4QJXA

Crystal structure of human carbonic anhydrase isozyme xiii with inhibitor
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
Knots found
sequence length
258
structure length
258
Chain Sequence
SWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase/lyase inhibitor
molecule keywords Carbonic anhydrase 13
publication title Functionalization of Fluorinated Benzenesulfonamides and Their Inhibitory Properties toward Carbonic Anhydrases
pubmed doi rcsb
source organism Homo sapiens
total genus 80
structure length 258
sequence length 258
other databases KnotProt 2.0: S +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2014-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 4qjxA00
1JD0A 1G48A 2POUA 1Y7WA 4JSSA 1ZH9A 3P4VA 1TG3A 1V9EA 3P5AA 3DV7A 1RAZA 4RFCA 3DCWA 4CNXA 1KEQA 1CANA 5EZTX 1G0EA 1MOOA 1DMXA 1HCAA 1H9NA 4RN4A 1CVEA 4ETQC 2X7TA 4M2RA 3IBNA 3NB5A 5FNMA 5EOIA 3T84A 1CA3A 5FL6A 4Q83A 4PXXA 5J8ZA 1Z9YA 5DSJA 4XIXA 2AW1A 4BCWA 3MHIA 3OY0A 1FSNA 1XEGA 1G1DA 3DC9A 4LHIA 3U7CA 5FL4A 1YO2A 4YVYA 4CA2A 2W2JA 3HKUA 4ITOA 4QIZA 2H15A 1FLJA 4XZ5A 4YXUA 1TBTX 5DOGA 4R59A 2FNMA 3M2YA 3QYKA 4DZ7A 4JSAA 5DSLA 3M5EA 4HEZA 2NXSA 4Q08A 2FMZA 1Z97A 4QSJA 3M5SA 4YYTA 1YDDA 9CA2A 4Q49A 5G0BA 1CAYA 4K0SA 3M96A 1BNVA 4WW6A 4COQA 4Z1NA 1HCBA 2FNNA 1AM6A 4Q09A 1YDBA 5JQTA 4E3GA 5JQ0A 1TG9A 1G46A 2NXRA 5EKJA 5C8IA 4PYYA 2GD8A 3P3HA 1CNCA 4WW8A 3M14A 2FOVA 7CA2A 5G0CA 5SZ0A 4ZWZA 1H4NA 5JEGB 2CBCA 4Q99A 3OKVA 4HF3A 5E2KA 3BETA 5EKMA 1TB0X 2QO8A 2NWYA 2FW4A 3V5GA 3M40A 5E2RA 4FIKA 3R17B 2Q38A 4R5AA 5BYIA 1OKMA 1A42A 1THKA 4FU5A 4L5VA 5FNLA 1DCBA 5JESB 3KS3A 1BN4A 4FL7A 5EIJA 3M67A 4E3FA 3ZP9A 5SZ4A 4K0TA 1OKNA 5DVXA 1LG6A 3C7PA 1ZE8A 3EFTA 3S71B 4MLXA 5CJFA 3DD8A 1CVFA 4CNVA 3OIKA 4PQ7A 1XQ0A 3SBHA 4QY3A 2NNVA 2WD2A 4MTYA 4RUZA 3FE4A 4KP8A 3T83A 4JSZA 5EHEA 3MWOA 4QJPA 5FNHA 1CCTA 4LU3A 3IBUA 3V3GB 3IBLA 1EOUA 3DD0A 1XPZA 1IF5A 4E5QA 4DZ9A 1CAMA 2NWOA 4QK1A 1CVBA 3RJ7A 1CNGA 5FL5A 4KNMA 5JGTB 3OKUA 3BL1A 1CAOA 1FSRA 2HKKA 1CNBA 4BF1A 3MHMA 2VVAX 1CCUA 1F2WA 3MNUA 1LZVA 1UGFA 3F8EA 4Q8YA 5FDCA 3RYJB 1JV0A 4Z1KA 4YXOA 1CNYA 1HUHA 2X7UA 5E28A 3DA2A 3MNIA 3F4XA 3DCSA 3K34A 4MDMA 3DVDA 1TE3X 4WR7A 4TWLA 1I9LA 1I9MA 3IGPA 3OYSA 3S72B 3V2MA 5BRVA 1BNQA 1FSQA 3M1WA 2QP6A 4FVOA 3P3JA 3V7XA 1BNWA 2CBDA 2FOUA 2NNSA 5DSIA 2ILIA 4YGNA 5FLRA 1CNXA 1XEVA 3UYNA 4LP6A 5A6HA 1HVAA 1CVAA 1KWQA 1LG5A 3D8WA 5EKHA 1Z93A 3F7UA 1AZMA 1CRAA 2POWA 1FQNA 2NNGA 4MDGA 2Q1BA 1BV3A 4MDLA 8CA2A 1RZAA 5FLSA 4GL1X 4ZWIA 3ZNCA 2FMGA 5SZ5A 1HECA 3RYYA 3KWAA 1RJ6A 3EFIA 3U47A 3JXFA 2ZNCA 2F14A 1KWRA 4CNRA 2WEHA 3HS4A 1IF4A 1I91A 4PYXA 5AMDA 3DCCA 2OSFA 4HT2A 2NN1A 5DSQA 4YGJA 5EH7A 5E2SA 3HKQA 1RJ5A 3MNAA 3MDZA 4QTLA 4XIWA 1CNIA 1FQRA 3MHOA 4QJ0A 3P44A 5CACA 1UGDA 1ZNCA 5FLPA 3PYKA 1IF8A 1KOQA 5SZ2A 1RZBA 3SAXA 5G01A 1URTA 4Q81A 2HL4A 4UOVA 4FVNA 4Q7PA 4FPTA 3M1QA 3S97A 1CALA 3P58A 3S8XA 1TH9A 2QOAA 1LUGA 5DRSA 4ILXA 1G53A 4Q9YA 4ZWXA 3M1JA 4E3HA 2HNCA 3Q31A 3FW3A 1CRMA 3M98A 3N3JA 3IEOA 3GZ0A 3HFPA 4X5SA 1RZCA 4FRCA 5L3OA 1CAIA 3KNEA 5EH5A 2VVBX 3MNJA 5CLUA 3RZ8A 4BF6A 3M04A 4MO8A 5FLOA 5JEPB 3S75B 2FOSA 1BN3A 1CA2A 4ITPA 4Q7SA 1BNTA 4KAPA 1DCAA 4JSWA 1AVNA 4YWPA 4HEWA 4K0ZA 2WEJA 4IWZA 1IF9A 5A25A 3RZ7A 5DSRA 3N2PA 1CVDA 2CBAA 1UGEA 1MUAA 3F7BA 4ZX0A 3RZ1B 4QEFA 1BZMA 4RIUA 3DVBA 3M2XA 5DSMA 3MHCA 4E4AA 5FNJA 3MNKA 3PO6A 2HFWA 3L14A 1CNKA 3M3XA 4G0CA 4XFWA 2X7SA 3KIGA 4M2WA 3VBDA 4KNNA 1YDCA 2NNOA 3RLDA 3T5ZA 3ML5A 3OYQA 4QSAA 3V3FA 3OIMA 1I8ZA 4QJOA 1UGCA 2GEHA 2NN7A 3KOKA 2IT4A 3MMFA 4KV0A 3CYUA 4Q8XA 4HU1A 5DSOA 3KLDB 1V9IC 3M1KA 4KUWA 5SZ7A 1UGGA 2CBBA 1CZMA 1G4JA 1BNUA 3W6HA 4HT0A 5SZ3A 3T85A 4Y0JA 3V3JA 5L6KA 4CNWA 3D93A 5FNKA 1IF6A 2EU2A 2H4NA 3V3IB 1G54A 3KOIA 4K13A 4JS6A 3U3AX 3U45X 3V2JA 4HEYA 1FQLA 3M2NA 5DSKA 4YX4A 4KNJA 4RUXA 3CZVA 1BNMA 3CA2A 3RGEA 1CNJA 4E3DA 4TWMA 3DVCA 4KUVA 5JG5B 4KUYA 5AMGA 1HEDA 1ZSBA 3S74B 1ZGFA 3P5LA 1G0FA 5IPZA 4L5UA 1HEBA 1OKLA 3DBUA 2FOYA 1RAYA 4YGKA 4Q7VA 3TVOX 3DC3A 4RIVA 4ZX1A 4Q87A 3PJJA 4RUYA 1CILA 1ZFQA 4Q6DA 3P55A 1FR4A 3S9TA 3W6IA 1CVHA 1I9PA 1ZSCA 2Q1QA 5FDIA 1G45A 5E2NA 5FLTA 1BN1A 3ML2A 4Q06A 4Q90A 2HD6A 4Q6EA 3HLJA 3B1BA 4WUPA 4YHAA 5JDVB 3MZCA 3CAJA 3OILA 4L5WA 3V3HB 4YGFA 4ZAOA 3B4FA 4Z1EA 4QJWA 5BRWA 4IDRX 3JXGA 4Q78A 3RG3A 3RG4A 2CABA 5HPJA 3NJ9A 1RZDA 4Z1JA 2WEGA 4WUQA 3K7KA 4XE1A 2POVA 3TMJA 3RZ0B 1RZEA 4K1QA 1JCZA 1CAKA 1OQ5A 2NWZA 1KOPA 1BCDA 1G3ZA 1CNWA 5E5RA 1CAZA 5FLQA 5FNGA 3RYZA 5SZ1A 3RYVB 4ZWYA 3IAIA 