4R5AA

A carbonic anhydrase ix mimic in complex with a carbohydrate-based sulfamate
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
Knots found
sequence length
260
structure length
259
Chain Sequence
MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFQVTFDDSQDKAVLKGGPLDGTYRLLQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDVGKAVQQPDGLAVLGIFLKVGSAPGLQKVVDVLDSIKTEGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLAECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into Carbonic Anhydrase IX Isoform Specificity of Carbohydrate-Based Sulfamates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Carbonic anhydrase 2
total genus 81
structure length 259
sequence length 260
other databases KnotProt 2.0: K +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2014-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 4r5aA00
3HKTA 3RGEA 1BN3A 1HCBA 4XIXA 1BCDA 1LZVA 4FL7A 5FNMA 5JEPB 1YDCA 4CQ0A 2CBDA 4JSAA 2FOUA 3F7UA 1CNIA 3S76A 3S73B 1CVHA 3OY0A 3DAZA 3V3FA 1F2WA 3IGPA 4MTYA 1IF6A 3OYSA 3M98A 5HPJA 4Q8XA 3TVNX 2HL4A 1ZSBA 2NWPA 4HT2A 3T82A 1YO0A 4MLXA 4QY3A 2HNCA 4Q7WA 5FLQA 3QYKA 5DSPA 1TTMA 3OYQA 5AMDA 2NNOA 3RZ0B 1JCZA 2HKKA 4Q87A 4E9OX 3HLJA 2QP6A 2NNGA 4LHIA 1FSRA 2H4NA 4K0ZA 3P58A 4ZWXA 3KOKA 5EH7A 4JSWA 3DCSA 2FW4A 5G0CA 1YO2A 3RLDA 1I90A 4YVYA 1CAMA 2NNSA 3SBHA 3MNHA 3M2XA 3ZNCA 4KNMA 1ZGFA 2AX2A 3S72B 1RAZA 3RZ7A 4L5UA 4ITOA 4Q49A 2POVA 4YX4A 2VVAX 5E5UA 3V3GB 4FRCA 4QK1A 1TE3X 4HBAA 5FL5A 5A25A 1H4NA 1IF7A 1I9NA 3M1WA 1HUGA 1RZAA 2NMXA 1G0EA 2QO8A 3U3AX 3V7XA 3UYNA 1ZFQA 3DCWA 1TG3A 1ZSCA 3RYJB 1I9LA 4XIWA 5EHVA 1UGFA 4QK2A 3W6HA 3S77B 1CNKA 5L3OA 3F8EA 4G7AA 1KWQA 4FIKA 4Q7SA 4Z1KA 3M04A 4E3GA 5DSJA 5DSMA 1G4OA 1G46A 4Z1EA 4BF1A 1YDBA 2POUA 5BRWA 1CRAA 3N2PA 4RH2A 3S97A 2FMGA 2H15A 4WW8A 3T84A 4QSJA 4CACA 4QJ0A 2Q1QA 8CA2A 2AW1A 3V3JA 1YDDA 1UGDA 3D9ZA 3D8WA 1THKA 3DD0A 4PZHA 5DSNA 1CVCA 3FW3A 4N0XB 3CZVA 5DSKA 5SZ7A 1V9EA 3F7BA 3R16A 5AMLA 4YGNA 1H9QA 4GL1X 2NXRA 4PYYA 3FFPX 3D93A 3IBLA 3LXEA 3RZ8A 1BNVA 3RJ7A 4YHAA 4XE1A 3KKXA 1RZCA 1Z97A 5JEGB 2POWA 4DZ7A 5FDCA 1I8ZA 4M2WA 4COQA 3D92A 3S74B 3M5EA 2WEHA 2WEGA 5FNLA 5G01A 3V2JA 3DD8A 1XEVA 1CANA 1I91A 5SZ6A 5FLPA 5BRUA 4Q9YA 3M2ZA 2FOVA 3T5ZA 2HOCA 2NWOA 2NNVA 5E28A 3UYQA 1BN4A 1CNHA 3U7CA 1CAYA 1CZMA 3IEOA 3MZCA 1TH9A 3P44A 4E3DA 3OILA 2CBEA 1I9PA 5C8IA 3M1JA 2W2JA 3CA2A 1JV0A 5EH5A 4KNNA 3V2MA 4X5SA 3M96A 3M14A 1XEGA 4KUWA 5E2KA 3ZP9A 5BYIA 4FPTA 2X7SA 3F4XA 5JESB 3RYYA 3ML2A 1CNXA 4MDMA 3PO6A 1TBTX 1ZNCA 5EKJA 2Q1BA 5FLSA 1G6VA 4BCWA 3M5TA 3MMFA 1Y7WA 5L6KA 4Z0QA 3P5AA 1UGGA 1CAHA 2QOAA 4KV0A 1LG5A 1FLJA 5E2RA 3IAIA 4DZ9A 5LMDA 3IBUA 4ZX1A 3T85A 1ZH9A 1FQRA 4Q7VA 1MOOA 3B4FA 4QIZA 4QSAA 1CNCA 1UGBA 2WD2A 3L14A 4ZWYA 1I9QA 5E2MA 3P3JA 3DC9A 4Q83A 4WR7A 1LUGA 3N4BA 3PYKA 4TWLA 1BNUA 4Q09A 3OIMA 3M67A 3D0NA 4YWPA 4ZWIA 4FVNA 1I9MA 7CA2A 3MNIA 4JSSA 1CAIA 3SAPA 2FMZA 3MHIA 5DRSA 3HKUA 1BNMA 4Q8ZA 4QJPA 4RUZA 3PJJA 4RUYA 1BV3A 1YDAA 3VBDA 4ITPA 1OKLA 3RZ5A 1XQ0A 3KNEA 4KUVA 3CYUA 4JS6A 1HVAA 4MDGA 1CINA 5BNLA 1G3ZA 1LGDA 5EKMA 4E4AA 4MDLA 1XPZA 3RG3A 4E49A 1TEQX 3MHOA 1KEQA 3KOIA 5FNGA 1IF8A 2ILIA 2NWYA 1CCUA 5JG5B 5CACA 1G48A 1CNBA 1CALA 5DSQA 3P5LA 3EFIA 1FSNA 1UGEA 1A42A 3MHLA 1FQLA 4HT0A 1I9OA 3NI5A 4PXXA 1IF4A 1BNWA 4RIUA 2GEHA 2HFWA 4KUYA 4Q99A 3V5GA 1BNTA 3M1QA 3MHCA 4N16A 1KOPA 5AMGA 3KWAA 5E2SA 2CABA 5FL4A 4K1QA 3RYZA 4YYTA 4Q6DA 2GD8A 5EIJA 3TVOX 5FDIA 1G53A 3W6IA 2OSMA 1G54A 4Y0JA 1OKNA 1CCTA 4IDRX 4K0SA 4R5BA 5CJFA 4RN4A 4E5QA 2CBCA 5JGSB 1TEUX 1RJ5A 1G4JA 4C3TA 3BETA 1CNWA 3P55A 1OQ5A 3U45X 1KOQA 1CA2A 4PYXA 5JQ0A 5DOHA 5J8ZA 2WEJA 4FU5A 2FNNA 4QJMA 5G03A 1CNJA 4Z1JA 4RFDA 2NXSA 2FOQA 2CA2A 4WW6A 3DV7A 1CVDA 2WD3A 5FNJA 3KIGA 5E2NA 2EU2A 5JQTA 5DSOA 5FNHA 1CIMA 4CA2A 3M5SA 4Q78A 4QJXA 4CNVA 4Q6EA 4YXUA 2F14A 1AM6A 1CAJA 4K0TA 4RUXA 3N0NA 4HEWA 1BICA 3DVBA 3KS3A 1RAYA 3K2FA 3DC3A 1V9IC 4PQ7A 2WEOA 3DCCA 4L5VA 4Q07A 1CVBA 3DVCA 3OKVA 4QEFA 1DCAA 1G0FA 4KP5A 1FR4A 5DSIA 5EOIA 2OSFA 1FQMA 3S8XA 1DMXA 3MNJA 5SZ2A 4YGJA 3OIKA 3JXGA 4M2VA 4HEYA 4M2UA 4XZ5A 1H9NA 1Z93A 3RG4A 4ZWZA 1Z9YA 1HCAA 3M2YA 3BL0A 3ML5A 5SZ1A 3K34A 1CVAA 3N3JA 2Q38A 5FL6A 1BNQA 1HEAA 1ZSAA 4MLTA 4KP8A 2ZNCA 1IF5A 1DMYA 4TWMA 4HEZA 1CVFA 1OKMA 1TB0X 1T9NA 4ETQC 1YO1A 3FE4A 3M40A 3S75B 4QJWA 2ABEA 1CILA 1RZDA 1CAKA 2FOYA 3OKUA 3MYQA 1HEBA 4WL4A 3RYVB 5DOGA 1G1DA 2O4ZA 3M1KA 3HFPA 3MDZA 1UGAA 4Z1NA 1G45A 3NJ9A 9CA2A 4YGFA 3SBIA 1HEDA 1JD0A 4Q0LA 6CA2A 2FOSA 4ILXA 4YGKA 3CAJA 5FNKA 1AZMA 1CVEA 