4XIWA

Carbonic anhydrase cah3 from chlamydomonas reinhardtii in complex with acetazolamide
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
Knots found
sequence length
237
structure length
237
Chain Sequence
AWNYGEVAGPPTWKGVCATGKRQSPINIPLNTSAPKVDAEMGEFDFAYGSFEKCDVLNTGHGTMQVNFPAGNLAFIGNMELELLQFHFHAPSEHAMDGRRYAMEAHLVHKNKSTGNLAVLGIMLEPGGLIKNPALSTALEVAPEVPLAKKPSPKGINPVMLLPKKSKAGTRPFVHYPGSLTTPPCSEGVDWFVFMQPIKVPDSQILDFMRFVGDNKTYATNTRPLQLLNSRLVEYEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Carbonic anhydrase, alpha type
publication title Crystal Structure and Functional Characterization of Photosystem II-Associated Carbonic Anhydrase CAH3 in Chlamydomonas reinhardtii.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
total genus 59
structure length 237
sequence length 237
chains with identical sequence B, C, D, E, F, G, H
other databases KnotProt 2.0: S +31
ec nomenclature
pdb deposition date 2015-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 4xiwA00
1TG3A 2IT4A 1TH9A 3M2ZA 3ML5A 1DMYA 3CYUA 3P4VA 1UGBA 5SZ5A 3MNJA 3PO6A 1ZFKA 4YGJA 3M04A 3D92A 1I90A 4K13A 4YGLA 1KOQA 2QO8A 3KIGA 4JSSA 1RZCA 4JSWA 3KWAA 4Q49A 4Q83A 4CNRA 1HCAA 4Q07A 4QTLA 1MUAA 3R17B 1XEGA 3MHOA 4ITPA 3HS4A 3RYZA 4QJWA 1BNUA 3P58A 1BNMA 5E5RA 1TB0X 1BICA 4XZ5A 3U47A 1H9QA 5DOGA 4YWPA 3NJ9A 4M2UA 1ZNCA 3JXFA 3M40A 4FVNA 4E49A 4ZAOA 4FL7A 4L5UA 3DBUA 3RG4A 4MDLA 1YDBA 1G52A 3BETA 1CA2A 1CVDA 1I9QA 5AMGA 3DC9A 3RZ5A 5IPZA 3OYSA 1TE3X 3TVNX 1OQ5A 5EKHA 4Q90A 2NMXA 1G1DA 3DVCA 5SZ3A 4DZ7A 1HUHA 5FL5A 4R59A 3M1WA 5FLTA 5FLQA 1CCSA 3SAPA 1CZMA 4QJOA 3M1QA 3DA2A 3V3GB 1JCZA 3ML2A 2WD3A 2ABEA 4C3TA 1Z93A 4KP8A 4PYYA 3M3XA 5BYIA 2NXRA 4Q7SA 4Q9YA 4BF1A 3S72B 4Q8XA 5C8IA 4TWLA 4GL1X 3P44A 4KUWA 4Q08A 5FNMA 3S71B 2WD2A 3C7PA 3JXGA 4YXIA 1G48A 1HUGA 4BF6A 3M2XA 5E2SA 4E5QA 3V7XA 1RZEA 3T83A 2Q1BA 2FNMA 4QJ0A 3D8WA 4Z1NA 5FLRA 4CACA 4Q99A 4CQ0A 2F14A 4IWZA 5BNLA 1UGAA 1Z97A 3P3JA 4TWMA 3KKXA 5SZ7A 1XEVA 5JQ0A 3M5TA 9CA2A 2HL4A 4FIKA 1TBTX 1TEUX 