3HKTA 4E9OX 1YO0A 3KONA 5EHVA 4QSBA 4N16A 3RZ5A 6CA2A 3MYQA 3S78B 3JXHC 3M5TA 4QK2A 3N0NA 3BL0A 5LMDA 5BRUA 3LXEA 2NXTA 4Z0QA 3R16A 4QK3A 4CACA 4HBAA 3D0NA 2HOCA 3MNHA 5E2MA 3SAPA 1LGDA 5E5UA 2CA2A 4QJMA 1YO1A 3K2FA 4WL4A 5AMLA 3FFPX 4R5BA 1TTMA 2OSMA 4MLTA 3N4BA 3IBIA 4PZHA 1G4OA 3DAZA 2WEOA 4Q7WA 2WD3A 1I9QA 4CQ0A 4Q07A 3T82A 1H9QA 4KP5A 5DSPA 4Q8ZA 1T9NA 2EU3A 4QIYA 2ABEA 2FNKA 3M2ZA 1TEUX 3NI5A 1J9WA 1CINA 1DMYA 1I90A 3TVNX 3S77B 4KNIA 2O4ZA 2EZ7A 4G7AA 5EH8A 3S73B 4YGLA 3UYQA 1UGBA 4M2VA 3T5UA 1FR7A 1G6VA 4RFDA 4QJXA 5JEHB 3RYXB 5JGSB 1I9OA 3HKNA 1ZFKA 4M2UA 3SBIA 5EHWA 5DOHA 1CCSA 1TEQX 3D92A 1BICA 1HUGA 3S76A 1CNHA 5BNLA 1CAJA 5G03A 4E49A 12CAA 2NWPA 1CAHA 1CIMA 4QSIA 3KKXA 5DSNA 4N0XB 1G52A 1ZSAA 2CBEA 3MHLA 1UGAA 2NMXA 4RH2A 4Q0LA 1CVCA 4YXIA 1IF7A 3D9ZA 1YDAA 2FOQA 1BNNA 1HEAA 5JG3B 5SZ6A 4C3TA 5CA2A 1ZGEA 1FQMA 2AX2A 1I9NA 5FNIA
chains in the Genus database with same CATH superfamily
1JD0A 1G48A 2POUA 1Y7WA 4JSSA 1ZH9A 3P4VA 1TG3A 1V9EA 3P5AA 3DV7A 1RAZA 4RFCA 3DCWA 4CNXA 1KEQA 1CANA 5EZTX 1G0EA 1MOOA 1DMXA 1HCAA 1H9NA 4RN4A 1CVEA 4ETQC 2X7TA 4M2RA 3IBNA 3NB5A 5FNMA 5EOIA 3T84A 1CA3A 5FL6A 4Q83A 4PXXA 5J8ZA 1Z9YA 5DSJA 4XIXA 2AW1A 4BCWA 3MHIA 3OY0A 1FSNA 1XEGA 1G1DA 3DC9A 4LHIA 3U7CA 5FL4A 1YO2A 4YVYA 4CA2A 2W2JA 3HKUA 4ITOA 4QIZA 2H15A 1FLJA 4XZ5A 4YXUA 1TBTX 5DOGA 4R59A 2FNMA 3M2YA 3QYKA 4DZ7A 4JSAA 5DSLA 3M5EA 4HEZA 2NXSA 4Q08A 2FMZA 1Z97A 4QSJA 3M5SA 4YYTA 1YDDA 9CA2A 4Q49A 5G0BA 1CAYA 4K0SA 3M96A 1BNVA 4WW6A 4COQA 4Z1NA 1HCBA 2FNNA 1AM6A 4Q09A 1YDBA 5JQTA 4E3GA 5JQ0A 1TG9A 1G46A 2NXRA 5EKJA 5C8IA 4PYYA 2GD8A 3P3HA 1CNCA 4WW8A 3M14A 2FOVA 7CA2A 5G0CA 5SZ0A 4ZWZA 1H4NA 5JEGB 2CBCA 4Q99A 3OKVA 4HF3A 5E2KA 3BETA 5EKMA 1TB0X 2QO8A 2NWYA 2FW4A 3V5GA 3M40A 5E2RA 4FIKA 3R17B 2Q38A 4R5AA 5BYIA 1OKMA 1A42A 1THKA 4FU5A 4L5VA 5FNLA 1DCBA 5JESB 3KS3A 1BN4A 4FL7A 5EIJA 3M67A 4E3FA 3ZP9A 5SZ4A 4K0TA 1OKNA 5DVXA 1LG6A 3C7PA 1ZE8A 3EFTA 3S71B 4MLXA 5CJFA 3DD8A 1CVFA 4CNVA 3OIKA 4PQ7A 1XQ0A 3SBHA 4QY3A 2NNVA 2WD2A 4MTYA 4RUZA 3FE4A 4KP8A 3T83A 4JSZA 5EHEA 3MWOA 4QJPA 5FNHA 1CCTA 4LU3A 3IBUA 3V3GB 3IBLA 1EOUA 3DD0A 1XPZA 1IF5A 4E5QA 4DZ9A 1CAMA 2NWOA 4QK1A 1CVBA 3RJ7A 1CNGA 5FL5A 4KNMA 5JGTB 3OKUA 3BL1A 1CAOA 1FSRA 2HKKA 1CNBA 4BF1A 3MHMA 2VVAX 1CCUA 1F2WA 3MNUA 1LZVA 1UGFA 3F8EA 4Q8YA 5FDCA 3RYJB 1JV0A 4Z1KA 4YXOA 1CNYA 1HUHA 2X7UA 5E28A 3DA2A 3MNIA 3F4XA 3DCSA 3K34A 4MDMA 3DVDA 1TE3X 4WR7A 4TWLA 1I9LA 1I9MA 3IGPA 3OYSA 3S72B 3V2MA 5BRVA 1BNQA 1FSQA 3M1WA 2QP6A 4FVOA 3P3JA 3V7XA 1BNWA 2CBDA 2FOUA 2NNSA 5DSIA 2ILIA 4YGNA 5FLRA 1CNXA 1XEVA 3UYNA 4LP6A 5A6HA 1HVAA 1CVAA 1KWQA 1LG5A 3D8WA 5EKHA 1Z93A 3F7UA 1AZMA 1CRAA 2POWA 1FQNA 2NNGA 4MDGA 2Q1BA 1BV3A 4MDLA 8CA2A 1RZAA 5FLSA 4GL1X 4ZWIA 3ZNCA 2FMGA 5SZ5A 1HECA 3RYYA 3KWAA 1RJ6A 3EFIA 3U47A 3JXFA 2ZNCA 2F14A 1KWRA 4CNRA 2WEHA 3HS4A 1IF4A 1I91A 4PYXA 5AMDA 3DCCA 2OSFA 4HT2A 2NN1A 5DSQA 4YGJA 5EH7A 5E2SA 3HKQA 1RJ5A 3MNAA 3MDZA 4QTLA 4XIWA 1CNIA 1FQRA 3MHOA 4QJ0A 3P44A 5CACA 1UGDA 1ZNCA 5FLPA 3PYKA 1IF8A 1KOQA 5SZ2A 1RZBA 3SAXA 5G01A 1URTA 4Q81A 2HL4A 4UOVA 4FVNA 4Q7PA 4FPTA 3M1QA 3S97A 1CALA 3P58A 3S8XA 1TH9A 2QOAA 1LUGA 5DRSA 4ILXA 1G53A 4Q9YA 4ZWXA 3M1JA 4E3HA 2HNCA 3Q31A 3FW3A 1CRMA 3M98A 3N3JA 3IEOA 3GZ0A 3HFPA 4X5SA 1RZCA 4FRCA 5L3OA 1CAIA 3KNEA 5EH5A 2VVBX 3MNJA 5CLUA 3RZ8A 4BF6A 3M04A 4MO8A 5FLOA 5JEPB 3S75B 2FOSA 1BN3A 1CA2A 4ITPA 4Q7SA 1BNTA 4KAPA 1DCAA 4JSWA 1AVNA 4YWPA 4HEWA 4K0ZA 2WEJA 4IWZA 1IF9A 5A25A 3RZ7A 5DSRA 3N2PA 1CVDA 2CBAA 1UGEA 1MUAA 3F7BA 4ZX0A 3RZ1B 4QEFA 1BZMA 4RIUA 3DVBA 3M2XA 5DSMA 3MHCA 4E4AA 5FNJA 3MNKA 3PO6A 2HFWA 3L14A 1CNKA 3M3XA 4G0CA 4XFWA 2X7SA 3KIGA 4M2WA 3VBDA 4KNNA 1YDCA 2NNOA 3RLDA 3T5ZA 3ML5A 3OYQA 4QSAA 3V3FA 3OIMA 1I8ZA 4QJOA 1UGCA 2GEHA 2NN7A 3KOKA 2IT4A 3MMFA 4KV0A 3CYUA 4Q8XA 4HU1A 5DSOA 3KLDB 1V9IC 3M1KA 4KUWA 5SZ7A 1UGGA 2CBBA 1CZMA 1G4JA 1BNUA 3W6HA 4HT0A 5SZ3A 3T85A 4Y0JA 3V3JA 5L6KA 4CNWA 3D93A 5FNKA 1IF6A 2EU2A 2H4NA 3V3IB 1G54A 3KOIA 4K13A 4JS6A 3U3AX 3U45X 3V2JA 4HEYA 1FQLA 3M2NA 5DSKA 4YX4A 4KNJA 4RUXA 3CZVA 1BNMA 3CA2A 3RGEA 1CNJA 4E3DA 4TWMA 3DVCA 4KUVA 5JG5B 4KUYA 5AMGA 1HEDA 1ZSBA 3S74B 1ZGFA 3P5LA 1G0FA 5IPZA 4L5UA 1HEBA 1OKLA 3DBUA 2FOYA 1RAYA 4YGKA 4Q7VA 3TVOX 3DC3A 4RIVA 4ZX1A 4Q87A 3PJJA 4RUYA 1CILA 1ZFQA 4Q6DA 3P55A 1FR4A 3S9TA 3W6IA 1CVHA 1I9PA 1ZSCA 2Q1QA 5FDIA 1G45A 5E2NA 5FLTA 1BN1A 3ML2A 4Q06A 4Q90A 2HD6A 4Q6EA 3HLJA 3B1BA 4WUPA 4YHAA 5JDVB 3MZCA 3CAJA 3OILA 4L5WA 3V3HB 4YGFA 4ZAOA 3B4FA 4Z1EA 4QJWA 5BRWA 4IDRX 