AM6A 1H9NA 4K0TA 3U7CA 4QJ0A 4YYTA 3N4BA 4E5QA 1CVFA 1RAYA 4E3FA 1TTMA 1CNJA 2NNVA 1CVDA 5FDCA 2POWA 3U45X 4ZX0A 4E3HA 4PZHA 4Q8YA 3MNUA 4L5VA 1IF9A 4G7AA 4Q09A 3S71B 4MO8A 2ILIA 4WUPA 4QJWA 5EKMA 1FQRA 3TVNX 2FNKA 2H15A 4FU5A 4MLTA 2EZ7A 2CABA 5JDVB 1CNXA 4JSSA 5SZ1A 3M67A 1JD0A 3GZ0A 5JG3B 1LGDA 3JXHC 5E5RA 5EKJA 5G01A 3K2FA 3PO6A 1OQ5A 3M98A 1I9NA 3ZNCA 3MNAA 4Q49A 2CBAA 5A25A 1I9PA 4QK1A 5G0CA 1OKMA 1UGGA 1FSRA 3V5GA 1ZH9A 3M1QA 5BYIA 4FPTA 1IF7A 2NNSA 3TVOX 1EOUA 1Z97A 4FVOA 1TBTX 1HECA 5L3OA 2HNCA 5FNGA 1CAZA 2CBDA 2EU2A 1AZMA 1HCAA 4CNVA 3CA2A 1T9NA 1G0FA 3N2PA 5DSIA 3M2ZA 3RYVB 4YGLA 4JSAA 2FNNA 4QEFA 5E2MA 5CACA 4G0CA 4LHIA 4ILXA 3RZ7A 3DVBA 3K7KA 5BRWA 4YGKA 3IAIA 3M5EA 4KNJA 3SAPA 5EKHA 5FDIA 3T83A 2NWZA 4LP6A 5CLUA 1UGFA 5E5UA 4KV0A 1UGDA 3DA2A 3M1KA 2H4NA 3EFTA 4K0ZA 1CRAA 1LG5A 2WEGA 3T82A 1CAOA 3V2JA 5AMDA 3D9ZA 3RYJB 4WW6A 1CNGA 4JSWA 4ZWZA 5FL4A 3MHOA 3S8XA 4QSIA 4RN4A 3DCCA 3KNEA 1Y7WA 1ZNCA 5FNLA 1I8ZA 4BF6A 5FNKA 3V3FA 1BN1A 3KOKA 1G4JA 3KWAA 3PJJA 2AX2A 4JS6A 1ZGFA 4DZ9A 1G45A 2CA2A 1CRMA 4WR7A 1RZBA 4HU1A 4KUYA 1RJ5A 4ZWIA 2FOSA 3MMFA 1DMYA 1YDDA 4M2RA 1FR4A 3KLDB 2O4ZA 3ML2A 1XEVA 1CVBA 1ZFQA 1BV3A 3CYUA 3MNHA 4Q6DA 4K1QA 5FLTA 1YDCA 2QP6A 2CBBA 4QJPA 2FNMA 3DD0A 7CA2A 3QYKA 4QTLA 2F14A 1I9LA 4KAPA 1G1DA 5JEHB 3CZVA 1CA3A 5EZTX 4KUVA 3IBNA 4L5UA 4QJXA 1G48A 1G54A 1RAZA 5EH8A 3MZCA 3UYNA 1HEBA 2Q1BA 5EH7A 3D92A 1BCDA 5G0BA 1BNTA 2HOCA 4QK2A 4YGFA 4Q7WA 2X7SA 1G4OA 3S97A 3IGPA 3DC9A 1THKA 1UGAA 4RUXA 4WUQA 3N3JA 4MLXA 4Y0JA 4Q90A 4Q7PA 5FLOA 2POVA 3M2YA 4YWPA 3M04A 3M96A 4M2WA 4Z1EA 4HEZA 5CJFA 2NN7A 1CAMA 3P3HA 4XIXA 1CINA 3S77B 1Z93A 1JCZA 1BNQA 4TWMA 1BN4A 4E4AA 1BZMA 3M5SA 5JQTA 4WL4A 3NJ9A 1CVHA 3MHCA 4HF3A 3M2NA 3MNIA 4XE1A 4QIZA 4RH2A 3DVCA 3CAJA 4Q9YA 1CIMA 1TEUX 5SZ0A 3L14A 2OSMA 2FOVA 4K13A 3R17B 1CNBA 3IBLA 3B4FA 4UOVA 1CAKA 3LXEA 3OKUA 4Q81A 5EHWA 1J9WA 3K34A 4ZX1A 1HUGA 3V2MA 1HEAA 3T84A 9CA2A 4K0SA 4RFCA 3DV7A 4CA2A 1FSQA 1FSNA 3M40A 5G03A 3RZ8A 1HCBA 4TWLA 5E2KA 1KWQA 3RYZA 6CA2A 1DMXA 5DSLA 3KKXA 1H4NA 1TG3A 5FLQA 1XEGA 4Q83A 3NI5A 4QJOA 1CA2A 2W2JA 1XPZA 3S75B 2HKKA 4KNMA 4Q99A 5LMDA 3RLDA 2GEHA 3F8EA 1OKNA 5C8IA 4R59A 3HS4A 3OKVA 4DZ7A 1CVEA 2QOAA 4R5BA 1CNWA 3V3GB 3IEOA 2FOUA 1ZFKA 3VBDA 3HFPA 2NWPA 1G52A 4Q78A 1CVAA 2FOQA 1V9EA 3MDZA 3OYQA 3FE4A 3F7UA 3P55A 4XZ5A 4QSJA 3RJ7A 5DVXA 4FRCA 3DCWA 5FLPA 4CQ0A 1CILA 1G6VA 4R5AA 1UGBA 4ITOA 1TB0X 4BF1A 3SBHA 1BN3A 4QK3A 3DCSA 3RG4A 3DAZA 4PYXA 5FNIA 3OYSA 3JXGA 3MHIA 3ML5A 5FNJA 5E28A 2NN1A 5BRUA 1YO2A 1XQ0A 4RUYA 1I9MA 1MUAA 4YGJA 5HPJA 4FL7A 5BRVA 1CCUA 1IF5A 4Q7SA 5EHVA 4Q8XA 3M3XA 1HUHA 5SZ4A 3SBIA 3BETA 1H9QA 1FR7A 3DVDA 4IDRX 4GL1X 5DSQA 5DSKA 1IF8A 5JG5B 2FW4A 4Z0QA 1G46A 5FL6A 3N0NA 4LU3A 1I91A 3NB5A 4FIKA 4RIUA 1HVAA 4YGNA 4CNXA 5SZ6A 1V9IC 1KEQA 5BNLA 4KNIA 3RZ5A 4Z1KA 4MDMA 1TE3X 4HT0A 4Z1NA 3R16A 1HEDA 1CZMA 5J8ZA 1RZEA 1TEQX 4FVNA 4KP5A 1RZAA 3P4VA 3MWOA 5DOHA 3W6IA 2WEHA 4XFWA 5A6HA 3FW3A 1BNUA
chains in the Genus database with same CATH superfamily
4YX4A 5SZ7A 4QSBA 3P3JA 3MHMA 3S78B 1CALA 3ZP9A 3P44A 1URTA 1CCSA 4PYYA 1UGCA 4QIYA 2Q1QA 3S74B 1UGEA 5SZ2A 5JEGB 1CCTA 3F7BA 4N0XB 1YO1A 1BNNA 3M5TA 3MNKA 5DSNA 2FMZA 4E3DA 4BCWA 3C7PA 4KNNA 3BL0A 1ZSBA 4PQ7A 3OIKA 4YVYA 1YDBA 4C3TA 4RUZA 1CAHA 5EH5A 5SZ5A 3T5ZA 4E49A 3U3AX 2NNGA 4QY3A 5DRSA 4M2VA 1TG9A 3M2XA 4CACA 4E3GA 1AVNA 2CBCA 5AMLA 5IPZA 2WEOA 4ZWYA 4RIVA 3SAXA 3RZ1B 5DSPA 2GD8A 5JGTB 1DCAA 1LUGA 1DCBA 3OY0A 4Q08A 2FOYA 3P5LA 1CNCA 2WD3A 2X7TA 3Q31A 3T85A 3KOIA 4HEYA 4Q6EA 2Q38A 4WW8A 3S76A 5FLRA 2CBEA 1RZDA 4ETQC 5JGSB 5E2NA 1Z9YA 1CANA 8CA2A 1ZSAA 1I9QA 1RZCA 1ZSCA 2HFWA 1FQNA 2FMGA 4L5WA 3MYQA 4Q8ZA 3V3HB 1RJ6A 5JESB 3V3JA 4HEWA 1ZE8A 3RYYA 3U47A 3F4XA 3KIGA 3DBUA 1YDAA 3FFPX 3T5UA 3S72B 5E2SA 1CVCA 4YXOA 2QO8A 5E2RA 2NMXA 2NWOA 1KWRA 3V7XA 1ZGEA 3MNJA 4QJMA 4MTYA 1CAIA 3OILA 5FNHA 4X5SA 1G53A 4COQA 1LG6A 1BNMA 2WD2A 1BNWA 3S73B 3UYQA 4MDGA 2HD6A 2EU3A 1FQLA 1MOOA 2NXTA 3DD8A 5DOGA 3KONA 4ITPA 1FLJA 4RFDA 5JQ0A 5FLSA 3HKNA 1A42A 1IF6A 4KP8A 1CNKA 4HT2A 4KUWA 4E9OX 3BL1A 5AMGA 3W6HA 4XIWA 3TMJA 1JV0A 2VVBX 1F2WA 12CAA 1CNIA 4N16A 3V3IB 2ZNCA 3RYXB 1CNYA 4IWZA 4Q07A 3IBUA 1KOPA 3OIMA 2NXSA 