3SAXA 2NWZA 1EOUA 4MO8A 4K13A 5E5RA 3RYXB 4YXOA 1J9WA 3P4VA 1MUAA 3DBUA 1RJ6A 3GZ0A 3R17B 4LU3A 4QSIA 5SZ5A 1UGCA 2FNKA 3MHMA 3IBIA 4JSZA 2FNMA 3TMJA 3T5UA 2X7TA 4QIYA 4HF3A 1KWRA 3M2NA 3C7PA 1BZMA 4UOVA 5FLRA 4KNIA 4R5AA 1CNGA 5SZ0A 4WUPA 5FLOA 2NXTA 4L5WA 4RFCA 3JXHC 1CNYA 5EH8A 1FQNA 1CCSA 4KAPA 3BL1A 4FVOA 2EZ7A 1ZFKA 4Q08A 3Q31A 4E3FA 3V3HB 2EU3A 4RIVA 3IBNA 2CBAA 5EHEA 4ZX0A 1TG9A 1G52A 4R59A 4XFWA 4HU1A 4Q06A 1RZEA 4CNXA 5DVXA 5EKHA 4YXIA 1RZBA 2NN7A 2X7UA 4G0CA 4M2RA 5G0BA 3EFTA 3HKQA 4CNWA 3JXFA 1CAZA 1ZGEA 3HKNA 3M3XA 4Q7PA 3NB5A 3KLDB 2HD6A 12CAA 1IF9A 3K7KA 3V3IB 4BF6A 3RZ1B 1CRMA 3MNKA 3S78B 3KONA 5JG3B 4Q90A 3DVDA 3MNAA 1CAOA 1DCBA 5FLTA 1URTA 3MWOA 5BRVA 1FSQA 5DSRA 4KNJA 5EHWA 4E3HA 1BNNA 1ZE8A 2IT4A 1FR7A 5CA2A 1LG6A 5SZ4A 2VVBX 3DA2A 5SZ3A 5EZTX 1HECA 3HS4A 5JEHB 1BN1A 5CLUA 4Q8YA 4ZAOA 3S9TA 4QSBA 1HUHA 4QTLA 5JDVB 4IWZA 4QK3A 5FNIA 3U47A 4CNRA 4YGLA 4LP6A 3P3HA 4Q81A 5A6HA 5IPZA 4QJOA 4WUQA 3S71B 2NN1A 3B1BA 3T83A 1AVNA 5DSLA 2CBBA 5JGTB 3MNUA 1CA3A
chains in the Genus database with same CATH superfamily
3HKTA 3RGEA 1BN3A 1HCBA 4XIXA 1BCDA 1LZVA 4FL7A 5FNMA 5JEPB 1YDCA 4CQ0A 2CBDA 4JSAA 2FOUA 3F7UA 1CNIA 3S76A 3S73B 1CVHA 3OY0A 3DAZA 3V3FA 1F2WA 3IGPA 4MTYA 1IF6A 3OYSA 3M98A 5HPJA 4Q8XA 3TVNX 2HL4A 1ZSBA 2NWPA 4HT2A 3T82A 1YO0A 4MLXA 4QY3A 2HNCA 4Q7WA 5FLQA 3QYKA 5DSPA 1TTMA 3OYQA 5AMDA 2NNOA 3RZ0B 1JCZA 2HKKA 4Q87A 4E9OX 3HLJA 2QP6A 2NNGA 4LHIA 1FSRA 2H4NA 4K0ZA 3P58A 4ZWXA 3KOKA 5EH7A 4JSWA 3DCSA 2FW4A 5G0CA 1YO2A 3RLDA 1I90A 4YVYA 1CAMA 2NNSA 3SBHA 3MNHA 3M2XA 3ZNCA 4KNMA 1ZGFA 2AX2A 3S72B 1RAZA 3RZ7A 4L5UA 4ITOA 4Q49A 2POVA 4YX4A 2VVAX 5E5UA 3V3GB 4FRCA 4QK1A 1TE3X 4HBAA 5FL5A 5A25A 1H4NA 1IF7A 1I9NA 3M1WA 1HUGA 1RZAA 2NMXA 1G0EA 2QO8A 3U3AX 3V7XA 3UYNA 1ZFQA 3DCWA 1TG3A 1ZSCA 3RYJB 1I9LA 4XIWA 5EHVA 1UGFA 4QK2A 3W6HA 3S77B 1CNKA 5L3OA 3F8EA 4G7AA 1KWQA 4FIKA 4Q7SA 4Z1KA 3M04A 4E3GA 5DSJA 5DSMA 1G4OA 1G46A 4Z1EA 4BF1A 1YDBA 2POUA 5BRWA 1CRAA 3N2PA 4RH2A 3S97A 2FMGA 2H15A 4WW8A 3T84A 4QSJA 4CACA 4QJ0A 2Q1QA 8CA2A 2AW1A 3V3JA 1YDDA 1UGDA 3D9ZA 3D8WA 1THKA 3DD0A 4PZHA 5DSNA 1CVCA 3FW3A 4N0XB 3CZVA 5DSKA 5SZ7A 1V9EA 3F7BA 3R16A 5AMLA 4YGNA 1H9QA 4GL1X 2NXRA 4PYYA 3FFPX 3D93A 3IBLA 3LXEA 3RZ8A 1BNVA 3RJ7A 4YHAA 4XE1A 3KKXA 1RZCA 1Z97A 5JEGB 2POWA 4DZ7A 5FDCA 1I8ZA 4M2WA 4COQA 3D92A 3S74B 3M5EA 2WEHA 2WEGA 5FNLA 5G01A 3V2JA 3DD8A 1XEVA 1CANA 1I91A 5SZ6A 5FLPA 5BRUA 4Q9YA 3M2ZA 2FOVA 3T5ZA 2HOCA 2NWOA 2NNVA 5E28A 3UYQA 1BN4A 1CNHA 3U7CA 1CAYA 1CZMA 3IEOA 3MZCA 1TH9A 3P44A 4E3DA 3OILA 2CBEA 1I9PA 5C8IA 3M1JA 2W2JA 3CA2A 1JV0A 5EH5A 4KNNA 3V2MA 4X5SA 3M96A 3M14A 1XEGA 4KUWA 5E2KA 3ZP9A 5BYIA 4FPTA 2X7SA 3F4XA 5JESB 3RYYA 3ML2A 1CNXA 4MDMA 3PO6A 1TBTX 1ZNCA 5EKJA 2Q1BA 5FLSA 1G6VA 4BCWA 3M5TA 3MMFA 1Y7WA 5L6KA 4Z0QA 3P5AA 1UGGA 1CAHA 2QOAA 4KV0A 1LG5A 1FLJA 5E2RA 3IAIA 4DZ9A 5LMDA 3IBUA 4ZX1A 3T85A 1ZH9A 1FQRA 4Q7VA 1MOOA 3B4FA 4QIZA 4QSAA 1CNCA 1UGBA 2WD2A 3L14A 4ZWYA 1I9QA 5E2MA 3P3JA 3DC9A 4Q83A 4WR7A 1LUGA 3N4BA 3PYKA 4TWLA 1BNUA 4Q09A 3OIMA 3M67A 3D0NA 4YWPA 4ZWIA 4FVNA 1I9MA 7CA2A 3MNIA 4JSSA 1CAIA 3SAPA 2FMZA 3MHIA 5DRSA 3HKUA 1BNMA 4Q8ZA 4QJPA 4RUZA 3PJJA 4RUYA 1BV3A 1YDAA 3VBDA 4ITPA 1OKLA 3RZ5A 1XQ0A 3KNEA 4KUVA 3CYUA 4JS6A 1HVAA 4MDGA 1CINA 5BNLA 1G3ZA 1LGDA 5EKMA 4E4AA 4MDLA 1XPZA 3RG3A 4E49A 1TEQX 3MHOA 1KEQA 3KOIA 5FNGA 1IF8A 2ILIA 2NWYA 1CCUA 5JG5B 5CACA 1G48A 1CNBA 1CALA 5DSQA 3P5LA 3EFIA 1FSNA 1UGEA 1A42A 3MHLA 1FQLA 4HT0A 1I9OA 3NI5A 4PXXA 1IF4A 1BNWA 4RIUA 2GEHA 2HFWA 4KUYA 4Q99A 3V5GA 1BNTA 3M1QA 3MHCA 4N16A 1KOPA 5AMGA 3KWAA 5E2SA 2CABA 5FL4A 4K1QA 3RYZA 4YYTA 4Q6DA 2GD8A 5EIJA 3TVOX 5FDIA 1G53A 3W6IA 2OSMA 1G54A 4Y0JA 1OKNA 1CCTA 4IDRX 4K0SA 4R5BA 5CJFA 4RN4A 4E5QA 2CBCA 5JGSB 1TEUX 1RJ5A 1G4JA 4C3TA 3BETA 1CNWA 3P55A 1OQ5A 3U45X 1KOQA 1CA2A 4PYXA 5JQ0A 5DOHA 5J8ZA 2WEJA 4FU5A 2FNNA 4QJMA 5G03A 1CNJA 4Z1JA 4RFDA 2NXSA 2FOQA 2CA2A 4WW6A 3DV7A 1CVDA 2WD3A 5FNJA 3KIGA 5E2NA 2EU2A 5JQTA 5DSOA 5FNHA 1CIMA 4CA2A 3M5SA 4Q78A 4QJXA 4CNVA 4Q6EA 4YXUA 2F14A 1AM6A 1CAJA 4K0TA 4RUXA 3N0NA 4HEWA 1BICA 3DVBA 3KS3A 1RAYA 3K2FA 3DC3A 1V9IC 4PQ7A 2WEOA 3DCCA 4L5VA 4Q07A 1CVBA 3DVCA 3OKVA 4QEFA 1DCAA 1G0FA 4KP5A 1FR4A 5DSIA 5EOIA 2OSFA 1FQMA 3S8XA 1DMXA 3MNJA 5SZ2A 4YGJA 3OIKA 3JXGA 4M2VA 4HEYA 4M2UA 4XZ5A 1H9NA 1Z93A 3RG4A 4ZWZA 1Z9YA 1HCAA 3M2YA 3BL0A 3ML5A 5SZ1A 3K34A 1CVAA 3N3JA 2Q38A 5FL6A 1BNQA 1HEAA 1ZSAA 4MLTA 4KP8A 2ZNCA 1IF5A 1DMYA 4TWMA 4HEZA 1CVFA 1OKMA 1TB0X 1T9NA 4ETQC 1YO1A 3FE4A 3M40A 3S75B 4QJWA 2ABEA 1CILA 