3JXGA 4Q78A 3RG3A 3RG4A 2CABA 5HPJA 3NJ9A 1RZDA 4Z1JA 2WEGA 4WUQA 3K7KA 4XE1A 2POVA 3TMJA 3RZ0B 1RZEA 4K1QA 1JCZA 1CAKA 1OQ5A 2NWZA 1KOPA 1BCDA 1G3ZA 1CNWA 5E5RA 1CAZA 5FLQA 5FNGA 3RYZA 5SZ1A 3RYVB 4ZWYA 3IAIA 3HKTA 4E9OX 1YO0A 3KONA 5EHVA 4QSBA 4N16A 3RZ5A 6CA2A 3MYQA 3S78B 3JXHC 3M5TA 4QK2A 3N0NA 3BL0A 5LMDA 5BRUA 3LXEA 2NXTA 4Z0QA 3R16A 4QK3A 4CACA 4HBAA 3D0NA 2HOCA 3MNHA 5E2MA 3SAPA 1LGDA 5E5UA 2CA2A 4QJMA 1YO1A 3K2FA 4WL4A 5AMLA 3FFPX 4R5BA 1TTMA 2OSMA 4MLTA 3N4BA 3IBIA 4PZHA 1G4OA 3DAZA 2WEOA 4Q7WA 2WD3A 1I9QA 4CQ0A 4Q07A 3T82A 1H9QA 4KP5A 5DSPA 4Q8ZA 1T9NA 2EU3A 4QIYA 2ABEA 2FNKA 3M2ZA 1TEUX 3NI5A 1J9WA 1CINA 1DMYA 1I90A 3TVNX 3S77B 4KNIA 2O4ZA 2EZ7A 4G7AA 5EH8A 3S73B 4YGLA 3UYQA 1UGBA 4M2VA 3T5UA 1FR7A 1G6VA 4RFDA 4QJXA 5JEHB 3RYXB 5JGSB 1I9OA 3HKNA 1ZFKA 4M2UA 3SBIA 5EHWA 5DOHA 1CCSA 1TEQX 3D92A 1BICA 1HUGA 3S76A 1CNHA 5BNLA 1CAJA 5G03A 4E49A 12CAA 2NWPA 1CAHA 1CIMA 4QSIA 3KKXA 5DSNA 4N0XB 1G52A 1ZSAA 2CBEA 3MHLA 1UGAA 2NMXA 4RH2A 4Q0LA 1CVCA 4YXIA 1IF7A 3D9ZA 1YDAA 2FOQA 1BNNA 1HEAA 5JG3B 5SZ6A 4C3TA 5CA2A 1ZGEA 1FQMA 2AX2A 1I9NA 5FNIA
chains in the Genus database with same CATH topology
1JD0A 1G48A 2POUA 1Y7WA 4JSSA 1ZH9A 3P4VA 1TG3A 1V9EA 3P5AA 3DV7A 1RAZA 4RFCA 3DCWA 4CNXA 1KEQA 1CANA 5EZTX 1G0EA 1MOOA 1DMXA 1HCAA 1H9NA 4RN4A 1CVEA 4ETQC 2X7TA 4M2RA 3IBNA 3NB5A 5FNMA 5EOIA 3T84A 1CA3A 5FL6A 4Q83A 4PXXA 5J8ZA 1Z9YA 5DSJA 4XIXA 2AW1A 4BCWA 3MHIA 3OY0A 1FSNA 1XEGA 1G1DA 3DC9A 4LHIA 3U7CA 5FL4A 1YO2A 4YVYA 4CA2A 2W2JA 3HKUA 4ITOA 4QIZA 2H15A 1FLJA 4XZ5A 4YXUA 1TBTX 5DOGA 4R59A 2FNMA 3M2YA 3QYKA 4DZ7A 4JSAA 5DSLA 3M5EA 4HEZA 2NXSA 4Q08A 2FMZA 1Z97A 4QSJA 3M5SA 4YYTA 1YDDA 9CA2A 4Q49A 5G0BA 1CAYA 4K0SA 3M96A 1BNVA 4WW6A 4COQA 4Z1NA 1HCBA 2FNNA 1AM6A 4Q09A 1YDBA 5JQTA 4E3GA 5JQ0A 1TG9A 1G46A 2NXRA 5EKJA 5C8IA 4PYYA 2GD8A 3P3HA 1CNCA 4WW8A 3M14A 2FOVA 7CA2A 5G0CA 5SZ0A 4ZWZA 1H4NA 5JEGB 2CBCA 4Q99A 3OKVA 4HF3A 5E2KA 3BETA 5EKMA 1TB0X 2QO8A 2NWYA 2FW4A 3V5GA 3M40A 5E2RA 4FIKA 3R17B 2Q38A 4R5AA 5BYIA 1OKMA 1A42A 1THKA 4FU5A 4L5VA 5FNLA 1DCBA 5JESB 3KS3A 1BN4A 4FL7A 5EIJA 3M67A 4E3FA 3ZP9A 5SZ4A 4K0TA 1OKNA 5DVXA 1LG6A 3C7PA 1ZE8A 3EFTA 3S71B 4MLXA 5CJFA 3DD8A 1CVFA 4CNVA 3OIKA 4PQ7A 1XQ0A 3SBHA 4QY3A 2NNVA 2WD2A 4MTYA 4RUZA 3FE4A 4KP8A 3T83A 4JSZA 5EHEA 3MWOA 4QJPA 5FNHA 1CCTA 4LU3A 3IBUA 3V3GB 3IBLA 1EOUA 3DD0A 1XPZA 1IF5A 4E5QA 4DZ9A 1CAMA 2NWOA 4QK1A 1CVBA 3RJ7A 1CNGA 5FL5A 4KNMA 5JGTB 3OKUA 3BL1A 1CAOA 1FSRA 2HKKA 1CNBA 4BF1A 3MHMA 2VVAX 1CCUA 1F2WA 3MNUA 1LZVA 1UGFA 3F8EA 4Q8YA 5FDCA 3RYJB 1JV0A 4Z1KA 4YXOA 1CNYA 1HUHA 2X7UA 5E28A 3DA2A 3MNIA 3F4XA 3DCSA 3K34A 4MDMA 3DVDA 1TE3X 4WR7A 4TWLA 1I9LA 1I9MA 3IGPA 3OYSA 3S72B 3V2MA 5BRVA 1BNQA 1FSQA 3M1WA 2QP6A 4FVOA 3P3JA 3V7XA 1BNWA 2CBDA 2FOUA 2NNSA 5DSIA 2ILIA 4YGNA 5FLRA 1CNXA 1XEVA 3UYNA 4LP6A 5A6HA 1HVAA 1CVAA 1KWQA 1LG5A 3D8WA 5EKHA 1Z93A 3F7UA 1AZMA 1CRAA 2POWA 1FQNA 2NNGA 4MDGA 2Q1BA 1BV3A 4MDLA 8CA2A 1RZAA 5FLSA 4GL1X 4ZWIA 3ZNCA 2FMGA 5SZ5A 1HECA 3RYYA 3KWAA 1RJ6A 3EFIA 3U47A 3JXFA 2ZNCA 2F14A 1KWRA 4CNRA 2WEHA 3HS4A 1IF4A 1I91A 4PYXA 5AMDA 3DCCA 2OSFA 4HT2A 2NN1A 5DSQA 4YGJA 5EH7A 5E2SA 3HKQA 1RJ5A 3MNAA 3MDZA 4QTLA 4XIWA 1CNIA 1FQRA 3MHOA 4QJ0A 3P44A 5CACA 1UGDA 1ZNCA 5FLPA 3PYKA 1IF8A 1KOQA 5SZ2A 1RZBA 3SAXA 5G01A 1URTA 4Q81A 2HL4A 4UOVA 4FVNA 4Q7PA 4FPTA 3M1QA 3S97A 1CALA 3P58A 3S8XA 1TH9A 2QOAA 1LUGA 5DRSA 4ILXA 1G53A 4Q9YA 4ZWXA 3M1JA 4E3HA 2HNCA 3Q31A 3FW3A 1CRMA 3M98A 3N3JA 3IEOA 3GZ0A 3HFPA 4X5SA 1RZCA 4FRCA 5L3OA 1CAIA 3KNEA 5EH5A 2VVBX 3MNJA 5CLUA 3RZ8A 4BF6A 3M04A 4MO8A 5FLOA 5JEPB 3S75B 2FOSA 1BN3A 1CA2A 4ITPA 4Q7SA 1BNTA 4KAPA 1DCAA 4JSWA 1AVNA 4YWPA 4HEWA 4K0ZA 2WEJA 4IWZA 1IF9A 5A25A 3RZ7A 5DSRA 3N2PA 1CVDA 2CBAA 1UGEA 1MUAA 3F7BA 4ZX0A 3RZ1B 4QEFA 1BZMA 4RIUA 3DVBA 3M2XA 5DSMA 3MHCA 4E4AA 5FNJA 3MNKA 3PO6A 2HFWA 3L14A 1CNKA 3M3XA 4G0CA 4XFWA 2X7SA 3KIGA 4M2WA 3VBDA 4KNNA 1YDCA 2NNOA 3RLDA 3T5ZA 3ML5A 3OYQA 4QSAA 3V3FA 3OIMA 1I8ZA 4QJOA 1UGCA 2GEHA 2NN7A 3KOKA 2IT4A 3MMFA 4KV0A 3CYUA 4Q8XA 4HU1A 5DSOA 3KLDB 1V9IC 3M1KA 4KUWA 5SZ7A 1UGGA 2CBBA 1CZMA 1G4JA 1BNUA 3W6HA 4HT0A 5SZ3A 3T85A 4Y0JA 3V3JA 5L6KA 4CNWA 3D93A 5FNKA 1IF6A 2EU2A 2H4NA 3V3IB 1G54A 3KOIA 4K13A 4JS6A 3U3AX 3U45X 3V2JA 4HEYA 1FQLA 3M2NA 5DSKA 4YX4A 4KNJA 4RUXA 3CZVA 1BNMA 3CA2A 3RGEA 1CNJA 4E3DA 4TWMA 3DVCA 4KUVA 5JG5B 4KUYA 5AMGA 1HEDA 1ZSBA 3S74B 1ZGFA 3P5LA 1G0FA 5IPZA 4L5UA 1HEBA 1OKLA 3DBUA 2FOYA 1RAYA 4YGKA 4Q7VA 3TVOX 3DC3A 4RIVA 4ZX1A 4Q87A 3PJJA 4RUYA 1CILA 1ZFQA 4Q6DA 3P55A 