2OSFA 4CNWA 4MDLA 5FL5A 3EFIA 3MHLA 3HKQA 4HBAA 1G0EA 3D0NA 1LZVA 4ZAOA 4M2UA 3RZ0B 2X7UA 4YXIA 5DSRA 3S9TA 1IF4A 5CA2A 4Q0LA 1CAYA 3RGEA 1BNVA 5L6KA 3B1BA 4PXXA 1KOQA 3M14A 4Z1JA 2NWYA 2VVAX 1CNHA 5EIJA 3JXFA 2POUA 3D8WA 3RG3A 4Q06A 5DSMA 5JEPB 1TH9A 4Q87A 3HKTA 3HLJA 3HKUA 3D93A 2ABEA 3P5AA 3PYKA 5FNMA 3IBIA 1CAJA 3M1JA 3KS3A 1I9OA 1I90A 4YXUA 2HL4A 3DC3A 1OKLA 4QSAA 4CNRA 4Q7VA 2NNOA 4JSZA 5DSOA 2AW1A 5EHEA 4ZWXA 4YHAA 1BICA 5SZ3A 3P58A 2IT4A 5EOIA 5DSJA 3M1WA 1YO0A 1G3ZA 2NXRA 1FQMA 2WEJA 1AM6A 1H9NA 4K0TA 3U7CA 4QJ0A 4YYTA 3N4BA 4E5QA 1CVFA 1RAYA 4E3FA 1TTMA 1CNJA 2NNVA 1CVDA 5FDCA 2POWA 3U45X 4ZX0A 4E3HA 4PZHA 4Q8YA 3MNUA 4L5VA 1IF9A 4G7AA 4Q09A 3S71B 4MO8A 2ILIA 4WUPA 4QJWA 5EKMA 1FQRA 3TVNX 2FNKA 2H15A 4FU5A 4MLTA 2EZ7A 2CABA 5JDVB 1CNXA 4JSSA 5SZ1A 3M67A 1JD0A 3GZ0A 5JG3B 1LGDA 3JXHC 5E5RA 5EKJA 5G01A 3K2FA 3PO6A 1OQ5A 3M98A 1I9NA 3ZNCA 3MNAA 4Q49A 2CBAA 5A25A 1I9PA 4QK1A 5G0CA 1OKMA 1UGGA 1FSRA 3V5GA 1ZH9A 3M1QA 5BYIA 4FPTA 1IF7A 2NNSA 3TVOX 1EOUA 1Z97A 4FVOA 1TBTX 1HECA 5L3OA 2HNCA 5FNGA 1CAZA 2CBDA 2EU2A 1AZMA 1HCAA 4CNVA 3CA2A 1T9NA 1G0FA 3N2PA 5DSIA 3M2ZA 3RYVB 4YGLA 4JSAA 2FNNA 4QEFA 5E2MA 5CACA 4G0CA 4LHIA 4ILXA 3RZ7A 3DVBA 3K7KA 5BRWA 4YGKA 3IAIA 3M5EA 4KNJA 3SAPA 5EKHA 5FDIA 3T83A 2NWZA 4LP6A 5CLUA 1UGFA 5E5UA 4KV0A 1UGDA 3DA2A 3M1KA 2H4NA 3EFTA 4K0ZA 1CRAA 1LG5A 2WEGA 3T82A 1CAOA 3V2JA 5AMDA 3D9ZA 3RYJB 4WW6A 1CNGA 4JSWA 4ZWZA 5FL4A 3MHOA 3S8XA 4QSIA 4RN4A 3DCCA 3KNEA 1Y7WA 1ZNCA 5FNLA 1I8ZA 4BF6A 5FNKA 3V3FA 1BN1A 3KOKA 1G4JA 3KWAA 3PJJA 2AX2A 4JS6A 1ZGFA 4DZ9A 1G45A 2CA2A 1CRMA 4WR7A 1RZBA 4HU1A 4KUYA 1RJ5A 4ZWIA 2FOSA 3MMFA 1DMYA 1YDDA 4M2RA 1FR4A 3KLDB 2O4ZA 3ML2A 1XEVA 1CVBA 1ZFQA 1BV3A 3CYUA 3MNHA 4Q6DA 4K1QA 5FLTA 1YDCA 2QP6A 2CBBA 4QJPA 2FNMA 3DD0A 7CA2A 3QYKA 4QTLA 2F14A 1I9LA 4KAPA 1G1DA 5JEHB 3CZVA 1CA3A 5EZTX 4KUVA 3IBNA 4L5UA 4QJXA 1G48A 1G54A 1RAZA 5EH8A 3MZCA 3UYNA 1HEBA 2Q1BA 5EH7A 3D92A 1BCDA 5G0BA 1BNTA 2HOCA 4QK2A 4YGFA 4Q7WA 2X7SA 1G4OA 3S97A 3IGPA 3DC9A 1THKA 1UGAA 4RUXA 4WUQA 3N3JA 4MLXA 4Y0JA 4Q90A 4Q7PA 5FLOA 2POVA 3M2YA 4YWPA 3M04A 3M96A 4M2WA 4Z1EA 4HEZA 5CJFA 2NN7A 1CAMA 3P3HA 4XIXA 1CINA 3S77B 1Z93A 1JCZA 1BNQA 4TWMA 1BN4A 4E4AA 1BZMA 3M5SA 5JQTA 4WL4A 3NJ9A 1CVHA 3MHCA 4HF3A 3M2NA 3MNIA 4XE1A 4QIZA 4RH2A 3DVCA 3CAJA 4Q9YA 1CIMA 1TEUX 5SZ0A 3L14A 2OSMA 2FOVA 4K13A 3R17B 1CNBA 3IBLA 3B4FA 4UOVA 1CAKA 3LXEA 3OKUA 4Q81A 5EHWA 1J9WA 3K34A 4ZX1A 1HUGA 3V2MA 1HEAA 3T84A 9CA2A 4K0SA 4RFCA 3DV7A 4CA2A 1FSQA 1FSNA 3M40A 5G03A 3RZ8A 1HCBA 4TWLA 5E2KA 1KWQA 3RYZA 6CA2A 1DMXA 5DSLA 3KKXA 1H4NA 1TG3A 5FLQA 1XEGA 4Q83A 3NI5A 4QJOA 1CA2A 2W2JA 1XPZA 3S75B 2HKKA 4KNMA 4Q99A 5LMDA 3RLDA 2GEHA 3F8EA 1OKNA 5C8IA 4R59A 3HS4A 3OKVA 4DZ7A 1CVEA 2QOAA 4R5BA 1CNWA 3V3GB 3IEOA 2FOUA 1ZFKA 3VBDA 3HFPA 2NWPA 1G52A 4Q78A 1CVAA 2FOQA 1V9EA 3MDZA 3OYQA 3FE4A 3F7UA 3P55A 4XZ5A 4QSJA 3RJ7A 5DVXA 4FRCA 3DCWA 5FLPA 4CQ0A 1CILA 1G6VA 4R5AA 1UGBA 4ITOA 1TB0X 4BF1A 3SBHA 1BN3A 4QK3A 3DCSA 3RG4A 3DAZA 4PYXA 5FNIA 3OYSA 3JXGA 3MHIA 3ML5A 5FNJA 5E28A 2NN1A 5BRUA 1YO2A 1XQ0A 4RUYA 1I9MA 1MUAA 4YGJA 5HPJA 4FL7A 5BRVA 1CCUA 1IF5A 4Q7SA 5EHVA 4Q8XA 3M3XA 1HUHA 5SZ4A 3SBIA 3BETA 1H9QA 1FR7A 3DVDA 4IDRX 4GL1X 5DSQA 5DSKA 1IF8A 5JG5B 2FW4A 4Z0QA 1G46A 5FL6A 3N0NA 4LU3A 1I91A 3NB5A 4FIKA 4RIUA 1HVAA 4YGNA 4CNXA 5SZ6A 1V9IC 1KEQA 5BNLA 4KNIA 3RZ5A 4Z1KA 4MDMA 1TE3X 4HT0A 4Z1NA 3R16A 1HEDA 1CZMA 5J8ZA 1RZEA 1TEQX 4FVNA 4KP5A 1RZAA 3P4VA 3MWOA 5DOHA 3W6IA 2WEHA 4XFWA 5A6HA 3FW3A 1BNUA
chains in the Genus database with same CATH topology
4YX4A 5SZ7A 4QSBA 3P3JA 3MHMA 3S78B 1CALA 3ZP9A 3P44A 1URTA 1CCSA 4PYYA 1UGCA 4QIYA 2Q1QA 3S74B 1UGEA 5SZ2A 5JEGB 1CCTA 3F7BA 4N0XB 1YO1A 1BNNA 3M5TA 3MNKA 5DSNA 2FMZA 4E3DA 4BCWA 3C7PA 4KNNA 3BL0A 1ZSBA 4PQ7A 3OIKA 4YVYA 1YDBA 4C3TA 4RUZA 1CAHA 5EH5A 5SZ5A 3T5ZA 4E49A 3U3AX 2NNGA 4QY3A 5DRSA 4M2VA 1TG9A 3M2XA 4CACA 4E3GA 1AVNA 2CBCA 5AMLA 5IPZA 2WEOA 4ZWYA 4RIVA 3SAXA 3RZ1B 5DSPA 2GD8A 5JGTB 1DCAA 1LUGA 1DCBA 3OY0A 4Q08A 2FOYA 3P5LA 1CNCA 2WD3A 2X7TA 3Q31A 3T85A 3KOIA 4HEYA 4Q6EA 2Q38A 4WW8A 3S76A 5FLRA 2CBEA 1RZDA 4ETQC 5JGSB 5E2NA 1Z9YA 1CANA 8CA2A 1ZSAA 1I9QA 1RZCA 1ZSCA 2HFWA 1FQNA 2FMGA 4L5WA 3MYQA 4Q8ZA 3V3HB 