4PXXA 6CA2A 5FNKA 4ZWZA 1Z9YA 5EZTX 1HVAA 1I9NA 2GD8A 2WEJA 1KWQA 1BN3A 3N2PA 3P5LA 4XFWA 4BCWA 3MYQA 1HECA 4QIYA 2H4NA 5EH5A 4Z0QA 1LUGA 3T5UA 4MLXA 5EKJA 3P5AA 5E2KA 4DZ9A 4M2RA 1BNNA 5EH7A 4MO8A 3S74B 3CZVA 1BNQA 2NNOA 2NXTA 3MHMA 4MDMA 3S77B 3U7CA 1JD0A 1CVAA 3HKTA 2ZNCA 2FMZA 5FNGA 5FNJA 1CNBA 3MDZA 4MLTA 5DSLA 2Q1QA 1HEAA 5EH8A 4RIVA 5BRUA 1I91A 4N0XB 4XIWA 5G0CA 1CAZA 1ZH9A 4YGNA 2FW4A 3M96A 4QK3A 1CVFA 4PYXA 1YO1A 3BL1A 3RG3A 5FL4A 4KNMA 4CNVA 4HU1A 5G03A 3M2NA 1OKMA 3DD8A 3IEOA 4YHAA 4ZWIA 1THKA 3DVDA 3FW3A 4KV0A 4Q6DA 4WW8A 2OSFA 4HEYA 4E4AA 1G6VA 3HFPA 3MMFA 3BL0A 1CAYA 3M14A 1I9PA 4YGFA 3V3HB 5L3OA 3M5SA 1CVEA 4G0CA 4YYTA 1CNWA 3EFTA 2FOQA 3M67A 3SBHA 3HKNA 3RYXB 2FOVA 1FQMA 3KS3A 3QYKA 1IF9A 3CAJA 1RAYA 2NWOA 2QP6A 4QSIA 3JXHC 4JSZA 3IBNA 3GZ0A 5JQTA 3K2FA 3PJJA 1H4NA 3B4FA 1CINA 2FNKA 3RZ8A 3RYJB 2NWYA 1G46A 3V3JA 3R16A 5FLOA 4E3FA 3MHLA 3N4BA 1UGDA 2W2JA 5CLUA 2X7SA 4Q81A 5CACA 3IBLA 3KNEA 5EHEA 1AZMA 4Q87A 1A42A 1BN1A 1IF4A 1FSNA 2NNSA 1ZGEA 3M2YA 3U45X 1G4JA 5SZ4A 4ZWYA 2NWZA 5EKMA 5SZ0A 4RFDA 1CNJA 1G0EA 5HPJA 3HKQA 4JS6A 2CBEA 4E3GA 1JV0A 3LXEA 4M2VA 4G7AA 7CA2A 3T84A 1I9LA 4QJPA 4FRCA 1CVHA 1RZDA 3NI5A 3S9TA 3KOIA 1LG6A 1I8ZA 2FMGA 4K1QA 4Q09A 3S8XA 4WUQA 4ETQC 3DVBA 1CNKA 4KP5A 3S97A 3W6IA 1G53A 1CNIA 3RZ7A 1BNWA 1CAHA 5A25A 1ZSAA 5DSMA 4XIXA 4QSJA 1FQNA 1G4OA 1G0FA 3IBUA 2CABA 1IF7A 3D0NA 4HT0A 3OIKA 4QJMA 3U3AX 3DCWA 3FE4A 3RGEA 3B1BA 4ZX0A 2CBCA 4Y0JA 5L6KA 4LP6A 1EOUA 4QK1A 2FNNA 2NWPA 1UGCA 3V3IB 4IDRX 3DCCA 1CAIA 3DD0A 3P3HA 5SZ1A 5DSNA 5CJFA 4Q0LA 4RIUA 2FOSA 1FSRA 3RZ1B 1FR4A 1G54A 4Z1EA 2EU2A 3M5EA 3HKUA 5JEGB 1I9MA 4MTYA 1DCBA 5LMDA 3L14A 3NB5A 5DSKA 3IBIA 5SZ2A 3M1JA 4LU3A 5DSPA 4HF3A 1V9EA 4QSAA 5JGSB 4Q7VA 2QOAA 1BCDA 1J9WA 3MNIA 1CILA 4RUZA 1HCBA 1IF8A 1AM6A 3DV7A 4L5VA 5DVXA 4R5BA 4WUPA 4YGKA 4UOVA 5FDCA 5JDVB 5FLPA 1ZFQA 4K0TA 3OILA 4RN4A 2O4ZA 3KONA 1BV3A 1RZBA 4ZWXA 4K0ZA 3VBDA 1I9OA 4N16A 1YO0A 2ILIA 1CANA 3RJ7A 4YXOA 4RH2A 3FFPX 1OKLA 1G45A 5EOIA 1YDDA 1YDAA 5JEHB 4FU5A 2WEGA 5FDIA 