1FR4A 3S9TA 3W6IA 1CVHA 1I9PA 1ZSCA 2Q1QA 5FDIA 1G45A 5E2NA 5FLTA 1BN1A 3ML2A 4Q06A 4Q90A 2HD6A 4Q6EA 3HLJA 3B1BA 4WUPA 4YHAA 5JDVB 3MZCA 3CAJA 3OILA 4L5WA 3V3HB 4YGFA 4ZAOA 3B4FA 4Z1EA 4QJWA 5BRWA 4IDRX 3JXGA 4Q78A 3RG3A 3RG4A 2CABA 5HPJA 3NJ9A 1RZDA 4Z1JA 2WEGA 4WUQA 3K7KA 4XE1A 2POVA 3TMJA 3RZ0B 1RZEA 4K1QA 1JCZA 1CAKA 1OQ5A 2NWZA 1KOPA 1BCDA 1G3ZA 1CNWA 5E5RA 1CAZA 5FLQA 5FNGA 3RYZA 5SZ1A 3RYVB 4ZWYA 3IAIA 3HKTA 4E9OX 1YO0A 3KONA 5EHVA 4QSBA 4N16A 3RZ5A 6CA2A 3MYQA 3S78B 3JXHC 3M5TA 4QK2A 3N0NA 3BL0A 5LMDA 5BRUA 3LXEA 2NXTA 4Z0QA 3R16A 4QK3A 4CACA 4HBAA 3D0NA 2HOCA 3MNHA 5E2MA 3SAPA 1LGDA 5E5UA 2CA2A 4QJMA 1YO1A 3K2FA 4WL4A 5AMLA 3FFPX 4R5BA 1TTMA 2OSMA 4MLTA 3N4BA 3IBIA 4PZHA 1G4OA 3DAZA 2WEOA 4Q7WA 2WD3A 1I9QA 4CQ0A 4Q07A 3T82A 1H9QA 4KP5A 5DSPA 4Q8ZA 1T9NA 2EU3A 4QIYA 2ABEA 2FNKA 3M2ZA 1TEUX 3NI5A 1J9WA 1CINA 1DMYA 1I90A 3TVNX 3S77B 4KNIA 2O4ZA 2EZ7A 4G7AA 5EH8A 3S73B 4YGLA 3UYQA 1UGBA 4M2VA 3T5UA 1FR7A 1G6VA 4RFDA 4QJXA 5JEHB 3RYXB 5JGSB 1I9OA 3HKNA 1ZFKA 4M2UA 3SBIA 5EHWA 5DOHA 1CCSA 1TEQX 3D92A 1BICA 1HUGA 3S76A 1CNHA 5BNLA 1CAJA 5G03A 4E49A 12CAA 2NWPA 1CAHA 1CIMA 4QSIA 3KKXA 5DSNA 4N0XB 1G52A 1ZSAA 2CBEA 3MHLA 1UGAA 2NMXA 4RH2A 4Q0LA 1CVCA 4YXIA 1IF7A 3D9ZA 1YDAA 2FOQA 1BNNA 1HEAA 5JG3B 5SZ6A 4C3TA 5CA2A 1ZGEA 1FQMA 2AX2A 1I9NA 5FNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JD0 A;  1G48 A;  2POU A;  1Y7W A;  4JSS A;  1ZH9 A;  3P4V A;  1TG3 A;  1V9E A;  3P5A A;  3DV7 A;  1RAZ A;  4RFC A;  3DCW A;  4CNX A;  1KEQ A;  1CAN A;  5EZT X;  1G0E A;  1MOO A;  1DMX A;  1HCA A;  1H9N A;  4RN4 A;  1CVE A;  4ETQ C;  2X7T A;  4M2R A;  3IBN A;  3NB5 A;  5FNM A;  5EOI A;  3T84 A;  1CA3 A;  5FL6 A;  4Q83 A;  4PXX A;  5J8Z A;  1Z9Y A;  5DSJ A;  4XIX A;  2AW1 A;  4BCW A;  3MHI A;  3OY0 A;  1FSN A;  1XEG A;  1G1D A;  3DC9 A;  4LHI A;  3U7C A;  5FL4 A;  1YO2 A;  4YVY A;  4CA2 A;  2W2J A;  3HKU A;  4ITO A;  4QIZ A;  2H15 A;  1FLJ A;  4XZ5 A;  4YXU A;  1TBT X;  5DOG A;  4R59 A;  2FNM A;  3M2Y A;  3QYK A;  4DZ7 A;  4JSA A;  5DSL A;  3M5E A;  4HEZ A;  2NXS A;  4Q08 A;  2FMZ A;  1Z97 A;  4QSJ A;  3M5S A;  4YYT A;  1YDD A;  9CA2 A;  4Q49 A;  5G0B A;  1CAY A;  4K0S A;  3M96 A;  1BNV A;  4WW6 A;  4COQ A;  4Z1N A;  1HCB A;  2FNN A;  1AM6 A;  4Q09 A;  1YDB A;  5JQT A;  4E3G A;  5JQ0 A;  1TG9 A;  1G46 A;  2NXR A;  5EKJ A;  5C8I A;  4PYY A;  2GD8 A;  3P3H A;  1CNC A;  4WW8 A;  3M14 A;  2FOV A;  7CA2 A;  5G0C A;  5SZ0 A;  4ZWZ A;  1H4N A;  5JEG B;  2CBC A;  4Q99 A;  3OKV A;  4HF3 A;  5E2K A;  3BET A;  5EKM A;  1TB0 X;  2QO8 A;  2NWY A;  2FW4 A;  3V5G A;  3M40 A;  5E2R A;  4FIK A;  3R17 B;  2Q38 A;  4R5A A;  5BYI A;  1OKM A;  1A42 A;  1THK A;  4FU5 A;  4L5V A;  5FNL A;  1DCB A;  5JES B;  3KS3 A;  1BN4 A;  4FL7 A;  5EIJ A;  3M67 A;  4E3F A;  3ZP9 A;  5SZ4 A;  4K0T A;  1OKN A;  5DVX A;  1LG6 A;  3C7P A;  1ZE8 A;  3EFT A;  3S71 B;  4MLX A;  5CJF A;  3DD8 A;  1CVF A;  4CNV A;  3OIK A;  4PQ7 A;  1XQ0 A;  3SBH A;  4QY3 A;  2NNV A;  2WD2 A;  4MTY A;  4RUZ A;  3FE4 A;  4KP8 A;  3T83 A;  4JSZ A;  5EHE A;  3MWO A;  4QJP A;  5FNH A;  1CCT A;  4LU3 A;  3IBU A;  3V3G B;  3IBL A;  1EOU A;  3DD0 A;  1XPZ A;  1IF5 A;  4E5Q A;  4DZ9 A;  1CAM A;  2NWO A;  4QK1 A;  1CVB A;  3RJ7 A;  1CNG A;  5FL5 A;  4KNM A;  5JGT B;  3OKU A;  3BL1 A;  1CAO A;  1FSR A;  2HKK A;  1CNB A;  4BF1 A;  3MHM A;  2VVA X;  1CCU A;  1F2W A;  3MNU A;  1LZV A;  1UGF A;  3F8E A;  4Q8Y A;  5FDC A;  3RYJ B;  1JV0 A;  4Z1K A;  4YXO A;  1CNY A;  1HUH A;  2X7U A;  5E28 A;  3DA2 A;  3MNI A;  3F4X A;  3DCS A;  3K34 A;  4MDM A;  3DVD A;  1TE3 X;  4WR7 A;  4TWL A;  1I9L A;  1I9M A;  3IGP A;  3OYS A;  3S72 B;  3V2M A;  5BRV A;  1BNQ A;  1FSQ A;  3M1W A;  2QP6 A;  4FVO A;  3P3J A;  3V7X A;  1BNW A;  2CBD A;  2FOU A;  2NNS A;  5DSI A;  2ILI A;  4YGN A;  5FLR A;  1CNX A;  1XEV A;  3UYN A;  4LP6 A;  5A6H A;  1HVA A;  1CVA A;  1KWQ A;  1LG5 A;  3D8W A;  5EKH A;  1Z93 A;  3F7U A;  1AZM A;  1CRA A;  2POW A;  1FQN A;  2NNG A;  4MDG A;  2Q1B A;  1BV3 A;  4MDL A;  8CA2 A;  1RZA A;  5FLS A;  4GL1 X;  4ZWI A;  3ZNC A;  2FMG A;  5SZ5 A;  1HEC A;  3RYY A;  3KWA A;  1RJ6 A;  3EFI A;  3U47 A;  3JXF A;  2ZNC A;  2F14 A;  1KWR A;  4CNR A;  2WEH A;  3HS4 A;  1IF4 A;  1I91 A;  4PYX A;  5AMD A;  3DCC A;  2OSF A;  4HT2 A;  2NN1 A;  5DSQ A;  4YGJ A;  5EH7 A;  5E2S A;  3HKQ A;  1RJ5 A;  3MNA A;  3MDZ A;  4QTL A;  4XIW A;  1CNI A;  1FQR A;  3MHO A;  4QJ0 A;  3P44 A;  5CAC A;  1UGD A;  1ZNC A;  5FLP A;  3PYK A;  1IF8 A;  1KOQ A;  5SZ2 A;  1RZB A;  3SAX A;  5G01 A;  1URT A;  4Q81 A;  2HL4 A;  4UOV A;  4FVN A;  4Q7P A;  4FPT A;  3M1Q A;  3S97 A;  1CAL A;  3P58 A;  3S8X A;  1TH9 A;  2QOA A;  1LUG A;  5DRS A;  4ILX A;  1G53 A;  4Q9Y A;  4ZWX A;  3M1J A;  4E3H A;  2HNC A;  3Q31 A;  3FW3 A;  1CRM A;  3M98 A;  3N3J A;  3IEO A;  3GZ0 A;  3HFP A;  4X5S A;  1RZC A;  4FRC A;  5L3O A;  1CAI A;  3KNE A;  5EH5 A;  2VVB X;  3MNJ A;  5CLU A;  3RZ8 A;  4BF6 A;  3M04 A;  4MO8 A;  5FLO A;  5JEP B;  3S75 B;  2FOS A;  1BN3 A;  1CA2 A;  4ITP A;  4Q7S A;  1BNT A;  4KAP A;  1DCA A;  4JSW A;  1AVN A;  4YWP A;  4HEW A;  4K0Z A;  2WEJ A;  4IWZ A;  1IF9 A;  5A25 A;  3RZ7 A;  5DSR A;  3N2P A;  1CVD A;  2CBA A;  1UGE A;  1MUA A;  3F7B A;  4ZX0 A;  3RZ1 B;  4QEF A;  1BZM A;  4RIU A;  3DVB A;  3M2X A;  5DSM A;  3MHC A;  4E4A A;  5FNJ A;  3MNK A;  3PO6 A;  2HFW A;  3L14 A;  1CNK A;  3M3X A;  4G0C A;  4XFW A;  2X7S A;  3KIG A;  4M2W A;  3VBD A;  4KNN A;  1YDC A;  2NNO A;  3RLD A;  3T5Z A;  3ML5 A;  3OYQ A;  4QSA A;  3V3F A;  3OIM A;  1I8Z A;  4QJO A;  1UGC A;  2GEH A;  2NN7 A;  3KOK A;  2IT4 A;  3MMF A;  4KV0 A;  3CYU A;  4Q8X A;  4HU1 A;  5DSO A;  3KLD B;  1V9I C;  3M1K A;  4KUW A;  5SZ7 A;  1UGG A;  2CBB A;  1CZM A;  1G4J A;  1BNU A;  3W6H A;  4HT0 A;  5SZ3 A;  3T85 A;  4Y0J A;  3V3J A;  5L6K A;  4CNW A;  3D93 A;  5FNK A;  1IF6 A;  2EU2 A;  2H4N A;  3V3I B;  1G54 A;  3KOI A;  4K13 A;  4JS6 A;  3U3A X;  3U45 X;  3V2J A;  4HEY A;  1FQL A;  3M2N A;  5DSK A;  4YX4 A;  4KNJ A;  4RUX A;  3CZV A;  1BNM A;  3CA2 A;  3RGE A;  1CNJ A;  4E3D A;  4TWM A;  3DVC A;  4KUV A;  5JG5 B;  4KUY A;  5AMG A;  1HED A;  1ZSB A;  3S74 B;  1ZGF A;  3P5L A;  1G0F A;  5IPZ A;  4L5U A;  1HEB A;  1OKL A;  3DBU A;  2FOY A;  1RAY A;  4YGK A;  4Q7V A;  3TVO X;  3DC3 A;  4RIV A;  4ZX1 A;  4Q87 A;  3PJJ A;  4RUY A;  1CIL A;  1ZFQ A;  4Q6D A;  3P55 A;  1FR4 A;  3S9T A;  3W6I A;  1CVH A;  1I9P A;  1ZSC A;  2Q1Q A;  5FDI A;  1G45 A;  5E2N A;  5FLT A;  1BN1 A;  3ML2 A;  4Q06 A;  4Q90 A;  2HD6 A;  4Q6E A;  3HLJ A;  3B1B A;  4WUP A;  4YHA A;  5JDV B;  3MZC A;  3CAJ A;  3OIL A;  4L5W A;  3V3H B;  4YGF A;  4ZAO A;  3B4F A;  4Z1E A;  4QJW A;  5BRW A;  4IDR X;  3JXG A;  4Q78 A;  3RG3 A;  3RG4 A;  2CAB A;  5HPJ A;  3NJ9 A;  1RZD A;  4Z1J A;  2WEG A;  4WUQ A;  3K7K A;  4XE1 A;  2POV A;  3TMJ A;  3RZ0 B;  1RZE A;  4K1Q A;  1JCZ A;  1CAK A;  1OQ5 A;  2NWZ A;  1KOP A;  1BCD A;  1G3Z A;  1CNW A;  5E5R A;  1CAZ A;  5FLQ A;  5FNG A;  3RYZ A;  5SZ1 A;  3RYV B;  4ZWY A;  3IAI A;  3HKT A;  4E9O X;  1YO0 A;  3KON A;  5EHV A;  4QSB A;  4N16 A;  3RZ5 A;  6CA2 A;  3MYQ A;  3S78 B;  3JXH C;  3M5T A;  4QK2 A;  3N0N A;  3BL0 A;  5LMD A;  5BRU A;  3LXE A;  2NXT A;  4Z0Q A;  3R16 A;  4QK3 A;  4CAC A;  4HBA A;  3D0N A;  2HOC A;  3MNH A;  5E2M A;  3SAP A;  1LGD A;  5E5U A;  2CA2 A;  4QJM A;  1YO1 A;  3K2F A;  4WL4 A;  5AML A;  3FFP X;  4R5B A;  1TTM A;  2OSM A;  4MLT A;  3N4B A;  3IBI A;  4PZH A;  1G4O A;  3DAZ A;  2WEO A;  4Q7W A;  2WD3 A;  1I9Q A;  4CQ0 A;  4Q07 A;  3T82 A;  1H9Q A;  4KP5 A;  5DSP A;  4Q8Z A;  1T9N A;  2EU3 A;  4QIY A;  2ABE A;  2FNK A;  3M2Z A;  1TEU X;  3NI5 A;  1J9W A;  1CIN A;  1DMY A;  1I90 A;  3TVN X;  3S77 B;  4KNI A;  2O4Z A;  2EZ7 A;  4G7A A;  5EH8 A;  3S73 B;  4YGL A;  3UYQ A;  1UGB A;  4M2V A;  3T5U A;  1FR7 A;  1G6V A;  4RFD A;  4QJX A;  5JEH B;  3RYX B;  5JGS B;  1I9O A;  3HKN A;  1ZFK A;  4M2U A;  3SBI A;  5EHW A;  5DOH A;  1CCS A;  1TEQ X;  3D92 A;  1BIC A;  1HUG A;  3S76 A;  1CNH A;  5BNL A;  1CAJ A;  5G03 A;  4E49 A;  12CA A;  2NWP A;  1CAH A;  1CIM A;  4QSI A;  3KKX A;  5DSN A;  4N0X B;  1G52 A;  1ZSA A;  2CBE A;  3MHL A;  1UGA A;  2NMX A;  4RH2 A;  4Q0L A;  1CVC A;  4YXI A;  1IF7 A;  3D9Z A;  1YDA A;  2FOQ A;  1BNN A;  1HEA A;  5JG3 B;  5SZ6 A;  4C3T A;  5CA2 A;  1ZGE A;  1FQM A;  2AX2 A;  1I9N A;  5FNI A; 
#chains in the Genus database with same CATH topology