1RJ6A 5JESB 3V3JA 4HEWA 1ZE8A 3RYYA 3U47A 3F4XA 3KIGA 3DBUA 1YDAA 3FFPX 3T5UA 3S72B 5E2SA 1CVCA 4YXOA 2QO8A 5E2RA 2NMXA 2NWOA 1KWRA 3V7XA 1ZGEA 3MNJA 4QJMA 4MTYA 1CAIA 3OILA 5FNHA 4X5SA 1G53A 4COQA 1LG6A 1BNMA 2WD2A 1BNWA 3S73B 3UYQA 4MDGA 2HD6A 2EU3A 1FQLA 1MOOA 2NXTA 3DD8A 5DOGA 3KONA 4ITPA 1FLJA 4RFDA 5JQ0A 5FLSA 3HKNA 1A42A 1IF6A 4KP8A 1CNKA 4HT2A 4KUWA 4E9OX 3BL1A 5AMGA 3W6HA 4XIWA 3TMJA 1JV0A 2VVBX 1F2WA 12CAA 1CNIA 4N16A 3V3IB 2ZNCA 3RYXB 1CNYA 4IWZA 4Q07A 3IBUA 1KOPA 3OIMA 2NXSA 2OSFA 4CNWA 4MDLA 5FL5A 3EFIA 3MHLA 3HKQA 4HBAA 1G0EA 3D0NA 1LZVA 4ZAOA 4M2UA 3RZ0B 2X7UA 4YXIA 5DSRA 3S9TA 1IF4A 5CA2A 4Q0LA 1CAYA 3RGEA 1BNVA 5L6KA 3B1BA 4PXXA 1KOQA 3M14A 4Z1JA 2NWYA 2VVAX 1CNHA 5EIJA 3JXFA 2POUA 3D8WA 3RG3A 4Q06A 5DSMA 5JEPB 1TH9A 4Q87A 3HKTA 3HLJA 3HKUA 3D93A 2ABEA 3P5AA 3PYKA 5FNMA 3IBIA 1CAJA 3M1JA 3KS3A 1I9OA 1I90A 4YXUA 2HL4A 3DC3A 1OKLA 4QSAA 4CNRA 4Q7VA 2NNOA 4JSZA 5DSOA 2AW1A 5EHEA 4ZWXA 4YHAA 1BICA 5SZ3A 3P58A 2IT4A 5EOIA 5DSJA 3M1WA 1YO0A 1G3ZA 2NXRA 1FQMA 2WEJA 1AM6A 1H9NA 4K0TA 3U7CA 4QJ0A 4YYTA 3N4BA 4E5QA 1CVFA 1RAYA 4E3FA 1TTMA 1CNJA 2NNVA 1CVDA 5FDCA 2POWA 3U45X 4ZX0A 4E3HA 4PZHA 4Q8YA 3MNUA 4L5VA 1IF9A 4G7AA 4Q09A 3S71B 4MO8A 2ILIA 4WUPA 4QJWA 5EKMA 1FQRA 3TVNX 2FNKA 2H15A 4FU5A 4MLTA 2EZ7A 2CABA 5JDVB 1CNXA 4JSSA 5SZ1A 3M67A 1JD0A 3GZ0A 5JG3B 1LGDA 3JXHC 5E5RA 5EKJA 5G01A 3K2FA 3PO6A 1OQ5A 3M98A 1I9NA 3ZNCA 3MNAA 4Q49A 2CBAA 5A25A 1I9PA 4QK1A 5G0CA 1OKMA 1UGGA 1FSRA 3V5GA 1ZH9A 3M1QA 5BYIA 4FPTA 1IF7A 2NNSA 3TVOX 1EOUA 1Z97A 4FVOA 1TBTX 1HECA 5L3OA 2HNCA 5FNGA 1CAZA 2CBDA 2EU2A 1AZMA 1HCAA 4CNVA 3CA2A 1T9NA 1G0FA 3N2PA 5DSIA 3M2ZA 3RYVB 4YGLA 4JSAA 2FNNA 4QEFA 5E2MA 5CACA 4G0CA 4LHIA 4ILXA 3RZ7A 3DVBA 3K7KA 5BRWA 4YGKA 3IAIA 3M5EA 4KNJA 3SAPA 5EKHA 5FDIA 3T83A 2NWZA 4LP6A 5CLUA 1UGFA 5E5UA 4KV0A 1UGDA 3DA2A 3M1KA 2H4NA 3EFTA 4K0ZA 1CRAA 1LG5A 2WEGA 3T82A 1CAOA 3V2JA 5AMDA 3D9ZA 3RYJB 4WW6A 1CNGA 4JSWA 4ZWZA 5FL4A 3MHOA 3S8XA 4QSIA 4RN4A 3DCCA 3KNEA 1Y7WA 1ZNCA 5FNLA 1I8ZA 4BF6A 5FNKA 3V3FA 1BN1A 3KOKA 1G4JA 3KWAA 3PJJA 2AX2A 4JS6A 1ZGFA 4DZ9A 1G45A 2CA2A 1CRMA 4WR7A 1RZBA 4HU1A 4KUYA 1RJ5A 4ZWIA 2FOSA 3MMFA 1DMYA 1YDDA 4M2RA 1FR4A 3KLDB 2O4ZA 3ML2A 1XEVA 1CVBA 1ZFQA 1BV3A 3CYUA 3MNHA 4Q6DA 4K1QA 5FLTA 1YDCA 2QP6A 2CBBA 4QJPA 2FNMA 3DD0A 7CA2A 3QYKA 4QTLA 2F14A 1I9LA 4KAPA 1G1DA 5JEHB 3CZVA 1CA3A 5EZTX 4KUVA 3IBNA 4L5UA 4QJXA 1G48A 1G54A 1RAZA 5EH8A 3MZCA 3UYNA 1HEBA 2Q1BA 5EH7A 3D92A 1BCDA 5G0BA 1BNTA 2HOCA 4QK2A 4YGFA 4Q7WA 2X7SA 1G4OA 3S97A 3IGPA 3DC9A 1THKA 1UGAA 4RUXA 4WUQA 3N3JA 4MLXA 4Y0JA 4Q90A 4Q7PA 5FLOA 2POVA 3M2YA 4YWPA 3M04A 3M96A 4M2WA 4Z1EA 4HEZA 5CJFA 2NN7A 1CAMA 3P3HA 4XIXA 1CINA 3S77B 1Z93A 1JCZA 1BNQA 4TWMA 1BN4A 4E4AA 1BZMA 3M5SA 5JQTA 4WL4A 3NJ9A 1CVHA 3MHCA 4HF3A 3M2NA 3MNIA 4XE1A 4QIZA 4RH2A 3DVCA 3CAJA 4Q9YA 1CIMA 1TEUX 5SZ0A 3L14A 2OSMA 2FOVA 4K13A 3R17B 1CNBA 3IBLA 3B4FA 4UOVA 1CAKA 3LXEA 3OKUA 4Q81A 5EHWA 1J9WA 3K34A 4ZX1A 1HUGA 3V2MA 1HEAA 3T84A 9CA2A 4K0SA 4RFCA 3DV7A 4CA2A 1FSQA 1FSNA 3M40A 5G03A 3RZ8A 1HCBA 4TWLA 5E2KA 1KWQA 3RYZA 6CA2A 1DMXA 5DSLA 3KKXA 1H4NA 1TG3A 5FLQA 1XEGA 4Q83A 3NI5A 4QJOA 1CA2A 2W2JA 1XPZA 3S75B 2HKKA 4KNMA 4Q99A 5LMDA 3RLDA 2GEHA 3F8EA 1OKNA 5C8IA 4R59A 3HS4A 3OKVA 4DZ7A 1CVEA 2QOAA 4R5BA 1CNWA 3V3GB 3IEOA 2FOUA 1ZFKA 3VBDA 3HFPA 2NWPA 1G52A 4Q78A 1CVAA 2FOQA 1V9EA 3MDZA 3OYQA 3FE4A 3F7UA 3P55A 4XZ5A 4QSJA 3RJ7A 5DVXA 4FRCA 3DCWA 5FLPA 4CQ0A 1CILA 1G6VA 4R5AA 1UGBA 4ITOA 1TB0X 4BF1A 3SBHA 1BN3A 4QK3A 3DCSA 3RG4A 3DAZA 4PYXA 5FNIA 3OYSA 3JXGA 3MHIA 3ML5A 5FNJA 5E28A 2NN1A 5BRUA 1YO2A 1XQ0A 4RUYA 1I9MA 1MUAA 4YGJA 5HPJA 4FL7A 5BRVA 1CCUA 1IF5A 4Q7SA 5EHVA 4Q8XA 3M3XA 1HUHA 5SZ4A 3SBIA 3BETA 1H9QA 1FR7A 3DVDA 4IDRX 4GL1X 5DSQA 5DSKA 1IF8A 5JG5B 2FW4A 4Z0QA 1G46A 5FL6A 3N0NA 4LU3A 1I91A 3NB5A 4FIKA 4RIUA 1HVAA 4YGNA 4CNXA 5SZ6A 1V9IC 1KEQA 5BNLA 4KNIA 3RZ5A 4Z1KA 4MDMA 1TE3X 4HT0A 4Z1NA 3R16A 1HEDA 1CZMA 5J8ZA 1RZEA 1TEQX 4FVNA 4KP5A 1RZAA 3P4VA 3MWOA 5DOHA 3W6IA 2WEHA 4XFWA 5A6HA 3FW3A 1BNUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YX4 A;  5SZ7 A;  4QSB A;  3P3J A;  3MHM A;  3S78 B;  1CAL A;  3ZP9 A;  3P44 A;  1URT A;  1CCS A;  4PYY A;  1UGC A;  4QIY A;  2Q1Q A;  