1RZAA 1LG5A 3MNUA 3PYKA 4YX4A 1DCAA 3D9ZA 3S75B 4HBAA 4Q6EA 3K7KA 2NXSA 4ITOA 3S73B 3RYYA 4QIZA 1BZMA 4PQ7A 1FLJA 1ZGFA 2H15A 3MHIA 3Q31A 2CBDA 4QEFA 5E28A 3T85A 2POWA 3MNAA 1BN4A 1CIMA 2CBBA 3TVOX 3MHCA 1RAZA 3M98A 4Q78A 1TEQX 2HD6A 2EZ7A 4ILXA 12CAA 1XQ0A 4LHIA 5E2RA 1CCTA 3K34A 4E3DA 3MNKA 2X7UA 2OSMA 3W6HA 4KAPA 1CALA 3T5ZA 3RYVB 3OKUA 4KNNA 4E3HA 3CA2A 4FPTA 1IF5A 4M2WA 1T9NA 5DSQA 4K0SA 5BRWA 2POUA 5JESB 3RLDA 3V5GA 4HEWA 4WW6A 4RUYA 2WEHA 5JGTB 4YVYA 1BNTA 1FR7A 4WR7A 4X5SA 1CNCA 1KEQA 4MDGA 1CAKA 4Z1KA 1RJ6A 1XPZA 2NN7A 3SBIA 2CBAA 2WEOA 5E2MA 5JG3B 3KOKA 3ZNCA 5FNHA 1FQLA 2GEHA 3DCSA 1CAJA 1V9IC 1F2WA 5EHWA 4KUVA 4E9OX 2AW1A 5AMDA 4Z1JA 8CA2A 4YXUA 2NNVA 2HOCA 2AX2A 5FLSA 1CVCA 3F7BA 1KWRA 4QJXA 5G0BA 4L5WA 4KUYA 1FSQA 5DSIA 3EFIA 4HT2A 1CAOA 1H9NA 1KOPA 5JG5B 3M1KA 1OKNA 3N3JA 2CA2A 5J8ZA 3OKVA 2FOYA 4Q8YA 5DOHA 2NN1A 3KLDB 5FNLA 5E5UA 5G01A 2POVA 3IGPA 5AMLA 1HEBA 3MZCA 1URTA 4R5AA 3S76A 4Q8ZA 3UYNA 1DMXA 3D93A 4Q06A 1CRMA 1ZSCA 1CNHA 5SZ6A 5A6HA 2Q38A 1YDCA 1UGEA 3V3FA 3DC3A 4PZHA 4Q7PA 2HFWA 2VVAX 4ZX1A 1IF6A 3DAZA 4CNXA 1CA3A 3F7UA 3HLJA 3MNHA 5EIJA 3UYQA 1BNVA 2HKKA 3N0NA 1ZE8A 5DSOA 1UGGA 2EU3A 3MWOA 3F8EA 4HEZA 4QK2A 5FL6A 1CNXA 5CA2A 1CAMA 3OY0A 4CNWA 1CNYA 4KNIA 3OIMA 4WL4A 4XE1A 4Q7WA 5DRSA 3RZ0B 2FOUA 4RUXA 4COQA 2NNGA 5E2NA 4JSAA 3IAIA 3OYQA 1CNGA 1AVNA 4QSBA 4RFCA 2HNCA 1HEDA 4KNJA 1FQRA 1CRAA 5DSRA 1TG9A 4CA2A 3S78B 3V2JA 5JEPB 5BRVA 3SAXA 1LGDA 4FVOA 1YO2A 1G3ZA 5DSJA 1MOOA 1ZSBA 4QY3A 1CVBA 5FNIA 1Y7WA 1CCUA 1UGFA 3P55A 3T82A 1LZVA 3TMJA 3ZP9A 5EHVA 2X7TA 2VVBX 3V2MA 1TTMA 1RJ5A 3F4XA
chains in the Genus database with same CATH superfamily
1TG3A 2IT4A 1TH9A 3M2ZA 3ML5A 1DMYA 3CYUA 3P4VA 1UGBA 5SZ5A 3MNJA 3PO6A 1ZFKA 4YGJA 3M04A 3D92A 1I90A 4K13A 4YGLA 1KOQA 2QO8A 3KIGA 4JSSA 1RZCA 4JSWA 3KWAA 4Q49A 4Q83A 4CNRA 1HCAA 4Q07A 4QTLA 1MUAA 3R17B 1XEGA 3MHOA 4ITPA 3HS4A 3RYZA 4QJWA 1BNUA 3P58A 1BNMA 5E5RA 1TB0X 1BICA 4XZ5A 3U47A 1H9QA 5DOGA 4YWPA 3NJ9A 4M2UA 1ZNCA 3JXFA 3M40A 4FVNA 4E49A 4ZAOA 4FL7A 