 1JD0 A;  1G48 A;  2POU A;  1Y7W A;  4JSS A;  1ZH9 A;  3P4V A;  1TG3 A;  1V9E A;  3P5A A;  3DV7 A;  1RAZ A;  4RFC A;  3DCW A;  4CNX A;  1KEQ A;  1CAN A;  5EZT X;  1G0E A;  1MOO A;  1DMX A;  1HCA A;  1H9N A;  4RN4 A;  1CVE A;  4ETQ C;  2X7T A;  4M2R A;  3IBN A;  3NB5 A;  5FNM A;  5EOI A;  3T84 A;  1CA3 A;  5FL6 A;  4Q83 A;  4PXX A;  5J8Z A;  1Z9Y A;  5DSJ A;  4XIX A;  2AW1 A;  4BCW A;  3MHI A;  3OY0 A;  1FSN A;  1XEG A;  1G1D A;  3DC9 A;  4LHI A;  3U7C A;  5FL4 A;  1YO2 A;  4YVY A;  4CA2 A;  2W2J A;  3HKU A;  4ITO A;  4QIZ A;  2H15 A;  1FLJ A;  4XZ5 A;  4YXU A;  1TBT X;  5DOG A;  4R59 A;  2FNM A;  3M2Y A;  3QYK A;  4DZ7 A;  4JSA A;  5DSL A;  3M5E A;  4HEZ A;  2NXS A;  4Q08 A;  2FMZ A;  1Z97 A;  4QSJ A;  3M5S A;  4YYT A;  1YDD A;  9CA2 A;  4Q49 A;  5G0B A;  1CAY A;  4K0S A;  3M96 A;  1BNV A;  4WW6 A;  4COQ A;  4Z1N A;  1HCB A;  2FNN A;  1AM6 A;  4Q09 A;  1YDB A;  5JQT A;  4E3G A;  5JQ0 A;  1TG9 A;  1G46 A;  2NXR A;  5EKJ A;  5C8I A;  4PYY A;  2GD8 A;  3P3H A;  1CNC A;  4WW8 A;  3M14 A;  2FOV A;  7CA2 A;  5G0C A;  5SZ0 A;  4ZWZ A;  1H4N A;  5JEG B;  2CBC A;  4Q99 A;  3OKV A;  4HF3 A;  5E2K A;  3BET A;  5EKM A;  1TB0 X;  2QO8 A;  2NWY A;  2FW4 A;  3V5G A;  3M40 A;  5E2R A;  4FIK A;  3R17 B;  2Q38 A;  4R5A A;  5BYI A;  1OKM A;  1A42 A;  1THK A;  4FU5 A;  4L5V A;  5FNL A;  1DCB A;  5JES B;  3KS3 A;  1BN4 A;  4FL7 A;  5EIJ A;  3M67 A;  4E3F A;  3ZP9 A;  5SZ4 A;  4K0T A;  1OKN A;  5DVX A;  1LG6 A;  3C7P A;  1ZE8 A;  3EFT A;  3S71 B;  4MLX A;  5CJF A;  3DD8 A;  1CVF A;  4CNV A;  3OIK A;  4PQ7 A;  1XQ0 A;  3SBH A;  4QY3 A;  2NNV A;  2WD2 A;  4MTY A;  4RUZ A;  3FE4 A;  4KP8 A;  3T83 A;  4JSZ A;  5EHE A;  3MWO A;  4QJP A;  5FNH A;  1CCT A;  4LU3 A;  3IBU A;  3V3G B;  3IBL A;  1EOU A;  3DD0 A;  1XPZ A;  1IF5 A;  4E5Q A;  4DZ9 A;  1CAM A;  2NWO A;  4QK1 A;  1CVB A;  3RJ7 A;  1CNG A;  5FL5 A;  4KNM A;  5JGT B;  3OKU A;  3BL1 A;  1CAO A;  1FSR A;  2HKK A;  1CNB A;  4BF1 A;  3MHM A;  2VVA X;  1CCU A;  1F2W A;  3MNU A;  1LZV A;  1UGF A;  3F8E A;  4Q8Y A;  5FDC A;  3RYJ B;  1JV0 A;  4Z1K A;  4YXO A;  1CNY A;  1HUH A;  2X7U A;  5E28 A;  3DA2 A;  3MNI A;  3F4X A;  3DCS A;  3K34 A;  4MDM A;  3DVD A;  1TE3 X;  4WR7 A;  4TWL A;  1I9L A;  1I9M A;  3IGP A;  3OYS A;  3S72 B;  3V2M A;  5BRV A;  1BNQ A;  1FSQ A;  3M1W A;  2QP6 A;  4FVO A;  3P3J A;  3V7X A;  1BNW A;  2CBD A;  2FOU A;  2NNS A;  5DSI A;  2ILI A;  4YGN A;  5FLR A;  1CNX A;  1XEV A;  3UYN A;  4LP6 A;  5A6H A;  1HVA A;  1CVA A;  1KWQ A;  1LG5 A;  3D8W A;  5EKH A;  1Z93 A;  3F7U A;  1AZM A;  1CRA A;  2POW A;  1FQN A;  2NNG A;  4MDG A;  2Q1B A;  1BV3 A;  4MDL A;  8CA2 A;  1RZA A;  5FLS A;  4GL1 X;  4ZWI A;  3ZNC A;  2FMG A;  5SZ5 A;  1HEC A;  3RYY A;  3KWA A;  1RJ6 A;  3EFI A;  3U47 A;  3JXF A;  2ZNC A;  2F14 A;  1KWR A;  4CNR A;  2WEH A;  3HS4 A;  1IF4 A;  1I91 A;  4PYX A;  5AMD A;  3DCC A;  2OSF A;  4HT2 A;  2NN1 A;  5DSQ A;  4YGJ A;  5EH7 A;  5E2S A;  3HKQ A;  1RJ5 A;  3MNA A;  3MDZ A;  4QTL A;  4XIW A;  1CNI A;  1FQR A;  3MHO A;  4QJ0 A;  3P44 A;  5CAC A;  1UGD A;  1ZNC A;  5FLP A;  3PYK A;  1IF8 A;  1KOQ A;  5SZ2 A;  1RZB A;  3SAX A;  5G01 A;  1URT A;  4Q81 A;  2HL4 A;  4UOV A;  4FVN A;  4Q7P A;  4FPT A;  3M1Q A;  3S97 A;  1CAL A;  3P58 A;  3S8X A;  1TH9 A;  2QOA A;  1LUG A;  5DRS A;  4ILX A;  1G53 A;  4Q9Y A;  4ZWX A;  3M1J A;  4E3H A;  2HNC A;  3Q31 A;  3FW3 A;  1CRM A;  3M98 A;  3N3J A;  3IEO A;  3GZ0 A;  3HFP A;  4X5S A;  1RZC A;  4FRC A;  5L3O A;  1CAI A;  3KNE A;  5EH5 A;  2VVB X;  3MNJ A;  5CLU A;  3RZ8 A;  4BF6 A;  3M04 A;  4MO8 A;  5FLO A;  5JEP B;  3S75 B;  2FOS A;  1BN3 A;  1CA2 A;  4ITP A;  4Q7S A;  1BNT A;  4KAP A;  1DCA A;  4JSW A;  1AVN A;  4YWP A;  4HEW A;  4K0Z A;  2WEJ A;  4IWZ A;  1IF9 A;  5A25 A;  3RZ7 A;  5DSR A;  3N2P A;  1CVD A;  2CBA A;  1UGE A;  1MUA A;  3F7B A;  4ZX0 A;  3RZ1 B;  4QEF A;  1BZM A;  4RIU A;  3DVB A;  3M2X A;  5DSM A;  3MHC A;  4E4A A;  5FNJ A;  3MNK A;  3PO6 A;  2HFW A;  3L14 A;  1CNK A;  3M3X A;  4G0C A;  4XFW A;  2X7S A;  3KIG A;  4M2W A;  3VBD A;  4KNN A;  1YDC A;  2NNO A;  3RLD A;  3T5Z A;  3ML5 A;  3OYQ A;  4QSA A;  3V3F A;  3OIM A;  1I8Z A;  4QJO A;  1UGC A;  2GEH A;  2NN7 A;  3KOK A;  2IT4 A;  3MMF A;  4KV0 A;  3CYU A;  4Q8X A;  4HU1 A;  5DSO A;  3KLD B;  1V9I C;  3M1K A;  4KUW A;  5SZ7 A;  1UGG A;  2CBB A;  1CZM A;  1G4J A;  1BNU A;  3W6H A;  4HT0 A;  5SZ3 A;  3T85 A;  4Y0J A;  3V3J A;  5L6K A;  4CNW A;  3D93 A;  5FNK A;  1IF6 A;  2EU2 A;  2H4N A;  3V3I B;  1G54 A;  3KOI A;  4K13 A;  4JS6 A;  3U3A X;  3U45 X;  3V2J A;  4HEY A;  1FQL A;  3M2N A;  5DSK A;  4YX4 A;  4KNJ A;  4RUX A;  3CZV A;  1BNM A;  3CA2 A;  3RGE A;  1CNJ A;  4E3D A;  4TWM A;  3DVC A;  4KUV A;  5JG5 B;  4KUY A;  5AMG A;  1HED A;  1ZSB A;  3S74 B;  1ZGF A;  3P5L A;  1G0F A;  5IPZ A;  4L5U A;  1HEB A;  1OKL A;  3DBU A;  2FOY A;  1RAY A;  4YGK A;  4Q7V A;  3TVO X;  3DC3 A;  4RIV A;  4ZX1 A;  4Q87 A;  3PJJ A;  4RUY A;  1CIL A;  1ZFQ A;  4Q6D A;  3P55 A;  1FR4 A;  3S9T A;  3W6I A;  1CVH A;  1I9P A;  1ZSC A;  2Q1Q A;  5FDI A;  1G45 