3S74 B;  1UGE A;  5SZ2 A;  5JEG B;  1CCT A;  3F7B A;  4N0X B;  1YO1 A;  1BNN A;  3M5T A;  3MNK A;  5DSN A;  2FMZ A;  4E3D A;  4BCW A;  3C7P A;  4KNN A;  3BL0 A;  1ZSB A;  4PQ7 A;  3OIK A;  4YVY A;  1YDB A;  4C3T A;  4RUZ A;  1CAH A;  5EH5 A;  5SZ5 A;  3T5Z A;  4E49 A;  3U3A X;  2NNG A;  4QY3 A;  5DRS A;  4M2V A;  1TG9 A;  3M2X A;  4CAC A;  4E3G A;  1AVN A;  2CBC A;  5AML A;  5IPZ A;  2WEO A;  4ZWY A;  4RIV A;  3SAX A;  3RZ1 B;  5DSP A;  2GD8 A;  5JGT B;  1DCA A;  1LUG A;  1DCB A;  3OY0 A;  4Q08 A;  2FOY A;  3P5L A;  1CNC A;  2WD3 A;  2X7T A;  3Q31 A;  3T85 A;  3KOI A;  4HEY A;  4Q6E A;  2Q38 A;  4WW8 A;  3S76 A;  5FLR A;  2CBE A;  1RZD A;  4ETQ C;  5JGS B;  5E2N A;  1Z9Y A;  1CAN A;  8CA2 A;  1ZSA A;  1I9Q A;  1RZC A;  1ZSC A;  2HFW A;  1FQN A;  2FMG A;  4L5W A;  3MYQ A;  4Q8Z A;  3V3H B;  1RJ6 A;  5JES B;  3V3J A;  4HEW A;  1ZE8 A;  3RYY A;  3U47 A;  3F4X A;  3KIG A;  3DBU A;  1YDA A;  3FFP X;  3T5U A;  3S72 B;  5E2S A;  1CVC A;  4YXO A;  2QO8 A;  5E2R A;  2NMX A;  2NWO A;  1KWR A;  3V7X A;  1ZGE A;  3MNJ A;  4QJM A;  4MTY A;  1CAI A;  3OIL A;  5FNH A;  4X5S A;  1G53 A;  4COQ A;  1LG6 A;  1BNM A;  2WD2 A;  1BNW A;  3S73 B;  3UYQ A;  4MDG A;  2HD6 A;  2EU3 A;  1FQL A;  1MOO A;  2NXT A;  3DD8 A;  5DOG A;  3KON A;  4ITP A;  1FLJ A;  4RFD A;  5JQ0 A;  5FLS A;  3HKN A;  1A42 A;  1IF6 A;  4KP8 A;  1CNK A;  4HT2 A;  4KUW A;  4E9O X;  3BL1 A;  5AMG A;  3W6H A;  4XIW A;  3TMJ A;  1JV0 A;  2VVB X;  1F2W A;  12CA A;  1CNI A;  4N16 A;  3V3I B;  2ZNC A;  3RYX B;  1CNY A;  4IWZ A;  4Q07 A;  3IBU A;  1KOP A;  3OIM A;  2NXS A;  2OSF A;  4CNW A;  4MDL A;  5FL5 A;  3EFI A;  3MHL A;  3HKQ A;  4HBA A;  1G0E A;  3D0N A;  1LZV A;  4ZAO A;  4M2U A;  3RZ0 B;  2X7U A;  4YXI A;  5DSR A;  3S9T A;  1IF4 A;  5CA2 A;  4Q0L A;  1CAY A;  3RGE A;  1BNV A;  5L6K A;  3B1B A;  4PXX A;  1KOQ A;  3M14 A;  4Z1J A;  2NWY A;  2VVA X;  1CNH A;  5EIJ A;  3JXF A;  2POU A;  3D8W A;  3RG3 A;  4Q06 A;  5DSM A;  5JEP B;  1TH9 A;  4Q87 A;  3HKT A;  3HLJ A;  3HKU A;  3D93 A;  2ABE A;  3P5A A;  3PYK A;  5FNM A;  3IBI A;  1CAJ A;  3M1J A;  3KS3 A;  1I9O A;  1I90 A;  4YXU A;  2HL4 A;  3DC3 A;  1OKL A;  4QSA A;  4CNR A;  4Q7V A;  2NNO A;  4JSZ A;  5DSO A;  2AW1 A;  5EHE A;  4ZWX A;  4YHA A;  1BIC A;  5SZ3 A;  3P58 A;  2IT4 A;  5EOI A;  5DSJ A;  3M1W A;  1YO0 A;  1G3Z A;  2NXR A;  1FQM A;  2WEJ A;  1AM6 A;  1H9N A;  4K0T A;  3U7C A;  4QJ0 A;  4YYT A;  3N4B A;  4E5Q A;  1CVF A;  1RAY A;  4E3F A;  1TTM A;  1CNJ A;  2NNV A;  1CVD A;  5FDC A;  2POW A;  3U45 X;  4ZX0 A;  4E3H A;  4PZH A;  4Q8Y A;  3MNU A;  4L5V A;  1IF9 A;  4G7A A;  4Q09 A;  3S71 B;  4MO8 A;  2ILI A;  4WUP A;  4QJW A;  5EKM A;  1FQR A;  3TVN X;  2FNK A;  2H15 A;  4FU5 A;  4MLT A;  2EZ7 A;  2CAB A;  5JDV B;  1CNX A;  4JSS A;  5SZ1 A;  3M67 A;  1JD0 A;  3GZ0 A;  5JG3 B;  1LGD A;  3JXH C;  5E5R A;  5EKJ A;  5G01 A;  3K2F A;  3PO6 A;  1OQ5 A;  3M98 A;  1I9N A;  3ZNC A;  3MNA A;  4Q49 A;  2CBA A;  5A25 A;  1I9P A;  4QK1 A;  5G0C A;  1OKM A;  1UGG A;  1FSR A;  3V5G A;  1ZH9 A;  3M1Q A;  5BYI A;  4FPT A;  1IF7 A;  2NNS A;  3TVO X;  1EOU A;  1Z97 A;  4FVO A;  1TBT X;  1HEC A;  5L3O A;  2HNC A;  5FNG A;  1CAZ A;  2CBD A;  2EU2 A;  1AZM A;  1HCA A;  4CNV A;  3CA2 A;  1T9N A;  1G0F A;  3N2P A;  5DSI A;  3M2Z A;  3RYV B;  4YGL A;  4JSA A;  2FNN A;  4QEF A;  5E2M A;  5CAC A;  4G0C A;  4LHI A;  4ILX A;  3RZ7 A;  3DVB A;  3K7K A;  5BRW A;  4YGK A;  3IAI A;  3M5E A;  4KNJ A;  3SAP A;  5EKH A;  5FDI A;  3T83 A;  2NWZ A;  4LP6 A;  5CLU A;  1UGF A;  5E5U A;  4KV0 A;  1UGD A;  3DA2 A;  3M1K A;  2H4N A;  3EFT A;  4K0Z A;  1CRA A;  1LG5 A;  2WEG A;  3T82 A;  1CAO A;  3V2J A;  5AMD A;  3D9Z A;  3RYJ B;  4WW6 A;  1CNG A;  4JSW A;  4ZWZ A;  5FL4 A;  3MHO A;  3S8X A;  4QSI A;  4RN4 A;  3DCC A;  3KNE A;  1Y7W A;  1ZNC A;  5FNL A;  1I8Z A;  4BF6 A;  5FNK A;  3V3F A;  1BN1 A;  3KOK A;  1G4J A;  3KWA A;  3PJJ A;  2AX2 A;  4JS6 A;  1ZGF A;  4DZ9 A;  1G45 A;  2CA2 A;  1CRM A;  4WR7 A;  1RZB A;  4HU1 A;  4KUY A;  1RJ5 A;  4ZWI A;  2FOS A;  3MMF A;  1DMY A;  1YDD A;  4M2R A;  1FR4 A;  3KLD B;  2O4Z A;  3ML2 A;  1XEV A;  1CVB A;  1ZFQ A;  1BV3 A;  3CYU A;  3MNH A;  4Q6D