1RZDA 1CAKA 2FOYA 3OKUA 3MYQA 1HEBA 4WL4A 3RYVB 5DOGA 1G1DA 2O4ZA 3M1KA 3HFPA 3MDZA 1UGAA 4Z1NA 1G45A 3NJ9A 9CA2A 4YGFA 3SBIA 1HEDA 1JD0A 4Q0LA 6CA2A 2FOSA 4ILXA 4YGKA 3CAJA 5FNKA 1AZMA 1CVEA 3SAXA 2NWZA 1EOUA 4MO8A 4K13A 5E5RA 3RYXB 4YXOA 1J9WA 3P4VA 1MUAA 3DBUA 1RJ6A 3GZ0A 3R17B 4LU3A 4QSIA 5SZ5A 1UGCA 2FNKA 3MHMA 3IBIA 4JSZA 2FNMA 3TMJA 3T5UA 2X7TA 4QIYA 4HF3A 1KWRA 3M2NA 3C7PA 1BZMA 4UOVA 5FLRA 4KNIA 4R5AA 1CNGA 5SZ0A 4WUPA 5FLOA 2NXTA 4L5WA 4RFCA 3JXHC 1CNYA 5EH8A 1FQNA 1CCSA 4KAPA 3BL1A 4FVOA 2EZ7A 1ZFKA 4Q08A 3Q31A 4E3FA 3V3HB 2EU3A 4RIVA 3IBNA 2CBAA 5EHEA 4ZX0A 1TG9A 1G52A 4R59A 4XFWA 4HU1A 4Q06A 1RZEA 4CNXA 5DVXA 5EKHA 4YXIA 1RZBA 2NN7A 2X7UA 4G0CA 4M2RA 5G0BA 3EFTA 3HKQA 4CNWA 3JXFA 1CAZA 1ZGEA 3HKNA 3M3XA 4Q7PA 3NB5A 3KLDB 2HD6A 12CAA 1IF9A 3K7KA 3V3IB 4BF6A 3RZ1B 1CRMA 3MNKA 3S78B 3KONA 5JG3B 4Q90A 3DVDA 3MNAA 1CAOA 1DCBA 5FLTA 1URTA 3MWOA 5BRVA 1FSQA 5DSRA 4KNJA 5EHWA 4E3HA 1BNNA 1ZE8A 2IT4A 1FR7A 5CA2A 1LG6A 5SZ4A 2VVBX 3DA2A 5SZ3A 5EZTX 1HECA 3HS4A 5JEHB 1BN1A 5CLUA 4Q8YA 4ZAOA 3S9TA 4QSBA 1HUHA 4QTLA 5JDVB 4IWZA 4QK3A 5FNIA 3U47A 4CNRA 4YGLA 4LP6A 3P3HA 4Q81A 5A6HA 5IPZA 4QJOA 4WUQA 3S71B 2NN1A 3B1BA 3T83A 1AVNA 5DSLA 2CBBA 5JGTB 3MNUA 1CA3A
chains in the Genus database with same CATH topology
3HKTA 3RGEA 1BN3A 1HCBA 4XIXA 1BCDA 1LZVA 4FL7A 5FNMA 5JEPB 1YDCA 4CQ0A 2CBDA 4JSAA 2FOUA 3F7UA 1CNIA 3S76A 3S73B 1CVHA 3OY0A 3DAZA 3V3FA 1F2WA 3IGPA 4MTYA 1IF6A 3OYSA 3M98A 5HPJA 4Q8XA 3TVNX 2HL4A 1ZSBA 2NWPA 4HT2A 3T82A 1YO0A 4MLXA 4QY3A 2HNCA 4Q7WA 5FLQA 3QYKA 5DSPA 1TTMA 3OYQA 5AMDA 2NNOA 3RZ0B 1JCZA 2HKKA 4Q87A 4E9OX 3HLJA 2QP6A 2NNGA 4LHIA 1FSRA 2H4NA 4K0ZA 3P58A 4ZWXA 3KOKA 5EH7A 4JSWA 3DCSA 2FW4A 5G0CA 1YO2A 3RLDA 1I90A 4YVYA 1CAMA 2NNSA 3SBHA 3MNHA 3M2XA 3ZNCA 4KNMA 1ZGFA 2AX2A 3S72B 1RAZA 3RZ7A 4L5UA 4ITOA 4Q49A 2POVA 4YX4A 2VVAX 5E5UA 3V3GB 4FRCA 4QK1A 1TE3X 4HBAA 5FL5A 5A25A 1H4NA 1IF7A 1I9NA 3M1WA 1HUGA 1RZAA 2NMXA 1G0EA 2QO8A 3U3AX 3V7XA 3UYNA 1ZFQA 3DCWA 1TG3A 1ZSCA 3RYJB 1I9LA 4XIWA 5EHVA 1UGFA 4QK2A 3W6HA 3S77B 1CNKA 5L3OA 3F8EA 4G7AA 1KWQA 4FIKA 4Q7SA 4Z1KA 3M04A 4E3GA 5DSJA 5DSMA 1G4OA 1G46A 4Z1EA 4BF1A 1YDBA 2POUA 5BRWA 1CRAA 3N2PA 4RH2A 3S97A 2FMGA 2H15A 4WW8A 3T84A 4QSJA 4CACA 4QJ0A 2Q1QA 8CA2A 2AW1A 3V3JA 1YDDA 1UGDA 3D9ZA 3D8WA 1THKA 3DD0A 4PZHA 5DSNA 1CVCA 3FW3A 4N0XB 3CZVA 5DSKA 5SZ7A 1V9EA 3F7BA 3R16A 5AMLA 4YGNA 1H9QA 4GL1X 2NXRA 4PYYA 3FFPX 3D93A 3IBLA 3LXEA 3RZ8A 1BNVA 3RJ7A 4YHAA 4XE1A 3KKXA 1RZCA 1Z97A 5JEGB 2POWA 4DZ7A 5FDCA 1I8ZA 4M2WA 4COQA 3D92A 3S74B 3M5EA 2WEHA 2WEGA 5FNLA 5G01A 3V2JA 3DD8A 1XEVA 1CANA 1I91A 5SZ6A 5FLPA 5BRUA 4Q9YA 3M2ZA 2FOVA 3T5ZA 2HOCA 2NWOA 2NNVA 5E28A 3UYQA 1BN4A 1CNHA 3U7CA 1CAYA 1CZMA 3IEOA 3MZCA 1TH9A 3P44A 4E3DA 3OILA 2CBEA 1I9PA 5C8IA 3M1JA 2W2JA 3CA2A 1JV0A 5EH5A 4KNNA 3V2MA 4X5SA 3M96A 3M14A 1XEGA 4KUWA 5E2KA 3ZP9A 5BYIA 4FPTA 2X7SA 3F4XA 5JESB 3RYYA 3ML2A 1CNXA 4MDMA 3PO6A 1TBTX 1ZNCA 5EKJA 2Q1BA 5FLSA 1G6VA 4BCWA 3M5TA 3MMFA 1Y7WA 5L6KA 4Z0QA 3P5AA 1UGGA 1CAHA 2QOAA 4KV0A 1LG5A 1FLJA 5E2RA 3IAIA 4DZ9A 5LMDA 3IBUA 4ZX1A 3T85A 1ZH9A 1FQRA 4Q7VA 1MOOA 3B4FA 4QIZA 4QSAA 1CNCA 1UGBA 2WD2A 3L14A 4ZWYA 1I9QA 5E2MA 3P3JA 3DC9A 4Q83A 4WR7A 1LUGA 3N4BA 3PYKA 4TWLA 1BNUA 4Q09A 3OIMA 3M67A 3D0NA 4YWPA 4ZWIA 4FVNA 1I9MA 7CA2A 3MNIA 4JSSA 1CAIA 3SAPA 2FMZA 3MHIA 5DRSA 3HKUA 1BNMA 4Q8ZA 4QJPA 4RUZA 3PJJA 4RUYA 1BV3A 1YDAA 3VBDA 4ITPA 1OKLA 3RZ5A 1XQ0A 3KNEA 4KUVA 3CYUA 4JS6A 1HVAA 4MDGA 1CINA 5BNLA 1G3ZA 1LGDA 5EKMA 4E4AA 4MDLA 1XPZA 3RG3A 4E49A 1TEQX 3MHOA 1KEQA 3KOIA 5FNGA 1IF8A 2ILIA 2NWYA 1CCUA 5JG5B 5CACA 1G48A 1CNBA 1CALA 5DSQA 3P5LA 3EFIA 1FSNA 1UGEA 1A42A 3MHLA 1FQLA 4HT0A 1I9OA 3NI5A 4PXXA 1IF4A 1BNWA 4RIUA 2GEHA 2HFWA 4KUYA 4Q99A 3V5GA 1BNTA 3M1QA 3MHCA 4N16A 1KOPA 5AMGA 3KWAA 5E2SA 2CABA 5FL4A 4K1QA 3RYZA 4YYTA 4Q6DA 2GD8A 5EIJA 3TVOX 5FDIA 1G53A 3W6IA 2OSMA 1G54A 4Y0JA 1OKNA 1CCTA 4IDRX 4K0SA 4R5BA 5CJFA 4RN4A 4E5QA 2CBCA 5JGSB 1TEUX 1RJ5A 1G4JA 4C3TA 3BETA 1CNWA 3P55A 1OQ5A 3U45X 1KOQA 1CA2A 4PYXA 5JQ0A 5DOHA 5J8ZA 2WEJA 4FU5A 2FNNA 4QJMA 5G03A 1CNJA 4Z1JA 4RFDA 2NXSA 2FOQA 2CA2A 4WW6A 3DV7A 1CVDA 2WD3A 5FNJA 3KIGA 5E2NA 2EU2A 5JQTA 5DSOA 5FNHA 1CIMA 4CA2A 3M5SA 4Q78A 4QJXA 4CNVA 4Q6EA 4YXUA 2F14A 1AM6A 1CAJA 4K0TA 4RUXA 3N0NA 4HEWA 1BICA 3DVBA 3KS3A 1RAYA 3K2FA 3DC3A 1V9IC 4PQ7A 2WEOA 3DCCA 4L5VA 4Q07A 1CVBA 3DVCA 3OKVA 4QEFA 1DCAA 1G0FA 4KP5A 1FR4A 5DSIA 5EOIA 2OSFA 1FQMA 3S8XA 1DMXA 3MNJA 5SZ2A 4YGJA 3OIKA 3JXGA 4M2VA 4HEYA 4M2UA 4XZ5A 1H9NA 1Z93A 3RG4A 4ZWZA 1Z9YA 1HCAA 3M2YA 3BL0A 3ML5A 5SZ1A 3K34A 1CVAA 3N3JA 2Q38A 5FL6A 1BNQA 1HEAA 1ZSAA 4MLTA 4KP8A 2ZNCA 1IF5A 1DMYA 4TWMA 4HEZA 1CVFA 1OKMA 1TB0X 1T9NA 4ETQC 1YO1A 3FE4A 3M40A 3S75B 4QJWA 2ABEA 1CILA 1RZDA 1CAKA 2FOYA 3OKUA 3MYQA 1HEBA 4WL4A 3RYVB 5DOGA 1G1DA 2O4ZA 3M1KA 3HFPA 3MDZA 1UGAA 4Z1NA 1G45A 3NJ9A 9CA2A 4YGFA 3SBIA 1HEDA 1JD0A 4Q0LA 6CA2A 2FOSA 4ILXA 4YGKA 3CAJA 5FNKA 1AZMA 1CVEA 3SAXA 2NWZA 1EOUA 4MO8A 4K13A 5E5RA 3RYXB 4YXOA 1J9WA 3P4VA 1MUAA 3DBUA 1RJ6A 3GZ0A 3R17B 4LU3A 4QSIA 5SZ5A 1UGCA 2FNKA 3MHMA 3IBIA 4JSZA 2FNMA 3TMJA 3T5UA 2X7TA 4QIYA 4HF3A 1KWRA 3M2NA 3C7PA 1BZMA 4UOVA 5FLRA 4KNIA 4R5AA 1CNGA 5SZ0A 4WUPA 5FLOA 2NXTA 4L5WA 4RFCA 3JXHC 1CNYA 5EH8A 1FQNA 1CCSA 4KAPA 3BL1A 4FVOA 2EZ7A 1ZFKA 4Q08A 3Q31A 4E3FA 3V3HB 2EU3A 4RIVA 3IBNA 2CBAA 5EHEA 4ZX0A 1TG9A 1G52A 4R59A 4XFWA 4HU1A 4Q06A 1RZEA 4CNXA 5DVXA 5EKHA 4YXIA 1RZBA 2NN7A 2X7UA 4G0CA 4M2RA 5G0BA 3EFTA 3HKQA 4CNWA 3JXFA 1CAZA 1ZGEA 3HKNA 3M3XA 4Q7PA 3NB5A 3KLDB 2HD6A 12CAA 1IF9A 3K7KA 3V3IB 4BF6A 3RZ1B 1CRMA 3MNKA 3S78B 3KONA 5JG3B 4Q90A 3DVDA 3MNAA 1CAOA 1DCBA 5FLTA 1URTA 3MWOA 5BRVA 1FSQA 5DSRA 4KNJA 5EHWA 4E3HA 1BNNA 1ZE8A 2IT4A 1FR7A 5CA2A 1LG6A 5SZ4A 2VVBX 3DA2A 5SZ3A 5EZTX 1HECA 3HS4A 5JEHB 1BN1A 5CLUA 4Q8YA 4ZAOA 3S9TA 4QSBA 1HUHA 4QTLA 5JDVB 4IWZA 4QK3A 5FNIA 3U47A 4CNRA 4YGLA 4LP6A 3P3HA 4Q81A 5A6HA 5IPZA 4QJOA 4WUQA 3S71B 2NN1A 3B1BA 3T83A 1AVNA 5DSLA 2CBBA 5JGTB 3MNUA 1CA3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HKT A;  3RGE A;  1BN3 A;  1HCB A;  4XIX A;  1BCD A;  1LZV A;  4FL7 A;  5FNM A;  5JEP B;  1YDC A;  4CQ0 A;  2CBD A;  4JSA A;  2FOU A;  3F7U A;  1CNI A;  3S76 A;  3S73 B;  1CVH A;  3OY0 A;  3DAZ A;  3V3F A;  1F2W A;  3IGP A;  4MTY A;  1IF6 A;  3OYS A;  3M98 A;  5HPJ A;  4Q8X A;  3TVN X;  2HL4 A;  1ZSB A;  2NWP A;  4HT2 A;  3T82 A;  1YO0 A;  4MLX A;  4QY3 A;  2HNC A;  4Q7W A;  5FLQ A;  3QYK A;  5DSP A;  1TTM A;  3OYQ A;  5AMD A;  2NNO A;  3RZ0 B;  1JCZ A;  2HKK A;  4Q87 A;  4E9O X;  3HLJ A;  2QP6 A;  2NNG A;  4LHI A;  1FSR A;  2H4N A;  4K0Z A;  3P58 A;  4ZWX A;  3KOK A;  5EH7 A;  4JSW A;  3DCS A;  2FW4 A;  5G0C A;  1YO2 A;  3RLD A;  1I90 A;  4YVY A;  1CAM A;  2NNS A;  3SBH A;  3MNH A;  3M2X A;  3ZNC A;  4KNM A;  1ZGF A;  2AX2 A;  3S72 B;  1RAZ A;  3RZ7 A;  4L5U A;  4ITO A;  4Q49 A;  2POV A;  4YX4 A;  2VVA X;  5E5U A;  3V3G B;  4FRC A;  4QK1 A;  1TE3 X;  4HBA A;  5FL5 A;  5A25 A;  1H4N A;  1IF7 A;  1I9N A;  3M1W A;  1HUG A;  1RZA A;  2NMX A;  1G0E A;  2QO8 A;  3U3A X;  3V7X A;  3UYN A;  1ZFQ A;  3DCW A;  1TG3 A;  1ZSC A;  3RYJ B;  1I9L A;  4XIW A;  5EHV A;  1UGF A;  4QK2 A;  3W6H A;  3S77 B;  1CNK A;  5L3O A;  3F8E A;  4G7A A;  1KWQ A;  4FIK A;  4Q7S A;  4Z1K A;  3M04 A;  4E3G A;  5DSJ A;  5DSM A;  1G4O A;  1G46 A;  4Z1E A;  4BF1 A;  1YDB A;  2POU A;  5BRW A;  1CRA A;  3N2P A;  4RH2 A;  3S97 A;  2FMG A;  2H15 A;  4WW8 A;  3T84 A;  4QSJ A;  4CAC A;  4QJ0 A;  2Q1Q A;  8CA2 A;  2AW1 A;  3V3J A;  1YDD A;  1UGD A;  3D9Z A;  3D8W A;  1THK A;  3DD0 A;  4PZH A;  5DSN A;  1CVC A;  3FW3 A;  4N0X B;  3CZV A;  5DSK A;  5SZ7 A;  1V9E A;  3F7B A;  3R16 A;  5AML A;  4YGN A;  1H9Q A;  4GL1 X;  2NXR A;  4PYY A;  3FFP X;  3D93 A;  3IBL A;  3LXE A;  3RZ8 A;  1BNV A;  3RJ7 A;  4YHA A;  4XE1 A;  3KKX A;  1RZC A;  1Z97 A;  5JEG B;  2POW A;  4DZ7 A;  5FDC A;  1I8Z A;  4M2W A;  4COQ A;  3D92 A;  3S74 B;  3M5E A;  2WEH A;  2WEG A;  5FNL A;  5G01 A;  3V2J A;  3DD8 A;  1XEV A;  1CAN A;  1I91 A;  5SZ6 A;  5FLP A;  5BRU A;  4Q9Y A;  3M2Z A;  2FOV A;  3T5Z A;  2HOC A;  2NWO A;  2NNV A;  5E28 A;  3UYQ A;  1BN4 A;  1CNH A;  3U7C A;  1CAY A;  1CZM A;  3IEO A;  3MZC A;  1TH9 A;  3P44 A;  4E3D A;  3OIL A;  2CBE A;  1I9P A;  5C8I A;  3M1J A;  2W2J A;  3CA2 A;  1JV0 A;  5EH5 A;  4KNN A;  3V2M A;  4X5S A;  3M96 A;  3M14 A;  1XEG A;  4KUW A;  5E2K A;  3ZP9 A;  5BYI A;  4FPT A;  2X7S A;  3F4X A;  5JES B;  3RYY A;  3ML2 A;  1CNX A;  4MDM A;  3PO6 A;  1TBT X;  1ZNC A;  5EKJ A;  2Q1B A;  5FLS A;  1G6V A;  4BCW A;  3M5T A;  3MMF A;  1Y7W A;  5L6K A;  4Z0Q A;  3P5A A;  1UGG A;  1CAH A;  2QOA A;  4KV0 A;  1LG5 A;  1FLJ A;  5E2R A;  3IAI A;  4DZ9 A;  5LMD A;  3IBU A;  4ZX1 A;  3T85 A;  1ZH9 A;  1FQR A;  4Q7V A;  1MOO A;  3B4F A;  4QIZ A;  4QSA A;  1CNC A;  1UGB A;  2WD2 A;  3L14 A;  4ZWY A;  1I9Q A;  5E2M A;  3P3J A;  3DC9 A;  4Q83 A;  4WR7 A;  1LUG A;  3N4B A;  3PYK A;  4TWL A;  1BNU A;  4Q09 A;  3OIM A;  3M67 A;  3D0N A;  4YWP A;  4ZWI A;  4FVN A;  1I9M A;  7CA2 A;  3MNI A;  4JSS A;  1CAI A;  3SAP A;  2FMZ A;  