A;  5E2N A;  5FLT A;  1BN1 A;  3ML2 A;  4Q06 A;  4Q90 A;  2HD6 A;  4Q6E A;  3HLJ A;  3B1B A;  4WUP A;  4YHA A;  5JDV B;  3MZC A;  3CAJ A;  3OIL A;  4L5W A;  3V3H B;  4YGF A;  4ZAO A;  3B4F A;  4Z1E A;  4QJW A;  5BRW A;  4IDR X;  3JXG A;  4Q78 A;  3RG3 A;  3RG4 A;  2CAB A;  5HPJ A;  3NJ9 A;  1RZD A;  4Z1J A;  2WEG A;  4WUQ A;  3K7K A;  4XE1 A;  2POV A;  3TMJ A;  3RZ0 B;  1RZE A;  4K1Q A;  1JCZ A;  1CAK A;  1OQ5 A;  2NWZ A;  1KOP A;  1BCD A;  1G3Z A;  1CNW A;  5E5R A;  1CAZ A;  5FLQ A;  5FNG A;  3RYZ A;  5SZ1 A;  3RYV B;  4ZWY A;  3IAI A;  3HKT A;  4E9O X;  1YO0 A;  3KON A;  5EHV A;  4QSB A;  4N16 A;  3RZ5 A;  6CA2 A;  3MYQ A;  3S78 B;  3JXH C;  3M5T A;  4QK2 A;  3N0N A;  3BL0 A;  5LMD A;  5BRU A;  3LXE A;  2NXT A;  4Z0Q A;  3R16 A;  4QK3 A;  4CAC A;  4HBA A;  3D0N A;  2HOC A;  3MNH A;  5E2M A;  3SAP A;  1LGD A;  5E5U A;  2CA2 A;  4QJM A;  1YO1 A;  3K2F A;  4WL4 A;  5AML A;  3FFP X;  4R5B A;  1TTM A;  2OSM A;  4MLT A;  3N4B A;  3IBI A;  4PZH A;  1G4O A;  3DAZ A;  2WEO A;  4Q7W A;  2WD3 A;  1I9Q A;  4CQ0 A;  4Q07 A;  3T82 A;  1H9Q A;  4KP5 A;  5DSP A;  4Q8Z A;  1T9N A;  2EU3 A;  4QIY A;  2ABE A;  2FNK A;  3M2Z A;  1TEU X;  3NI5 A;  1J9W A;  1CIN A;  1DMY A;  1I90 A;  3TVN X;  3S77 B;  4KNI A;  2O4Z A;  2EZ7 A;  4G7A A;  5EH8 A;  3S73 B;  4YGL A;  3UYQ A;  1UGB A;  4M2V A;  3T5U A;  1FR7 A;  1G6V A;  4RFD A;  4QJX A;  5JEH B;  3RYX B;  5JGS B;  1I9O A;  3HKN A;  1ZFK A;  4M2U A;  3SBI A;  5EHW A;  5DOH A;  1CCS A;  1TEQ X;  3D92 A;  1BIC A;  1HUG A;  3S76 A;  1CNH A;  5BNL A;  1CAJ A;  5G03 A;  4E49 A;  12CA A;  2NWP A;  1CAH A;  1CIM A;  4QSI A;  3KKX A;  5DSN A;  4N0X B;  1G52 A;  1ZSA A;  2CBE A;  3MHL A;  1UGA A;  2NMX A;  4RH2 A;  4Q0L A;  1CVC A;  4YXI A;  1IF7 A;  3D9Z A;  1YDA A;  2FOQ A;  1BNN A;  1HEA A;  5JG3 B;  5SZ6 A;  4C3T A;  5CA2 A;  1ZGE A;  1FQM A;  2AX2 A;  1I9N A;  5FNI A; 
#chains in the Genus database with same CATH homology
 1JD0 A;  1G48 A;  2POU A;  1Y7W A;  4JSS A;  1ZH9 A;  3P4V A;  1TG3 A;  1V9E A;  3P5A A;  3DV7 A;  1RAZ A;  4RFC A;  3DCW A;  4CNX A;  1KEQ A;  1CAN A;  5EZT X;  1G0E A;  1MOO A;  1DMX A;  1HCA A;  1H9N A;  4RN4 A;  1CVE A;  4ETQ C;  2X7T A;  4M2R A;  3IBN A;  3NB5 A;  5FNM A;  5EOI A;  3T84 A;  1CA3 A;  5FL6 A;  4Q83 A;  4PXX A;  5J8Z A;  1Z9Y A;  5DSJ A;  4XIX A;  2AW1 A;  4BCW A;  3MHI A;  3OY0 A;  1FSN A;  1XEG A;  1G1D A;  3DC9 A;  4LHI A;  3U7C A;  5FL4 A;  1YO2 A;  4YVY A;  4CA2 A;  2W2J A;  3HKU A;  4ITO A;  4QIZ A;  2H15 A;  1FLJ A;  4XZ5 A;  4YXU A;  1TBT X;  5DOG A;  4R59 A;  2FNM A;  3M2Y A;  3QYK A;  4DZ7 A;  4JSA A;  5DSL A;  3M5E A;  4HEZ A;  2NXS A;  4Q08 A;  2FMZ A;  1Z97 A;  4QSJ A;  3M5S A;  4YYT A;  1YDD A;  9CA2 A;  4Q49 A;  5G0B A;  1CAY A;  4K0S A;  3M96 A;  1BNV A;  4WW6 A;  4COQ A;  4Z1N A;  1HCB A;  2FNN A;  1AM6 A;  4Q09 A;  1YDB A;  5JQT A;  4E3G A;  5JQ0 A;  1TG9 A;  1G46 A;  2NXR A;  5EKJ A;  5C8I A;  4PYY A;  2GD8 A;  3P3H A;  1CNC A;  4WW8 A;  3M14 A;  2FOV A;  7CA2 A;  5G0C A;  5SZ0 A;  4ZWZ A;  1H4N A;  5JEG B;  2CBC A;  4Q99 A;  3OKV A;  4HF3 A;  5E2K A;  3BET A;  5EKM A;  1TB0 X;  2QO8 A;  2NWY A;  2FW4 A;  3V5G A;  3M40 A;  5E2R A;  4FIK A;  3R17 B;  2Q38 A;  4R5A A;  5BYI A;  1OKM A;  1A42 A;  1THK A;  4FU5 A;  4L5V A;  5FNL A;  1DCB A;  5JES B;  3KS3 A;  1BN4 A;  4FL7 A;  5EIJ A;  3M67 A;  4E3F A;  3ZP9 A;  5SZ4 A;  4K0T A;  1OKN A;  5DVX A;  1LG6 A;  3C7P A;  1ZE8 A;  3EFT A;  3S71 B;  4MLX A;  5CJF A;  3DD8 A;  1CVF A;  4CNV A;  3OIK A;  4PQ7 A;  1XQ0 A;  3SBH A;  4QY3 A;  2NNV A;  2WD2 A;  4MTY A;  4RUZ A;  3FE4 A;  4KP8 A;  3T83 A;  4JSZ A;  5EHE A;  3MWO A;  4QJP A;  5FNH A;  1CCT A;  4LU3 A;  3IBU A;  3V3G B;  3IBL A;  1EOU A;  3DD0 A;  1XPZ A;  1IF5 A;  4E5Q A;  4DZ9 A;  1CAM A;  2NWO A;  4QK1 A;  1CVB A;  3RJ7 A;  1CNG A;  5FL5 A;  4KNM A;  5JGT B;  3OKU A;  3BL1 A;  1CAO A;  1FSR A;  2HKK A;  1CNB A;  4BF1 A;  3MHM A;  2VVA X;  1CCU A;  1F2W A;  3MNU A;  1LZV A;  1UGF A;  3F8E A;  4Q8Y A;  5FDC A;  3RYJ B;  1JV0 A;  4Z1K A;  4YXO A;  1CNY A;  1HUH A;  2X7U A;  5E28 A;  3DA2 A;  3MNI A;  3F4X A;  3DCS A;  3K34 A;  4MDM A;  3DVD A;  1TE3 X;  4WR7 A;  4TWL A;  1I9L A;  1I9M A;  3IGP A;  3OYS A;  3S72 B;  3V2M A;  5BRV A;  1BNQ A;  1FSQ A;  3M1W A;  2QP6 A;  4FVO A;  3P3J A;  3V7X A;  1BNW A;  2CBD A;  2FOU A;  2NNS A;  5DSI A;  2ILI A;  4YGN A;  5FLR A;  1CNX A;  1XEV A;  3UYN A;  4LP6 A;  5A6H A;  1HVA A;  1CVA A;  1KWQ A;  1LG5 A;  3D8W A;  