A;  4K1Q A;  5FLT A;  1YDC A;  2QP6 A;  2CBB A;  4QJP A;  2FNM A;  3DD0 A;  7CA2 A;  3QYK A;  4QTL A;  2F14 A;  1I9L A;  4KAP A;  1G1D A;  5JEH B;  3CZV A;  1CA3 A;  5EZT X;  4KUV A;  3IBN A;  4L5U A;  4QJX A;  1G48 A;  1G54 A;  1RAZ A;  5EH8 A;  3MZC A;  3UYN A;  1HEB A;  2Q1B A;  5EH7 A;  3D92 A;  1BCD A;  5G0B A;  1BNT A;  2HOC A;  4QK2 A;  4YGF A;  4Q7W A;  2X7S A;  1G4O A;  3S97 A;  3IGP A;  3DC9 A;  1THK A;  1UGA A;  4RUX A;  4WUQ A;  3N3J A;  4MLX A;  4Y0J A;  4Q90 A;  4Q7P A;  5FLO A;  2POV A;  3M2Y A;  4YWP A;  3M04 A;  3M96 A;  4M2W A;  4Z1E A;  4HEZ A;  5CJF A;  2NN7 A;  1CAM A;  3P3H A;  4XIX A;  1CIN A;  3S77 B;  1Z93 A;  1JCZ A;  1BNQ A;  4TWM A;  1BN4 A;  4E4A A;  1BZM A;  3M5S A;  5JQT A;  4WL4 A;  3NJ9 A;  1CVH A;  3MHC A;  4HF3 A;  3M2N A;  3MNI A;  4XE1 A;  4QIZ A;  4RH2 A;  3DVC A;  3CAJ A;  4Q9Y A;  1CIM A;  1TEU X;  5SZ0 A;  3L14 A;  2OSM A;  2FOV A;  4K13 A;  3R17 B;  1CNB A;  3IBL A;  3B4F A;  4UOV A;  1CAK A;  3LXE A;  3OKU A;  4Q81 A;  5EHW A;  1J9W A;  3K34 A;  4ZX1 A;  1HUG A;  3V2M A;  1HEA A;  3T84 A;  9CA2 A;  4K0S A;  4RFC A;  3DV7 A;  4CA2 A;  1FSQ A;  1FSN A;  3M40 A;  5G03 A;  3RZ8 A;  1HCB A;  4TWL A;  5E2K A;  1KWQ A;  3RYZ A;  6CA2 A;  1DMX A;  5DSL A;  3KKX A;  1H4N A;  1TG3 A;  5FLQ A;  1XEG A;  4Q83 A;  3NI5 A;  4QJO A;  1CA2 A;  2W2J A;  1XPZ A;  3S75 B;  2HKK A;  4KNM A;  4Q99 A;  5LMD A;  3RLD A;  2GEH A;  3F8E A;  1OKN A;  5C8I A;  4R59 A;  3HS4 A;  3OKV A;  4DZ7 A;  1CVE A;  2QOA A;  4R5B A;  1CNW A;  3V3G B;  3IEO A;  2FOU A;  1ZFK A;  3VBD A;  3HFP A;  2NWP A;  1G52 A;  4Q78 A;  1CVA A;  2FOQ A;  1V9E A;  3MDZ A;  3OYQ A;  3FE4 A;  3F7U A;  3P55 A;  4XZ5 A;  4QSJ A;  3RJ7 A;  5DVX A;  4FRC A;  3DCW A;  5FLP A;  4CQ0 A;  1CIL A;  1G6V A;  4R5A A;  1UGB A;  4ITO A;  1TB0 X;  4BF1 A;  3SBH A;  1BN3 A;  4QK3 A;  3DCS A;  3RG4 A;  3DAZ A;  4PYX A;  5FNI A;  3OYS A;  3JXG A;  3MHI A;  3ML5 A;  5FNJ A;  5E28 A;  2NN1 A;  5BRU A;  1YO2 A;  1XQ0 A;  4RUY A;  1I9M A;  1MUA A;  4YGJ A;  5HPJ A;  4FL7 A;  5BRV A;  1CCU A;  1IF5 A;  4Q7S A;  5EHV A;  4Q8X A;  3M3X A;  1HUH A;  5SZ4 A;  3SBI A;  3BET A;  1H9Q A;  1FR7 A;  3DVD A;  4IDR X;  4GL1 X;  5DSQ A;  5DSK A;  1IF8 A;  5JG5 B;  2FW4 A;  4Z0Q A;  1G46 A;  5FL6 A;  3N0N A;  4LU3 A;  1I91 A;  3NB5 A;  4FIK A;  4RIU A;  1HVA A;  4YGN A;  4CNX A;  5SZ6 A;  1V9I C;  1KEQ A;  5BNL A;  4KNI A;  3RZ5 A;  4Z1K A;  4MDM A;  1TE3 X;  4HT0 A;  4Z1N A;  3R16 A;  1HED A;  1CZM A;  5J8Z A;  1RZE A;  1TEQ X;  4FVN A;  4KP5 A;  1RZA A;  3P4V A;  3MWO A;  5DOH A;  3W6I A;  2WEH A;  4XFW A;  5A6H A;  3FW3 A;  1BNU A; 
#chains in the Genus database with same CATH topology
 4YX4 A;  5SZ7 A;  4QSB A;  3P3J A;  3MHM A;  3S78 B;  1CAL A;  3ZP9 A;  3P44 A;  1URT A;  1CCS A;  4PYY A;  1UGC A;  4QIY A;  2Q1Q A;  3S74 B;  1UGE A;  5SZ2 A;  5JEG B;  1CCT A;  3F7B A;  4N0X B;  1YO1 A;  1BNN A;  3M5T A;  3MNK A;  5DSN A;  2FMZ A;  4E3D A;  4BCW A;  3C7P A;  4KNN A;  3BL0 A;  1ZSB A;  4PQ7 A;  3OIK A;  4YVY A;  1YDB A;  4C3T A;  4RUZ A;  1CAH A;  5EH5 A;  5SZ5 A;  3T5Z A;  4E49 A;  3U3A X;  2NNG A;  4QY3 A;  5DRS A;  4M2V A;  1TG9 A;  3M2X A;  4CAC A;  4E3G A;  1AVN A;  2CBC A;  5AML A;  5IPZ A;  2WEO A;  4ZWY A;  4RIV A;  3SAX A;  3RZ1 B;  5DSP A;  2GD8 A;  5JGT B;  1DCA A;  1LUG A;  1DCB A;  3OY0 A;  4Q08 A;  2FOY A;  3P5L A;  1CNC A;  2WD3 A;  2X7T A;  3Q31 A;  3T85 A;  3KOI A;  4HEY A;  4Q6E A;  2Q38 A;  4WW8 A;  3S76 A;  5FLR A;  2CBE A;  1RZD A;  4ETQ C;  5JGS B;  5E2N A;  1Z9Y A;  1CAN A;  8CA2 A;  1ZSA A;  1I9Q A;  1RZC A;  1ZSC A;  2HFW A;  1FQN A;  2FMG A;  4L5W A;  3MYQ A;  4Q8Z A;  3V3H B;  1RJ6 A;  5JES B;  3V3J A;  4HEW A;  1ZE8 A;  3RYY A;  3U47 A;  3F4X A;  3KIG A;  3DBU A;  1YDA A;  3FFP X;  3T5U A;  3S72 B;  5E2S A;  1CVC A;  4YXO A;  2QO8 A;  5E2R A;  2NMX A;  2NWO A;  1KWR A;  3V7X A;  1ZGE A;  3MNJ A;  4QJM A;  4MTY A;  1CAI A;  3OIL A;  5FNH A;  4X5S A;  1G53 A;  4COQ A;  1LG6 A;  1BNM A;  2WD2 A;  1BNW A;  3S73 B;  3UYQ A;  4MDG A;  2HD6 A;  2EU3 A;  1FQL A;  1MOO A;  2NXT A;  3DD8 A;  5DOG A;  3KON A;  4ITP A;  1FLJ A;  4RFD A;  5JQ0 A;  5FLS A;  3HKN A;  1A42 