3MHI A;  5DRS A;  3HKU A;  1BNM A;  4Q8Z A;  4QJP A;  4RUZ A;  3PJJ A;  4RUY A;  1BV3 A;  1YDA A;  3VBD A;  4ITP A;  1OKL A;  3RZ5 A;  1XQ0 A;  3KNE A;  4KUV A;  3CYU A;  4JS6 A;  1HVA A;  4MDG A;  1CIN A;  5BNL A;  1G3Z A;  1LGD A;  5EKM A;  4E4A A;  4MDL A;  1XPZ A;  3RG3 A;  4E49 A;  1TEQ X;  3MHO A;  1KEQ A;  3KOI A;  5FNG A;  1IF8 A;  2ILI A;  2NWY A;  1CCU A;  5JG5 B;  5CAC A;  1G48 A;  1CNB A;  1CAL A;  5DSQ A;  3P5L A;  3EFI A;  1FSN A;  1UGE A;  1A42 A;  3MHL A;  1FQL A;  4HT0 A;  1I9O A;  3NI5 A;  4PXX A;  1IF4 A;  1BNW A;  4RIU A;  2GEH A;  2HFW A;  4KUY A;  4Q99 A;  3V5G A;  1BNT A;  3M1Q A;  3MHC A;  4N16 A;  1KOP A;  5AMG A;  3KWA A;  5E2S A;  2CAB A;  5FL4 A;  4K1Q A;  3RYZ A;  4YYT A;  4Q6D A;  2GD8 A;  5EIJ A;  3TVO X;  5FDI A;  1G53 A;  3W6I A;  2OSM A;  1G54 A;  4Y0J A;  1OKN A;  1CCT A;  4IDR X;  4K0S A;  4R5B A;  5CJF A;  4RN4 A;  4E5Q A;  2CBC A;  5JGS B;  1TEU X;  1RJ5 A;  1G4J A;  4C3T A;  3BET A;  1CNW A;  3P55 A;  1OQ5 A;  3U45 X;  1KOQ A;  1CA2 A;  4PYX A;  5JQ0 A;  5DOH A;  5J8Z A;  2WEJ A;  4FU5 A;  2FNN A;  4QJM A;  5G03 A;  1CNJ A;  4Z1J A;  4RFD A;  2NXS A;  2FOQ A;  2CA2 A;  4WW6 A;  3DV7 A;  1CVD A;  2WD3 A;  5FNJ A;  3KIG A;  5E2N A;  2EU2 A;  5JQT A;  5DSO A;  5FNH A;  1CIM A;  4CA2 A;  3M5S A;  4Q78 A;  4QJX A;  4CNV A;  4Q6E A;  4YXU A;  2F14 A;  1AM6 A;  1CAJ A;  4K0T A;  4RUX A;  3N0N A;  4HEW A;  1BIC A;  3DVB A;  3KS3 A;  1RAY A;  3K2F A;  3DC3 A;  1V9I C;  4PQ7 A;  2WEO A;  3DCC A;  4L5V A;  4Q07 A;  1CVB A;  3DVC A;  3OKV A;  4QEF A;  1DCA A;  1G0F A;  4KP5 A;  1FR4 A;  5DSI A;  5EOI A;  2OSF A;  1FQM A;  3S8X A;  1DMX A;  3MNJ A;  5SZ2 A;  4YGJ A;  3OIK A;  3JXG A;  4M2V A;  4HEY A;  4M2U A;  4XZ5 A;  1H9N A;  1Z93 A;  3RG4 A;  4ZWZ A;  1Z9Y A;  1HCA A;  3M2Y A;  3BL0 A;  3ML5 A;  5SZ1 A;  3K34 A;  1CVA A;  3N3J A;  2Q38 A;  5FL6 A;  1BNQ A;  1HEA A;  1ZSA A;  4MLT A;  4KP8 A;  2ZNC A;  1IF5 A;  1DMY A;  4TWM A;  4HEZ A;  1CVF A;  1OKM A;  1TB0 X;  1T9N A;  4ETQ C;  1YO1 A;  3FE4 A;  3M40 A;  3S75 B;  4QJW A;  2ABE A;  1CIL A;  1RZD A;  1CAK A;  2FOY A;  3OKU A;  3MYQ A;  1HEB A;  4WL4 A;  3RYV B;  5DOG A;  1G1D A;  2O4Z A;  3M1K A;  3HFP A;  3MDZ A;  1UGA A;  4Z1N A;  1G45 A;  3NJ9 A;  9CA2 A;  4YGF A;  3SBI A;  1HED A;  1JD0 A;  4Q0L A;  6CA2 A;  2FOS A;  4ILX A;  4YGK A;  3CAJ A;  5FNK A;  1AZM A;  1CVE A;  3SAX A;  2NWZ A;  1EOU A;  4MO8 A;  4K13 A;  5E5R A;  3RYX B;  4YXO A;  1J9W A;  3P4V A;  1MUA A;  3DBU A;  1RJ6 A;  3GZ0 A;  3R17 B;  4LU3 A;  4QSI A;  5SZ5 A;  1UGC A;  2FNK A;  3MHM A;  3IBI A;  4JSZ A;  2FNM A;  3TMJ A;  3T5U A;  2X7T A;  4QIY A;  4HF3 A;  1KWR A;  3M2N A;  3C7P A;  1BZM A;  4UOV A;  5FLR A;  4KNI A;  4R5A A;  1CNG A;  5SZ0 A;  4WUP A;  5FLO A;  2NXT A;  4L5W A;  4RFC A;  3JXH C;  1CNY A;  5EH8 A;  1FQN A;  1CCS A;  4KAP A;  3BL1 A;  4FVO A;  2EZ7 A;  1ZFK A;  4Q08 A;  3Q31 A;  4E3F A;  3V3H B;  2EU3 A;  4RIV A;  3IBN A;  2CBA A;  5EHE A;  4ZX0 A;  1TG9 A;  1G52 A;  4R59 A;  4XFW A;  4HU1 A;  4Q06 A;  1RZE A;  4CNX A;  5DVX A;  5EKH A;  4YXI A;  1RZB A;  2NN7 A;  2X7U A;  4G0C A;  4M2R A;  5G0B A;  3EFT A;  3HKQ A;  4CNW A;  3JXF A;  1CAZ A;  1ZGE A;  3HKN A;  3M3X A;  4Q7P A;  3NB5 A;  3KLD B;  2HD6 A;  12CA A;  1IF9 A;  3K7K A;  3V3I B;  4BF6 A;  3RZ1 B;  1CRM A;  3MNK A;  3S78 B;  3KON A;  5JG3 B;  4Q90 A;  3DVD A;  3MNA A;  1CAO A;  1DCB A;  5FLT A;  1URT A;  3MWO A;  5BRV A;  1FSQ A;  5DSR A;  4KNJ A;  5EHW A;  4E3H A;  1BNN A;  1ZE8 A;  2IT4 A;  1FR7 A;  5CA2 A;  1LG6 A;  5SZ4 A;  2VVB X;  3DA2 A;  5SZ3 A;  5EZT X;  1HEC A;  3HS4 A;  5JEH B;  1BN1 A;  5CLU A;  4Q8Y A;  4ZAO A;  3S9T A;  4QSB A;  1HUH A;  4QTL A;  5JDV B;  4IWZ A;  4QK3 A;  5FNI A;  3U47 A;  4CNR A;  4YGL A;  4LP6 A;  3P3H A;  4Q81 A;  5A6H A;  5IPZ A;  4QJO A;  4WUQ A;  3S71 B;  2NN1 A;  3B1B A;  3T83 A;  1AVN A;  5DSL A;  2CBB A;  5JGT B;  3MNU A;  1CA3 A; 
#chains in the Genus database with same CATH topology