5EKH A;  1Z93 A;  3F7U A;  1AZM A;  1CRA A;  2POW A;  1FQN A;  2NNG A;  4MDG A;  2Q1B A;  1BV3 A;  4MDL A;  8CA2 A;  1RZA A;  5FLS A;  4GL1 X;  4ZWI A;  3ZNC A;  2FMG A;  5SZ5 A;  1HEC A;  3RYY A;  3KWA A;  1RJ6 A;  3EFI A;  3U47 A;  3JXF A;  2ZNC A;  2F14 A;  1KWR A;  4CNR A;  2WEH A;  3HS4 A;  1IF4 A;  1I91 A;  4PYX A;  5AMD A;  3DCC A;  2OSF A;  4HT2 A;  2NN1 A;  5DSQ A;  4YGJ A;  5EH7 A;  5E2S A;  3HKQ A;  1RJ5 A;  3MNA A;  3MDZ A;  4QTL A;  4XIW A;  1CNI A;  1FQR A;  3MHO A;  4QJ0 A;  3P44 A;  5CAC A;  1UGD A;  1ZNC A;  5FLP A;  3PYK A;  1IF8 A;  1KOQ A;  5SZ2 A;  1RZB A;  3SAX A;  5G01 A;  1URT A;  4Q81 A;  2HL4 A;  4UOV A;  4FVN A;  4Q7P A;  4FPT A;  3M1Q A;  3S97 A;  1CAL A;  3P58 A;  3S8X A;  1TH9 A;  2QOA A;  1LUG A;  5DRS A;  4ILX A;  1G53 A;  4Q9Y A;  4ZWX A;  3M1J A;  4E3H A;  2HNC A;  3Q31 A;  3FW3 A;  1CRM A;  3M98 A;  3N3J A;  3IEO A;  3GZ0 A;  3HFP A;  4X5S A;  1RZC A;  4FRC A;  5L3O A;  1CAI A;  3KNE A;  5EH5 A;  2VVB X;  3MNJ A;  5CLU A;  3RZ8 A;  4BF6 A;  3M04 A;  4MO8 A;  5FLO A;  5JEP B;  3S75 B;  2FOS A;  1BN3 A;  1CA2 A;  4ITP A;  4Q7S A;  1BNT A;  4KAP A;  1DCA A;  4JSW A;  1AVN A;  4YWP A;  4HEW A;  4K0Z A;  2WEJ A;  4IWZ A;  1IF9 A;  5A25 A;  3RZ7 A;  5DSR A;  3N2P A;  1CVD A;  2CBA A;  1UGE A;  1MUA A;  3F7B A;  4ZX0 A;  3RZ1 B;  4QEF A;  1BZM A;  4RIU A;  3DVB A;  3M2X A;  5DSM A;  3MHC A;  4E4A A;  5FNJ A;  3MNK A;  3PO6 A;  2HFW A;  3L14 A;  1CNK A;  3M3X A;  4G0C A;  4XFW A;  2X7S A;  3KIG A;  4M2W A;  3VBD A;  4KNN A;  1YDC A;  2NNO A;  3RLD A;  3T5Z A;  3ML5 A;  3OYQ A;  4QSA A;  3V3F A;  3OIM A;  1I8Z A;  4QJO A;  1UGC A;  2GEH A;  2NN7 A;  3KOK A;  2IT4 A;  3MMF A;  4KV0 A;  3CYU A;  4Q8X A;  4HU1 A;  5DSO A;  3KLD B;  1V9I C;  3M1K A;  4KUW A;  5SZ7 A;  1UGG A;  2CBB A;  1CZM A;  1G4J A;  1BNU A;  3W6H A;  4HT0 A;  5SZ3 A;  3T85 A;  4Y0J A;  3V3J A;  5L6K A;  4CNW A;  3D93 A;  5FNK A;  1IF6 A;  2EU2 A;  2H4N A;  3V3I B;  1G54 A;  3KOI A;  4K13 A;  4JS6 A;  3U3A X;  3U45 X;  3V2J A;  4HEY A;  1FQL A;  3M2N A;  5DSK A;  4YX4 A;  4KNJ A;  4RUX A;  3CZV A;  1BNM A;  3CA2 A;  3RGE A;  1CNJ A;  4E3D A;  4TWM A;  3DVC A;  4KUV A;  5JG5 B;  4KUY A;  5AMG A;  1HED A;  1ZSB A;  3S74 B;  1ZGF A;  3P5L A;  1G0F A;  5IPZ A;  4L5U A;  1HEB A;  1OKL A;  3DBU A;  2FOY A;  1RAY A;  4YGK A;  4Q7V A;  3TVO X;  3DC3 A;  4RIV A;  4ZX1 A;  4Q87 A;  3PJJ A;  4RUY A;  1CIL A;  1ZFQ A;  4Q6D A;  3P55 A;  1FR4 A;  3S9T A;  3W6I A;  1CVH A;  1I9P A;  1ZSC A;  2Q1Q A;  5FDI A;  1G45 A;  5E2N A;  5FLT A;  1BN1 A;  3ML2 A;  4Q06 A;  4Q90 A;  2HD6 A;  4Q6E A;  3HLJ A;  3B1B A;  4WUP A;  4YHA A;  5JDV B;  3MZC A;  3CAJ A;  3OIL A;  4L5W A;  3V3H B;  4YGF A;  4ZAO A;  3B4F A;  4Z1E A;  4QJW A;  5BRW A;  4IDR X;  3JXG A;  4Q78 A;  3RG3 A;  3RG4 A;  2CAB A;  5HPJ A;  3NJ9 A;  1RZD A;  4Z1J A;  2WEG A;  4WUQ A;  3K7K A;  4XE1 A;  2POV A;  3TMJ A;  3RZ0 B;  1RZE A;  4K1Q A;  1JCZ A;  1CAK A;  1OQ5 A;  2NWZ A;  1KOP A;  1BCD A;  1G3Z A;  1CNW A;  5E5R A;  1CAZ A;  5FLQ A;  5FNG A;  3RYZ A;  5SZ1 A;  3RYV B;  4ZWY A;  3IAI A;  3HKT A;  4E9O X;  1YO0 A;  3KON A;  5EHV A;  4QSB A;  4N16 A;  3RZ5 A;  6CA2 A;  3MYQ A;  3S78 B;  3JXH C;  3M5T A;  4QK2 A;  3N0N A;  3BL0 A;  5LMD A;  5BRU A;  3LXE A;  2NXT A;  4Z0Q A;  3R16 A;  4QK3 A;  4CAC A;  4HBA A;  3D0N A;  2HOC A;  3MNH A;  5E2M A;  3SAP A;  1LGD A;  5E5U A;  2CA2 A;  4QJM A;  1YO1 A;  3K2F A;  4WL4 A;  5AML A;  3FFP X;  4R5B A;  1TTM A;  2OSM A;  4MLT A;  3N4B A;  3IBI A;  4PZH A;  1G4O A;  3DAZ A;  2WEO A;  4Q7W A;  2WD3 A;  1I9Q A;  4CQ0 A;  4Q07 A;  3T82 A;  1H9Q A;  4KP5 A;  5DSP A;  4Q8Z A;  1T9N A;  2EU3 A;  4QIY A;  2ABE A;  2FNK A;  3M2Z A;  1TEU X;  3NI5 A;  1J9W A;  1CIN A;  1DMY A;  1I90 A;  3TVN X;  3S77 B;  4KNI A;  2O4Z A;  2EZ7 A;  4G7A A;  5EH8 A;  3S73 B;  4YGL A;  3UYQ A;  1UGB A;  4M2V A;  3T5U A;  1FR7 A;  1G6V A;  4RFD A;  4QJX A;  5JEH B;  3RYX B;  5JGS B;  1I9O A;  3HKN A;  1ZFK A;  4M2U A;  3SBI A;  5EHW A;  5DOH A;  1CCS A;  1TEQ X;  3D92 A;  1BIC A;  1HUG A;  3S76 A;  1CNH A;  5BNL A;  1CAJ A;  5G03 A;  4E49 A;  12CA A;  2NWP A;  1CAH A;  1CIM A;  4QSI A;  3KKX A;  5DSN A;  4N0X B;  1G52 A;  1ZSA A;  2CBE A;  3MHL A;  1UGA A;  2NMX A;  4RH2 A;  4Q0L A;  1CVC A;  4YXI A;  1IF7 A;  3D9Z A;  1YDA A;  2FOQ A;  1BNN A;  1HEA A;  5JG3 B;  5SZ6 A;  4C3T A;  5CA2 A;  1ZGE A;  1FQM A;  2AX2 A;  1I9N A;  5FNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...