A;  1IF6 A;  4KP8 A;  1CNK A;  4HT2 A;  4KUW A;  4E9O X;  3BL1 A;  5AMG A;  3W6H A;  4XIW A;  3TMJ A;  1JV0 A;  2VVB X;  1F2W A;  12CA A;  1CNI A;  4N16 A;  3V3I B;  2ZNC A;  3RYX B;  1CNY A;  4IWZ A;  4Q07 A;  3IBU A;  1KOP A;  3OIM A;  2NXS A;  2OSF A;  4CNW A;  4MDL A;  5FL5 A;  3EFI A;  3MHL A;  3HKQ A;  4HBA A;  1G0E A;  3D0N A;  1LZV A;  4ZAO A;  4M2U A;  3RZ0 B;  2X7U A;  4YXI A;  5DSR A;  3S9T A;  1IF4 A;  5CA2 A;  4Q0L A;  1CAY A;  3RGE A;  1BNV A;  5L6K A;  3B1B A;  4PXX A;  1KOQ A;  3M14 A;  4Z1J A;  2NWY A;  2VVA X;  1CNH A;  5EIJ A;  3JXF A;  2POU A;  3D8W A;  3RG3 A;  4Q06 A;  5DSM A;  5JEP B;  1TH9 A;  4Q87 A;  3HKT A;  3HLJ A;  3HKU A;  3D93 A;  2ABE A;  3P5A A;  3PYK A;  5FNM A;  3IBI A;  1CAJ A;  3M1J A;  3KS3 A;  1I9O A;  1I90 A;  4YXU A;  2HL4 A;  3DC3 A;  1OKL A;  4QSA A;  4CNR A;  4Q7V A;  2NNO A;  4JSZ A;  5DSO A;  2AW1 A;  5EHE A;  4ZWX A;  4YHA A;  1BIC A;  5SZ3 A;  3P58 A;  2IT4 A;  5EOI A;  5DSJ A;  3M1W A;  1YO0 A;  1G3Z A;  2NXR A;  1FQM A;  2WEJ A;  1AM6 A;  1H9N A;  4K0T A;  3U7C A;  4QJ0 A;  4YYT A;  3N4B A;  4E5Q A;  1CVF A;  1RAY A;  4E3F A;  1TTM A;  1CNJ A;  2NNV A;  1CVD A;  5FDC A;  2POW A;  3U45 X;  4ZX0 A;  4E3H A;  4PZH A;  4Q8Y A;  3MNU A;  4L5V A;  1IF9 A;  4G7A A;  4Q09 A;  3S71 B;  4MO8 A;  2ILI A;  4WUP A;  4QJW A;  5EKM A;  1FQR A;  3TVN X;  2FNK A;  2H15 A;  4FU5 A;  4MLT A;  2EZ7 A;  2CAB A;  5JDV B;  1CNX A;  4JSS A;  5SZ1 A;  3M67 A;  1JD0 A;  3GZ0 A;  5JG3 B;  1LGD A;  3JXH C;  5E5R A;  5EKJ A;  5G01 A;  3K2F A;  3PO6 A;  1OQ5 A;  3M98 A;  1I9N A;  3ZNC A;  3MNA A;  4Q49 A;  2CBA A;  5A25 A;  1I9P A;  4QK1 A;  5G0C A;  1OKM A;  1UGG A;  1FSR A;  3V5G A;  1ZH9 A;  3M1Q A;  5BYI A;  4FPT A;  1IF7 A;  2NNS A;  3TVO X;  1EOU A;  1Z97 A;  4FVO A;  1TBT X;  1HEC A;  5L3O A;  2HNC A;  5FNG A;  1CAZ A;  2CBD A;  2EU2 A;  1AZM A;  1HCA A;  4CNV A;  3CA2 A;  1T9N A;  1G0F A;  3N2P A;  5DSI A;  3M2Z A;  3RYV B;  4YGL A;  4JSA A;  2FNN A;  4QEF A;  5E2M A;  5CAC A;  4G0C A;  4LHI A;  4ILX A;  3RZ7 A;  3DVB A;  3K7K A;  5BRW A;  4YGK A;  3IAI A;  3M5E A;  4KNJ A;  3SAP A;  5EKH A;  5FDI A;  3T83 A;  2NWZ A;  4LP6 A;  5CLU A;  1UGF A;  5E5U A;  4KV0 A;  1UGD A;  3DA2 A;  3M1K A;  2H4N A;  3EFT A;  4K0Z A;  1CRA A;  1LG5 A;  2WEG A;  3T82 A;  1CAO A;  3V2J A;  5AMD A;  3D9Z A;  3RYJ B;  4WW6 A;  1CNG A;  4JSW A;  4ZWZ A;  5FL4 A;  3MHO A;  3S8X A;  4QSI A;  4RN4 A;  3DCC A;  3KNE A;  1Y7W A;  1ZNC A;  5FNL A;  1I8Z A;  4BF6 A;  5FNK A;  3V3F A;  1BN1 A;  3KOK A;  1G4J A;  3KWA A;  3PJJ A;  2AX2 A;  4JS6 A;  1ZGF A;  4DZ9 A;  1G45 A;  2CA2 A;  1CRM A;  4WR7 A;  1RZB A;  4HU1 A;  4KUY A;  1RJ5 A;  4ZWI A;  2FOS A;  3MMF A;  1DMY A;  1YDD A;  4M2R A;  1FR4 A;  3KLD B;  2O4Z A;  3ML2 A;  1XEV A;  1CVB A;  1ZFQ A;  1BV3 A;  3CYU A;  3MNH A;  4Q6D A;  4K1Q A;  5FLT A;  1YDC A;  2QP6 A;  2CBB A;  4QJP A;  2FNM A;  3DD0 A;  7CA2 A;  3QYK A;  4QTL A;  2F14 A;  1I9L A;  4KAP A;  1G1D A;  5JEH B;  3CZV A;  1CA3 A;  5EZT X;  4KUV A;  3IBN A;  4L5U A;  4QJX A;  1G48 A;  1G54 A;  1RAZ A;  5EH8 A;  3MZC A;  3UYN A;  1HEB A;  2Q1B A;  5EH7 A;  3D92 A;  1BCD A;  5G0B A;  1BNT A;  2HOC A;  4QK2 A;  4YGF A;  4Q7W A;  2X7S A;  1G4O A;  3S97 A;  3IGP A;  3DC9 A;  1THK A;  1UGA A;  4RUX A;  4WUQ A;  3N3J A;  4MLX A;  4Y0J A;  4Q90 A;  4Q7P A;  5FLO A;  2POV A;  3M2Y A;  4YWP A;  3M04 A;  3M96 A;  4M2W A;  4Z1E A;  4HEZ A;  5CJF A;  2NN7 A;  1CAM A;  3P3H A;  4XIX A;  1CIN A;  3S77 B;  1Z93 A;  1JCZ A;  1BNQ A;  4TWM A;  1BN4 A;  4E4A A;  1BZM A;  3M5S A;  5JQT A;  4WL4 A;  3NJ9 A;  1CVH A;  3MHC A;  4HF3 A;  3M2N A;  3MNI A;  4XE1 A;  4QIZ A;  4RH2 A;  3DVC A;  3CAJ A;  4Q9Y A;  1CIM A;  1TEU X;  5SZ0 A;  3L14 A;  2OSM A;  2FOV A;  4K13 A;  3R17 B;  1CNB A;  3IBL A;  3B4F A;  4UOV A;  1CAK A;  3LXE A;  3OKU A;  4Q81 A;  5EHW A;  1J9W A;  3K34 A;  4ZX1 A;  1HUG A;  3V2M A;  1HEA A;  3T84 A;  9CA2 A;  4K0S A;  4RFC A;  3DV7 A;  4CA2 A;  1FSQ A;  1FSN A;  3M40 A;  5G03 A;  3RZ8 A;  1HCB A;  4TWL A;  5E2K A;  1KWQ A;  3RYZ A;  6CA2 A;  1DMX A;  5DSL A;  3KKX A;  1H4N A;  1TG3 A;  5FLQ A;  1XEG A;  4Q83 A;  3NI5 A;  4QJO A;  1CA2 A;  