 3HKT A;  3RGE A;  1BN3 A;  1HCB A;  4XIX A;  1BCD A;  1LZV A;  4FL7 A;  5FNM A;  5JEP B;  1YDC A;  4CQ0 A;  2CBD A;  4JSA A;  2FOU A;  3F7U A;  1CNI A;  3S76 A;  3S73 B;  1CVH A;  3OY0 A;  3DAZ A;  3V3F A;  1F2W A;  3IGP A;  4MTY A;  1IF6 A;  3OYS A;  3M98 A;  5HPJ A;  4Q8X A;  3TVN X;  2HL4 A;  1ZSB A;  2NWP A;  4HT2 A;  3T82 A;  1YO0 A;  4MLX A;  4QY3 A;  2HNC A;  4Q7W A;  5FLQ A;  3QYK A;  5DSP A;  1TTM A;  3OYQ A;  5AMD A;  2NNO A;  3RZ0 B;  1JCZ A;  2HKK A;  4Q87 A;  4E9O X;  3HLJ A;  2QP6 A;  2NNG A;  4LHI A;  1FSR A;  2H4N A;  4K0Z A;  3P58 A;  4ZWX A;  3KOK A;  5EH7 A;  4JSW A;  3DCS A;  2FW4 A;  5G0C A;  1YO2 A;  3RLD A;  1I90 A;  4YVY A;  1CAM A;  2NNS A;  3SBH A;  3MNH A;  3M2X A;  3ZNC A;  4KNM A;  1ZGF A;  2AX2 A;  3S72 B;  1RAZ A;  3RZ7 A;  4L5U A;  4ITO A;  4Q49 A;  2POV A;  4YX4 A;  2VVA X;  5E5U A;  3V3G B;  4FRC A;  4QK1 A;  1TE3 X;  4HBA A;  5FL5 A;  5A25 A;  1H4N A;  1IF7 A;  1I9N A;  3M1W A;  1HUG A;  1RZA A;  2NMX A;  1G0E A;  2QO8 A;  3U3A X;  3V7X A;  3UYN A;  1ZFQ A;  3DCW A;  1TG3 A;  1ZSC A;  3RYJ B;  1I9L A;  4XIW A;  5EHV A;  1UGF A;  4QK2 A;  3W6H A;  3S77 B;  1CNK A;  5L3O A;  3F8E A;  4G7A A;  1KWQ A;  4FIK A;  4Q7S A;  4Z1K A;  3M04 A;  4E3G A;  5DSJ A;  5DSM A;  1G4O A;  1G46 A;  4Z1E A;  4BF1 A;  1YDB A;  2POU A;  5BRW A;  1CRA A;  3N2P A;  4RH2 A;  3S97 A;  2FMG A;  2H15 A;  4WW8 A;  3T84 A;  4QSJ A;  4CAC A;  4QJ0 A;  2Q1Q A;  8CA2 A;  2AW1 A;  3V3J A;  1YDD A;  1UGD A;  3D9Z A;  3D8W A;  1THK A;  3DD0 A;  4PZH A;  5DSN A;  1CVC A;  3FW3 A;  4N0X B;  3CZV A;  5DSK A;  5SZ7 A;  1V9E A;  3F7B A;  3R16 A;  5AML A;  4YGN A;  1H9Q A;  4GL1 X;  2NXR A;  4PYY A;  3FFP X;  3D93 A;  3IBL A;  3LXE A;  3RZ8 A;  1BNV A;  3RJ7 A;  4YHA A;  4XE1 A;  3KKX A;  1RZC A;  1Z97 A;  5JEG B;  2POW A;  4DZ7 A;  5FDC A;  1I8Z A;  4M2W A;  4COQ A;  3D92 A;  3S74 B;  3M5E A;  2WEH A;  2WEG A;  5FNL A;  5G01 A;  3V2J A;  3DD8 A;  1XEV A;  1CAN A;  1I91 A;  5SZ6 A;  5FLP A;  5BRU A;  4Q9Y A;  3M2Z A;  2FOV A;  3T5Z A;  2HOC A;  2NWO A;  2NNV A;  5E28 A;  3UYQ A;  1BN4 A;  1CNH A;  3U7C A;  1CAY A;  1CZM A;  3IEO A;  3MZC A;  1TH9 A;  3P44 A;  4E3D A;  3OIL A;  2CBE A;  1I9P A;  5C8I A;  3M1J A;  2W2J A;  3CA2 A;  1JV0 A;  5EH5 A;  4KNN A;  3V2M A;  4X5S A;  3M96 A;  3M14 A;  1XEG A;  4KUW A;  5E2K A;  3ZP9 A;  5BYI A;  4FPT A;  2X7S A;  3F4X A;  5JES B;  3RYY A;  3ML2 A;  1CNX A;  4MDM A;  3PO6 A;  1TBT X;  1ZNC A;  5EKJ A;  2Q1B A;  5FLS A;  1G6V A;  4BCW A;  3M5T A;  3MMF A;  1Y7W A;  5L6K A;  4Z0Q A;  3P5A A;  1UGG A;  1CAH A;  2QOA A;  4KV0 A;  1LG5 A;  1FLJ A;  5E2R A;  3IAI A;  4DZ9 A;  5LMD A;  3IBU A;  4ZX1 A;  3T85 A;  1ZH9 A;  1FQR A;  4Q7V A;  1MOO A;  3B4F A;  4QIZ A;  4QSA A;  1CNC A;  1UGB A;  2WD2 A;  3L14 A;  4ZWY A;  1I9Q A;  5E2M A;  3P3J A;  3DC9 A;  4Q83 A;  4WR7 A;  1LUG A;  3N4B A;  3PYK A;  4TWL A;  1BNU A;  4Q09 A;  3OIM A;  3M67 A;  3D0N A;  4YWP A;  4ZWI A;  4FVN A;  1I9M A;  7CA2 A;  3MNI A;  4JSS A;  1CAI A;  3SAP A;  2FMZ A;  3MHI A;  5DRS A;  3HKU A;  1BNM A;  4Q8Z A;  4QJP A;  4RUZ A;  3PJJ A;  4RUY A;  1BV3 A;  1YDA A;  3VBD A;  4ITP A;  1OKL A;  3RZ5 A;  1XQ0 A;  3KNE A;  4KUV A;  3CYU A;  4JS6 A;  1HVA A;  4MDG A;  1CIN A;  5BNL A;  1G3Z A;  1LGD A;  5EKM A;  4E4A A;  4MDL A;  1XPZ A;  3RG3 A;  4E49 A;  1TEQ X;  3MHO A;  1KEQ A;  3KOI A;  5FNG A;  1IF8 A;  2ILI A;  2NWY A;  1CCU A;  5JG5 B;  5CAC A;  1G48 A;  1CNB A;  1CAL A;  5DSQ A;  3P5L A;  3EFI A;  1FSN A;  1UGE A;  1A42 A;  3MHL A;  1FQL A;  4HT0 A;  1I9O A;  3NI5 A;  4PXX A;  1IF4 A;  1BNW A;  4RIU A;  2GEH A;  2HFW A;  4KUY A;  4Q99 A;  3V5G A;  1BNT A;  3M1Q A;  3MHC A;  4N16 A;  1KOP A;  5AMG A;  3KWA A;  5E2S A;  2CAB A;  5FL4 A;  4K1Q A;  3RYZ A;  4YYT A;  4Q6D A;  2GD8 A;  5EIJ A;  3TVO X;  5FDI A;  1G53 A;  3W6I A;  2OSM A;  1G54 A;  4Y0J A;  1OKN A;  1CCT A;  4IDR X;  4K0S A;  4R5B A;  5CJF A;  4RN4 A;  4E5Q A;  2CBC A;  5JGS B;  1TEU X;  1RJ5 A;  1G4J A;  4C3T A;  3BET A;  1CNW A;  3P55 A;  1OQ5 A;  3U45 X;  1KOQ A;  1CA2 A;  4PYX A;  5JQ0 A;  5DOH A;  5J8Z A;  2WEJ A;  4FU5 A;  2FNN A;  4QJM A;  5G03 A;  1CNJ A;  4Z1J A;  4RFD A;  2NXS A;  2FOQ A;  2CA2 A;  4WW6 A;  3DV7 A;  1CVD A;  2WD3 A;  5FNJ A;  3KIG A;  5E2N A;  2EU2 A;  5JQT A;  5DSO A;  5FNH A;  1CIM A;  4CA2 A;  3M5S A;  4Q78 A;  4QJX A;  4CNV A;  4Q6E A;  4YXU A;  2F14 A;  1AM6 A;  1CAJ A;  4K0T A;  4RUX A;  3N0N A;  4HEW A;  1BIC A;  3DVB A;  3KS3 A;  1RAY A;  3K2F A;  3DC3 A;  1V9I C;  4PQ7 A;  2WEO A;  3DCC A;  4L5V A;  4Q07 A;  1CVB A;  3DVC A;  3OKV A;  4QEF A;  1DCA A;  1G0F A;  4KP5 A;  1FR4 A;  5DSI A;  5EOI A;  2OSF A;  1FQM A;  3S8X A;  1DMX A;  3MNJ A;  5SZ2 A;  4YGJ A;  3OIK A;  3JXG A;  4M2V A;  4HEY A;  4M2U A;  4XZ5 A;  1H9N A;  1Z93 A;  3RG4 A;  4ZWZ A;  1Z9Y A;  1HCA A;  3M2Y A;  3BL0 A;  3ML5 A;  5SZ1 A;  3K34 A;  1CVA A;  3N3J A;  2Q38 A;  5FL6 A;  1BNQ A;  1HEA A;  1ZSA A;  4MLT A;  4KP8 A;  2ZNC A;  1IF5 A;  1DMY A;  4TWM A;  4HEZ A;  1CVF A;  1OKM