2W2J A;  1XPZ A;  3S75 B;  2HKK A;  4KNM A;  4Q99 A;  5LMD A;  3RLD A;  2GEH A;  3F8E A;  1OKN A;  5C8I A;  4R59 A;  3HS4 A;  3OKV A;  4DZ7 A;  1CVE A;  2QOA A;  4R5B A;  1CNW A;  3V3G B;  3IEO A;  2FOU A;  1ZFK A;  3VBD A;  3HFP A;  2NWP A;  1G52 A;  4Q78 A;  1CVA A;  2FOQ A;  1V9E A;  3MDZ A;  3OYQ A;  3FE4 A;  3F7U A;  3P55 A;  4XZ5 A;  4QSJ A;  3RJ7 A;  5DVX A;  4FRC A;  3DCW A;  5FLP A;  4CQ0 A;  1CIL A;  1G6V A;  4R5A A;  1UGB A;  4ITO A;  1TB0 X;  4BF1 A;  3SBH A;  1BN3 A;  4QK3 A;  3DCS A;  3RG4 A;  3DAZ A;  4PYX A;  5FNI A;  3OYS A;  3JXG A;  3MHI A;  3ML5 A;  5FNJ A;  5E28 A;  2NN1 A;  5BRU A;  1YO2 A;  1XQ0 A;  4RUY A;  1I9M A;  1MUA A;  4YGJ A;  5HPJ A;  4FL7 A;  5BRV A;  1CCU A;  1IF5 A;  4Q7S A;  5EHV A;  4Q8X A;  3M3X A;  1HUH A;  5SZ4 A;  3SBI A;  3BET A;  1H9Q A;  1FR7 A;  3DVD A;  4IDR X;  4GL1 X;  5DSQ A;  5DSK A;  1IF8 A;  5JG5 B;  2FW4 A;  4Z0Q A;  1G46 A;  5FL6 A;  3N0N A;  4LU3 A;  1I91 A;  3NB5 A;  4FIK A;  4RIU A;  1HVA A;  4YGN A;  4CNX A;  5SZ6 A;  1V9I C;  1KEQ A;  5BNL A;  4KNI A;  3RZ5 A;  4Z1K A;  4MDM A;  1TE3 X;  4HT0 A;  4Z1N A;  3R16 A;  1HED A;  1CZM A;  5J8Z A;  1RZE A;  1TEQ X;  4FVN A;  4KP5 A;  1RZA A;  3P4V A;  3MWO A;  5DOH A;  3W6I A;  2WEH A;  4XFW A;  5A6H A;  3FW3 A;  1BNU A; 
#chains in the Genus database with same CATH homology
 4YX4 A;  5SZ7 A;  4QSB A;  3P3J A;  3MHM A;  3S78 B;  1CAL A;  3ZP9 A;  3P44 A;  1URT A;  1CCS A;  4PYY A;  1UGC A;  4QIY A;  2Q1Q A;  3S74 B;  1UGE A;  5SZ2 A;  5JEG B;  1CCT A;  3F7B A;  4N0X B;  1YO1 A;  1BNN A;  3M5T A;  3MNK A;  5DSN A;  2FMZ A;  4E3D A;  4BCW A;  3C7P A;  4KNN A;  3BL0 A;  1ZSB A;  4PQ7 A;  3OIK A;  4YVY A;  1YDB A;  4C3T A;  4RUZ A;  1CAH A;  5EH5 A;  5SZ5 A;  3T5Z A;  4E49 A;  3U3A X;  2NNG A;  4QY3 A;  5DRS A;  4M2V A;  1TG9 A;  3M2X A;  4CAC A;  4E3G A;  1AVN A;  2CBC A;  5AML A;  5IPZ A;  2WEO A;  4ZWY A;  4RIV A;  3SAX A;  3RZ1 B;  5DSP A;  2GD8 A;  5JGT B;  1DCA A;  1LUG A;  1DCB A;  3OY0 A;  4Q08 A;  2FOY A;  3P5L A;  1CNC A;  2WD3 A;  2X7T A;  3Q31 A;  3T85 A;  3KOI A;  4HEY A;  4Q6E A;  2Q38 A;  4WW8 A;  3S76 A;  5FLR A;  2CBE A;  1RZD A;  4ETQ C;  5JGS B;  5E2N A;  1Z9Y A;  1CAN A;  8CA2 A;  1ZSA A;  1I9Q A;  1RZC A;  1ZSC A;  2HFW A;  1FQN A;  2FMG A;  4L5W A;  3MYQ A;  4Q8Z A;  3V3H B;  1RJ6 A;  5JES B;  3V3J A;  4HEW A;  1ZE8 A;  3RYY A;  3U47 A;  3F4X A;  3KIG A;  3DBU A;  1YDA A;  3FFP X;  3T5U A;  3S72 B;  5E2S A;  1CVC A;  4YXO A;  2QO8 A;  5E2R A;  2NMX A;  2NWO A;  1KWR A;  3V7X A;  1ZGE A;  3MNJ A;  4QJM A;  4MTY A;  1CAI A;  3OIL A;  5FNH A;  4X5S A;  1G53 A;  4COQ A;  1LG6 A;  1BNM A;  2WD2 A;  1BNW A;  3S73 B;  3UYQ A;  4MDG A;  2HD6 A;  2EU3 A;  1FQL A;  1MOO A;  2NXT A;  3DD8 A;  5DOG A;  3KON A;  4ITP A;  1FLJ A;  4RFD A;  5JQ0 A;  5FLS A;  3HKN A;  1A42 A;  1IF6 A;  4KP8 A;  1CNK A;  4HT2 A;  4KUW A;  4E9O X;  3BL1 A;  5AMG A;  3W6H A;  4XIW A;  3TMJ A;  1JV0 A;  2VVB X;  1F2W A;  12CA A;  1CNI A;  4N16 A;  3V3I B;  2ZNC A;  3RYX B;  1CNY A;  4IWZ A;  4Q07 A;  3IBU A;  1KOP A;  3OIM A;  2NXS A;  2OSF A;  4CNW A;  4MDL A;  5FL5 A;  3EFI A;  3MHL A;  3HKQ A;  4HBA A;  1G0E A;  3D0N A;  1LZV A;  4ZAO A;  4M2U A;  3RZ0 B;  2X7U A;  4YXI A;  5DSR A;  3S9T A;  1IF4 A;  5CA2 A;  4Q0L A;  1CAY A;  3RGE A;  1BNV A;  5L6K A;  3B1B A;  4PXX A;  1KOQ A;  3M14 A;  4Z1J A;  2NWY A;  2VVA X;  1CNH A;  5EIJ A;  3JXF A;  2POU A;  3D8W A;  3RG3 A;  4Q06 A;  5DSM A;  5JEP B;  1TH9 A;  4Q87 A;  3HKT A;  3HLJ A;  3HKU A;  3D93 A;  2ABE A;  3P5A A;  3PYK A;  5FNM A;  3IBI A;  1CAJ A;  3M1J A;  3KS3 A;  1I9O A;  1I90 A;  4YXU A;  2HL4 A;  3DC3 A;  1OKL A;  4QSA A;  4CNR A;  4Q7V A;  2NNO A;  4JSZ A;  5DSO A;  2AW1 A;  5EHE A;  4ZWX A;  4YHA A;  1BIC A;  5SZ3 A;  3P58 A;  2IT4 A;  5EOI A;  5DSJ A;  3M1W A;  1YO0 A;  1G3Z A;  2NXR A;  1FQM A;  2WEJ A;  1AM6 A;  1H9N A;  4K0T A;  3U7C A;  4QJ0 A;  4YYT A;  3N4B A;  4E5Q A;  1CVF A;  1RAY A;  4E3F A;  1TTM A;  1CNJ A;  2NNV A;  1CVD A;  5FDC A;  2POW A;  3U45 X;  4ZX0 A;  4E3H A;  4PZH A;  4Q8Y A;  3MNU A;  4L5V A;  1IF9 A;  4G7A A;  4Q09 A;  3S71 B;  4MO8 A;  2ILI A;  4WUP A;  4QJW A;  5EKM A;  1FQR A;  3TVN X;  2FNK A;  2H15 A;  4FU5 A;  4MLT A;  2EZ7 A;  2CAB A;  5JDV B;  1CNX A;  4JSS A;  5SZ1 A;  3M67 A;  1JD0 A;  3GZ0 A;  5JG3 B;  1LGD A;  3JXH C;  5E5R A;  5EKJ A;  5G01 A;  3K2F A;  3PO6 A;  1OQ5 A;  3M98 A;  1I9N A;  3ZNC A;  3MNA A;  4Q49 A;  2CBA A;  5A25 A;  1I9P A;  4QK1 A;  5G0C A;  1OKM A;  1UGG A;  1FSR A;  3V5G A;  1ZH9 A;  3M1Q A;  5BYI A;  4FPT A;  1IF7 A;  2NNS A;  3TVO X;  1EOU A;  1Z97 A;  4FVO A;  1TBT X;  1HEC A;  5L3O A;  2HNC A;  5FNG A;  1CAZ A;  2CBD A;  2EU2 A;  1AZM A;  1HCA A;  4CNV A;  3CA2 A;  1T9N A;  1G0F A;  3N2P A;  5DSI A;  3M2Z A;  3RYV B;  4YGL A;  4JSA A;  2FNN A;  4QEF A;  5E2M A;  5CAC A;  4G0C A;  4LHI A;  4ILX A;  3RZ7 A;  3DVB A;  3K7K A;  5BRW A;  4YGK A;  3IAI A;  3M5E A;  4KNJ A;  3SAP A;  5EKH A;  5FDI A;  3T83 A;  2NWZ A;  4LP6 A;  5CLU A;  1UGF A;  5E5U A;  4KV0 A;  1UGD A;  3DA2 A;  3M1K A;  2H4N A;  3EFT A;  4K0Z A;  1CRA A;  1LG5 A;  2WEG A;  3T82 A;  1CAO A;  3V2J A;  5AMD A;  3D9Z A;  3RYJ B;  4WW6 A;  1CNG A;  4JSW A;  4ZWZ A;  5FL4 A;  3MHO A;  3S8X A;  4QSI A;  4RN4 A;  3DCC A;  3KNE A;  1Y7W A;  1ZNC A;  5FNL A;  1I8Z A;  4BF6 A;  5FNK A;  3V3F A;  1BN1 A;  3KOK A;  1G4J A;  3KWA A;  3PJJ A;  2AX2 A;  4JS6 A;  1ZGF A;  4DZ9 A;  1G45 A;  2CA2 A;  1CRM A;  4WR7 A;  1RZB A;  4HU1 A;  4KUY A;  1RJ5 A;  4ZWI A;  2FOS A;  3MMF A;  1DMY A;  1YDD A;  4M2R A;  1FR4 A;  3KLD B;  2O4Z A;  3ML2 A;  1XEV A;  1CVB A;  1ZFQ A;  1BV3 A;  3CYU A;  3MNH A;  4Q6D A;  4K1Q A;  5FLT A;  1YDC A;  2QP6 A;  2CBB A;  4QJP A;  2FNM A;  3DD0 A;  7CA2 A;  3QYK A;  4QTL A;  2F14 A;  1I9L A;  4KAP A;  1G1D A;  5JEH B;  3CZV A;  1CA3 A;  5EZT X;  4KUV A;  3IBN A;  4L5U A;  4QJX A;  1G48 A;  1G54 A;  1RAZ A;  5EH8 A;  3MZC A;  3UYN A;  1HEB A;  2Q1B A;  5EH7 A;  3D92 A;  1BCD A;  5G0B A;  1BNT A;  2HOC A;  4QK2 A;  4YGF A;  4Q7W A;  2X7S A;  1G4O A;  3S97 A;  3IGP A;  3DC9 A;  1THK A;  1UGA A;  4RUX A;  4WUQ A;  3N3J A;  4MLX A;  4Y0J A;  4Q90 A;  4Q7P A;  5FLO A;  2POV A;  3M2Y A;  4YWP A;  3M04 A;  3M96 A;  4M2W A;  4Z1E A;  4HEZ A;  5CJF A;  2NN7 A;  1CAM A;  3P3H A;  4XIX A;  1CIN A;  3S77 B;  1Z93 A;  1JCZ A;  1BNQ A;  4TWM A;  1BN4 A;  4E4A A;  1BZM A;  3M5S A;  5JQT A;  4WL4 A;  3NJ9 A;  1CVH A;  3MHC A;  4HF3 A;  3M2N A;  3MNI A;  4XE1 A;  4QIZ A;  4RH2 A;  3DVC A;  3CAJ A;  4Q9Y A;  1CIM A;  1TEU X;  5SZ0 A;  3L14 A;  2OSM A;  2FOV A;  4K13 A;  3R17 B;  1CNB A;  3IBL A;  3B4F A;  4UOV A;  1CAK A;  3LXE A;  3OKU A;  4Q81 A;  5EHW A;  1J9W A;  3K34 A;  4ZX1 A;  1HUG A;  3V2M A;  1HEA A;  3T84 A;  9CA2 A;  4K0S A;  4RFC A;  3DV7 A;  4CA2 A;  1FSQ A;  1FSN A;  3M40 A;  5G03 A;  3RZ8 A;  1HCB A;  4TWL A;  5E2K A;  1KWQ A;  3RYZ A;  6CA2 A;  1DMX A;  5DSL A;  3KKX A;  1H4N A;  1TG3 A;  5FLQ A;  1XEG A;  4Q83 A;  3NI5 A;  4QJO A;  1CA2 A;  2W2J A;  1XPZ A;  3S75 B;  2HKK A;  4KNM A;  4Q99 A;  5LMD A;  3RLD A;  2GEH A;  3F8E A;  1OKN A;  5C8I A;  4R59 A;  3HS4 A;  3OKV A;  4DZ7 A;  1CVE A;  2QOA A;  4R5B A;  1CNW A;  3V3G B;  3IEO A;  2FOU A;  1ZFK A;  3VBD A;  3HFP A;  2NWP A;  1G52 A;  4Q78 A;  1CVA A;  2FOQ A;  1V9E A;  3MDZ A;  3OYQ A;  3FE4 A;  3F7U A;  3P55 A;  4XZ5 A;  4QSJ A;  3RJ7 A;  5DVX A;  4FRC A;  3DCW A;  5FLP A;  4CQ0 A;  1CIL A;  1G6V A;  4R5A A;  1UGB A;  4ITO A;  1TB0 X;  4BF1 A;  3SBH A;  1BN3 A;  4QK3 A;  3DCS A;  3RG4 A;  3DAZ A;  4PYX A;  5FNI A;  3OYS A;  3JXG A;  3MHI A;  3ML5 A;  5FNJ A;  5E28 A;  2NN1 A;  5BRU A;  1YO2 A;  1XQ0 A;  4RUY A;  1I9M A;  1MUA A;  4YGJ A;  5HPJ A;  4FL7 A;  5BRV A;  1CCU A;  1IF5 A;  4Q7S A;  5EHV A;  4Q8X A;  3M3X A;  1HUH A;  5SZ4 A;  3SBI A;  3BET A;  1H9Q A;  1FR7 A;  3DVD A;  4IDR X;  4GL1 X;  5DSQ A;  5DSK A;  1IF8 A;  5JG5 B;  2FW4 A;  4Z0Q A;  1G46 A;  5FL6 A;  3N0N A;  4LU3 A;  1I91 A;  3NB5 A;  4FIK A;  4RIU A;  1HVA A;  4YGN A;  4CNX A;  5SZ6 A;  1V9I C;  1KEQ A;  5BNL A;  4KNI A;  3RZ5 A;  4Z1K A;  4MDM A;  1TE3 X;  4HT0 A;  4Z1N A;  3R16 A;  1HED A;  1CZM A;  5J8Z A;  1RZE A;  1TEQ X;  4FVN A;  4KP5 A;  1RZA A;  3P4V A;  3MWO A;  5DOH A;  3W6I A;  2WEH A;  4XFW A;  5A6H A;  3FW3 A;  1BNU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...