A;  1TB0 X;  1T9N A;  4ETQ C;  1YO1 A;  3FE4 A;  3M40 A;  3S75 B;  4QJW A;  2ABE A;  1CIL A;  1RZD A;  1CAK A;  2FOY A;  3OKU A;  3MYQ A;  1HEB A;  4WL4 A;  3RYV B;  5DOG A;  1G1D A;  2O4Z A;  3M1K A;  3HFP A;  3MDZ A;  1UGA A;  4Z1N A;  1G45 A;  3NJ9 A;  9CA2 A;  4YGF A;  3SBI A;  1HED A;  1JD0 A;  4Q0L A;  6CA2 A;  2FOS A;  4ILX A;  4YGK A;  3CAJ A;  5FNK A;  1AZM A;  1CVE A;  3SAX A;  2NWZ A;  1EOU A;  4MO8 A;  4K13 A;  5E5R A;  3RYX B;  4YXO A;  1J9W A;  3P4V A;  1MUA A;  3DBU A;  1RJ6 A;  3GZ0 A;  3R17 B;  4LU3 A;  4QSI A;  5SZ5 A;  1UGC A;  2FNK A;  3MHM A;  3IBI A;  4JSZ A;  2FNM A;  3TMJ A;  3T5U A;  2X7T A;  4QIY A;  4HF3 A;  1KWR A;  3M2N A;  3C7P A;  1BZM A;  4UOV A;  5FLR A;  4KNI A;  4R5A A;  1CNG A;  5SZ0 A;  4WUP A;  5FLO A;  2NXT A;  4L5W A;  4RFC A;  3JXH C;  1CNY A;  5EH8 A;  1FQN A;  1CCS A;  4KAP A;  3BL1 A;  4FVO A;  2EZ7 A;  1ZFK A;  4Q08 A;  3Q31 A;  4E3F A;  3V3H B;  2EU3 A;  4RIV A;  3IBN A;  2CBA A;  5EHE A;  4ZX0 A;  1TG9 A;  1G52 A;  4R59 A;  4XFW A;  4HU1 A;  4Q06 A;  1RZE A;  4CNX A;  5DVX A;  5EKH A;  4YXI A;  1RZB A;  2NN7 A;  2X7U A;  4G0C A;  4M2R A;  5G0B A;  3EFT A;  3HKQ A;  4CNW A;  3JXF A;  1CAZ A;  1ZGE A;  3HKN A;  3M3X A;  4Q7P A;  3NB5 A;  3KLD B;  2HD6 A;  12CA A;  1IF9 A;  3K7K A;  3V3I B;  4BF6 A;  3RZ1 B;  1CRM A;  3MNK A;  3S78 B;  3KON A;  5JG3 B;  4Q90 A;  3DVD A;  3MNA A;  1CAO A;  1DCB A;  5FLT A;  1URT A;  3MWO A;  5BRV A;  1FSQ A;  5DSR A;  4KNJ A;  5EHW A;  4E3H A;  1BNN A;  1ZE8 A;  2IT4 A;  1FR7 A;  5CA2 A;  1LG6 A;  5SZ4 A;  2VVB X;  3DA2 A;  5SZ3 A;  5EZT X;  1HEC A;  3HS4 A;  5JEH B;  1BN1 A;  5CLU A;  4Q8Y A;  4ZAO A;  3S9T A;  4QSB A;  1HUH A;  4QTL A;  5JDV B;  4IWZ A;  4QK3 A;  5FNI A;  3U47 A;  4CNR A;  4YGL A;  4LP6 A;  3P3H A;  4Q81 A;  5A6H A;  5IPZ A;  4QJO A;  4WUQ A;  3S71 B;  2NN1 A;  3B1B A;  3T83 A;  1AVN A;  5DSL A;  2CBB A;  5JGT B;  3MNU A;  1CA3 A; 
#chains in the Genus database with same CATH homology
 3HKT A;  3RGE A;  1BN3 A;  1HCB A;  4XIX A;  1BCD A;  1LZV A;  4FL7 A;  5FNM A;  5JEP B;  1YDC A;  4CQ0 A;  2CBD A;  4JSA A;  2FOU A;  3F7U A;  1CNI A;  3S76 A;  3S73 B;  1CVH A;  3OY0 A;  3DAZ A;  3V3F A;  1F2W A;  3IGP A;  4MTY A;  1IF6 A;  3OYS A;  3M98 A;  5HPJ A;  4Q8X A;  3TVN X;  2HL4 A;  1ZSB A;  2NWP A;  4HT2 A;  3T82 A;  1YO0 A;  4MLX A;  4QY3 A;  2HNC A;  4Q7W A;  5FLQ A;  3QYK A;  5DSP A;  1TTM A;  3OYQ A;  5AMD A;  2NNO A;  3RZ0 B;  1JCZ A;  2HKK A;  4Q87 A;  4E9O X;  3HLJ A;  2QP6 A;  2NNG A;  4LHI A;  1FSR A;  2H4N A;  4K0Z A;  3P58 A;  4ZWX A;  3KOK A;  5EH7 A;  4JSW A;  3DCS A;  2FW4 A;  5G0C A;  1YO2 A;  3RLD A;  1I90 A;  4YVY A;  1CAM A;  2NNS A;  3SBH A;  3MNH A;  3M2X A;  3ZNC A;  4KNM A;  1ZGF A;  2AX2 A;  3S72 B;  1RAZ A;  3RZ7 A;  4L5U A;  4ITO A;  4Q49 A;  2POV A;  4YX4 A;  2VVA X;  5E5U A;  3V3G B;  4FRC A;  4QK1 A;  1TE3 X;  4HBA A;  5FL5 A;  5A25 A;  1H4N A;  1IF7 A;  1I9N A;  3M1W A;  1HUG A;  1RZA A;  2NMX A;  1G0E A;  2QO8 A;  3U3A X;  3V7X A;  3UYN A;  1ZFQ A;  3DCW A;  1TG3 A;  1ZSC A;  3RYJ B;  1I9L A;  4XIW A;  5EHV A;  1UGF A;  4QK2 A;  3W6H A;  3S77 B;  1CNK A;  5L3O A;  3F8E A;  4G7A A;  1KWQ A;  4FIK A;  4Q7S A;  4Z1K A;  3M04 A;  4E3G A;  5DSJ A;  5DSM A;  1G4O A;  1G46 A;  4Z1E A;  4BF1 A;  1YDB A;  2POU A;  5BRW A;  1CRA A;  3N2P A;  4RH2 A;  3S97 A;  2FMG A;  2H15 A;  4WW8 A;  3T84 A;  4QSJ A;  4CAC A;  4QJ0 A;  2Q1Q A;  8CA2 A;  2AW1 A;  3V3J A;  1YDD A;  1UGD A;  3D9Z A;  3D8W A;  1THK A;  3DD0 A;  4PZH A;  5DSN A;  1CVC A;  3FW3 A;  4N0X B;  3CZV A;  5DSK A;  5SZ7 A;  1V9E A;  3F7B A;  3R16 A;  5AML A;  4YGN A;  1H9Q A;  4GL1 X;  2NXR A;  4PYY A;  3FFP X;  3D93 A;  3IBL A;  3LXE A;  3RZ8 A;  1BNV A;  3RJ7 A;  4YHA A;  4XE1 A;  3KKX A;  1RZC A;  1Z97 A;  5JEG B;  2POW A;  4DZ7 A;  5FDC A;  1I8Z A;  4M2W A;  4COQ A;  3D92 A;  3S74 B;  3M5E A;  2WEH A;  2WEG A;  5FNL A;  5G01 A;  3V2J A;  3DD8 A;  1XEV A;  1CAN A;  1I91 A;  5SZ6 A;  5FLP A;  5BRU A;  4Q9Y A;  3M2Z A;  2FOV A;  3T5Z A;  2HOC A;  2NWO A;  2NNV A;  5E28 A;  3UYQ A;  1BN4 A;  1CNH A;  3U7C A;  1CAY A;  1CZM A;  3IEO A;  3MZC A;  1TH9 A;  3P44 A;  4E3D A;  3OIL A;  2CBE A;  1I9P A;  5C8I A;  3M1J A;  2W2J A;  3CA2 A;  1JV0 A;  5EH5 A;  4KNN A;  3V2M A;  4X5S A;  3M96 A;  3M14 A;  1XEG A;  4KUW A;  5E2K A;  3ZP9 A;  5BYI A;  4FPT A;  2X7S A;  3F4X A;  5JES B;  3RYY A;  3ML2 A;  1CNX A;  4MDM A;  3PO6 A;  1TBT X;  1ZNC A;  5EKJ A;  2Q1B A;  5FLS A;  1G6V A;  4BCW A;  3M5T A;  3MMF A;  1Y7W A;  5L6K A;  4Z0Q A;  3P5A A;  1UGG A;  1CAH A;  2QOA A;  4KV0 A;  1LG5 A;  1FLJ A;  5E2R A;  3IAI A;  4DZ9 A;  5LMD A;  3IBU A;  4ZX1 A;  3T85 A;  1ZH9 A;  1FQR A;  4Q7V A;  1MOO A;  3B4F A;  4QIZ A;  4QSA A;  1CNC A;  1UGB A;  2WD2 A;  3L14 A;  4ZWY A;  1I9Q A;  5E2M A;  3P3J A;  3DC9 A;  4Q83 A;  4WR7 A;  1LUG A;  3N4B A;  3PYK A;  4TWL A;  1BNU A;  4Q09 A;  3OIM A;  3M67 A;  3D0N A;  4YWP A;  4ZWI A;  4FVN A;  1I9M A;  7CA2 A;  3MNI A;  4JSS A;  1CAI A;  3SAP A;  2FMZ A;  3MHI A;  5DRS A;  3HKU A;  1BNM A;  4Q8Z A;  4QJP A;  4RUZ A;  3PJJ A;  4RUY A;  1BV3 A;  1YDA A;  3VBD A;  4ITP A;  1OKL A;  3RZ5 A;  1XQ0 A;  3KNE A;  4KUV A;  3CYU A;  4JS6 A;  1HVA A;  4MDG A;  1CIN A;  5BNL A;  1G3Z A;  1LGD A;  5EKM A;  4E4A A;  4MDL A;  1XPZ A;  3RG3 A;  4E49 A;  1TEQ X;  3MHO A;  1KEQ A;  3KOI A;  5FNG A;  1IF8 A;  2ILI A;  2NWY A;  1CCU A;  5JG5 B;  5CAC A;  1G48 A;  1CNB A;  1CAL A;  5DSQ A;  3P5L A;  3EFI A;  1FSN A;  1UGE A;  1A42 A;  3MHL A;  1FQL A;  4HT0 A;  1I9O A;  3NI5 A;  4PXX A;  1IF4 A;  1BNW A;  4RIU A;  2GEH A;  2HFW A;  4KUY A;  4Q99 A;  3V5G A;  1BNT A;  3M1Q A;  3MHC A;  4N16 A;  1KOP A;  5AMG A;  3KWA A;  5E2S A;  2CAB A;  5FL4 A;  4K1Q A;  3RYZ A;  4YYT A;  4Q6D A;  2GD8 A;  5EIJ A;  3TVO X;  5FDI A;  1G53 A;  3W6I A;  2OSM A;  1G54 A;  4Y0J A;  1OKN A;  1CCT A;  4IDR X;  4K0S A;  4R5B A;  5CJF A;  4RN4 A;  4E5Q A;  2CBC A;  5JGS B;  1TEU X;  1RJ5 A;  1G4J A;  4C3T A;  3BET A;  1CNW A;  3P55 A;  1OQ5 A;  3U45 X;  1KOQ A;  1CA2 A;  4PYX A;  5JQ0 A;  5DOH A;  5J8Z A;  2WEJ A;  4FU5 A;  2FNN A;  4QJM A;  5G03 A;  1CNJ A;  4Z1J A;  4RFD A;  2NXS A;  2FOQ A;  2CA2 A;  4WW6 A;  3DV7 A;  1CVD A;  2WD3 A;  5FNJ A;  3KIG A;  5E2N A;  2EU2 A;  5JQT A;  5DSO A;  5FNH A;  1CIM A;  4CA2 A;  3M5S A;  4Q78 A;  4QJX A;  4CNV A;  4Q6E A;  4YXU A;  2F14 A;  1AM6 A;  1CAJ A;  4K0T A;  4RUX A;  3N0N A;  4HEW A;  1BIC A;  3DVB A;  3KS3 A;  1RAY A;  3K2F A;  3DC3 A;  1V9I C;  4PQ7 A;  2WEO A;  3DCC A;  4L5V A;  4Q07 A;  1CVB A;  3DVC A;  3OKV A;  4QEF A;  1DCA A;  1G0F A;  4KP5 A;  1FR4 A;  5DSI A;  5EOI A;  2OSF A;  1FQM A;  3S8X A;  1DMX A;  3MNJ A;  5SZ2 A;  4YGJ A;  3OIK A;  3JXG A;  4M2V A;  4HEY A;  4M2U A;  4XZ5 A;  1H9N A;  1Z93 A;  3RG4 A;  4ZWZ A;  1Z9Y A;  1HCA A;  3M2Y A;  3BL0 A;  3ML5 A;  5SZ1 A;  3K34 A;  1CVA A;  3N3J A;  2Q38 A;  5FL6 A;  1BNQ A;  1HEA A;  1ZSA A;  4MLT A;  4KP8 A;  2ZNC A;  1IF5 A;  1DMY A;  4TWM A;  4HEZ A;  1CVF A;  1OKM A;  1TB0 X;  1T9N A;  4ETQ C;  1YO1 A;  3FE4 A;  3M40 A;  3S75 B;  4QJW A;  2ABE A;  1CIL A;  1RZD A;  1CAK A;  2FOY A;  3OKU A;  3MYQ A;  1HEB A;  4WL4 A;  3RYV B;  5DOG A;  1G1D A;  2O4Z A;  3M1K A;  3HFP A;  3MDZ A;  1UGA A;  4Z1N A;  1G45 A;  3NJ9 A;  9CA2 A;  4YGF A;  3SBI A;  1HED A;  1JD0 A;  4Q0L A;  6CA2 A;  2FOS A;  4ILX A;  4YGK A;  3CAJ A;  5FNK A;  1AZM A;  1CVE A;  3SAX A;  2NWZ A;  1EOU A;  4MO8 A;  4K13 A;  5E5R A;  3RYX B;  4YXO A;  1J9W A;  3P4V A;  1MUA A;  3DBU A;  1RJ6 A;  3GZ0 A;  3R17 B;  4LU3 A;  4QSI A;  5SZ5 A;  1UGC A;  2FNK A;  3MHM A;  3IBI A;  4JSZ A;  2FNM A;  3TMJ A;  3T5U A;  2X7T A;  4QIY A;  4HF3 A;  1KWR A;  3M2N A;  3C7P A;  1BZM A;  4UOV A;  5FLR A;  4KNI A;  4R5A A;  1CNG A;  5SZ0 A;  4WUP A;  5FLO A;  2NXT A;  4L5W A;  4RFC A;  3JXH C;  1CNY A;  5EH8 A;  1FQN A;  1CCS A;  4KAP A;  3BL1 A;  4FVO A;  2EZ7 A;  1ZFK A;  4Q08 A;  3Q31 A;  4E3F A;  3V3H B;  2EU3 A;  4RIV A;  3IBN A;  2CBA A;  5EHE A;  4ZX0 A;  1TG9 A;  1G52 A;  4R59 A;  4XFW A;  4HU1 A;  4Q06 A;  1RZE A;  4CNX A;  5DVX A;  5EKH A;  4YXI A;  1RZB A;  2NN7 A;  2X7U A;  4G0C A;  4M2R A;  5G0B A;  3EFT A;  3HKQ A;  4CNW A;  3JXF A;  1CAZ A;  1ZGE A;  3HKN A;  3M3X A;  4Q7P A;  3NB5 A;  3KLD B;  2HD6 A;  12CA A;  1IF9 A;  3K7K A;  3V3I B;  4BF6 A;  3RZ1 B;  1CRM A;  3MNK A;  3S78 B;  3KON A;  5JG3 B;  4Q90 A;  3DVD A;  3MNA A;  1CAO A;  1DCB A;  5FLT A;  1URT A;  3MWO A;  5BRV A;  1FSQ A;  5DSR A;  4KNJ A;  5EHW A;  4E3H A;  1BNN A;  1ZE8 A;  2IT4 A;  1FR7 A;  5CA2 A;  1LG6 A;  5SZ4 A;  2VVB X;  3DA2 A;  5SZ3 A;  5EZT X;  1HEC A;  3HS4 A;  5JEH B;  1BN1 A;  5CLU A;  4Q8Y A;  4ZAO A;  3S9T A;  4QSB A;  1HUH A;  4QTL A;  5JDV B;  4IWZ A;  4QK3 A;  5FNI A;  3U47 A;  4CNR A;  4YGL A;  4LP6 A;  3P3H A;  4Q81 A;  5A6H A;  5IPZ A;  4QJO A;  4WUQ A;  3S71 B;  2NN1 A;  3B1B A;  3T83 A;  1AVN A;  5DSL A;  2CBB A;  5JGT B;  3MNU A;  1CA3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...