4L5UA 3DBUA 3RG4A 4MDLA 1YDBA 1G52A 3BETA 1CA2A 1CVDA 1I9QA 5AMGA 3DC9A 3RZ5A 5IPZA 3OYSA 1TE3X 3TVNX 1OQ5A 5EKHA 4Q90A 2NMXA 1G1DA 3DVCA 5SZ3A 4DZ7A 1HUHA 5FL5A 4R59A 3M1WA 5FLTA 5FLQA 1CCSA 3SAPA 1CZMA 4QJOA 3M1QA 3DA2A 3V3GB 1JCZA 3ML2A 2WD3A 2ABEA 4C3TA 1Z93A 4KP8A 4PYYA 3M3XA 5BYIA 2NXRA 4Q7SA 4Q9YA 4BF1A 3S72B 4Q8XA 5C8IA 4TWLA 4GL1X 3P44A 4KUWA 4Q08A 5FNMA 3S71B 2WD2A 3C7PA 3JXGA 4YXIA 1G48A 1HUGA 4BF6A 3M2XA 5E2SA 4E5QA 3V7XA 1RZEA 3T83A 2Q1BA 2FNMA 4QJ0A 3D8WA 4Z1NA 5FLRA 4CACA 4Q99A 4CQ0A 2F14A 4IWZA 5BNLA 1UGAA 1Z97A 3P3JA 4TWMA 3KKXA 5SZ7A 1XEVA 5JQ0A 3M5TA 9CA2A 2HL4A 4FIKA 1TBTX 1TEUX 4PXXA 6CA2A 5FNKA 4ZWZA 1Z9YA 5EZTX 1HVAA 1I9NA 2GD8A 2WEJA 1KWQA 1BN3A 3N2PA 3P5LA 4XFWA 4BCWA 3MYQA 1HECA 4QIYA 2H4NA 5EH5A 4Z0QA 1LUGA 3T5UA 4MLXA 5EKJA 3P5AA 5E2KA 4DZ9A 4M2RA 1BNNA 5EH7A 4MO8A 3S74B 3CZVA 1BNQA 2NNOA 2NXTA 3MHMA 4MDMA 3S77B 3U7CA 1JD0A 1CVAA 3HKTA 2ZNCA 2FMZA 5FNGA 5FNJA 1CNBA 3MDZA 4MLTA 5DSLA 2Q1QA 1HEAA 5EH8A 4RIVA 5BRUA 1I91A 4N0XB 4XIWA 5G0CA 1CAZA 1ZH9A 4YGNA 2FW4A 3M96A 4QK3A 1CVFA 4PYXA 1YO1A 3BL1A 3RG3A 5FL4A 4KNMA 4CNVA 4HU1A 5G03A 3M2NA 1OKMA 3DD8A 3IEOA 4YHAA 4ZWIA 1THKA 3DVDA 3FW3A 4KV0A 4Q6DA 4WW8A 2OSFA 4HEYA 4E4AA 1G6VA 3HFPA 3MMFA 3BL0A 1CAYA 3M14A 1I9PA 4YGFA 3V3HB 5L3OA 3M5SA 1CVEA 4G0CA 4YYTA 1CNWA 3EFTA 2FOQA 3M67A 3SBHA 3HKNA 3RYXB 2FOVA 1FQMA 3KS3A 3QYKA 1IF9A 3CAJA 1RAYA 2NWOA 2QP6A 4QSIA 3JXHC 4JSZA 3IBNA 3GZ0A 5JQTA 3K2FA 3PJJA 1H4NA 3B4FA 1CINA 2FNKA 3RZ8A 3RYJB 2NWYA 1G46A 3V3JA 3R16A 5FLOA 4E3FA 3MHLA 3N4BA 1UGDA 2W2JA 5CLUA 2X7SA 4Q81A 5CACA 3IBLA 3KNEA 5EHEA 1AZMA 4Q87A 1A42A 1BN1A 1IF4A 1FSNA 2NNSA 1ZGEA 3M2YA 3U45X 1G4JA 5SZ4A 4ZWYA 2NWZA 5EKMA 5SZ0A 4RFDA 1CNJA 1G0EA 5HPJA 3HKQA 4JS6A 2CBEA 4E3GA 1JV0A 3LXEA 4M2VA 4G7AA 7CA2A 3T84A 1I9LA 4QJPA 4FRCA 1CVHA 1RZDA 3NI5A 3S9TA 3KOIA 1LG6A 1I8ZA 2FMGA 4K1QA 4Q09A 3S8XA 4WUQA 4ETQC 3DVBA 1CNKA 4KP5A 3S97A 3W6IA 1G53A 1CNIA 3RZ7A 1BNWA 1CAHA 5A25A 1ZSAA 5DSMA 4XIXA 4QSJA 1FQNA 1G4OA 1G0FA 3IBUA 2CABA 1IF7A 3D0NA 4HT0A 3OIKA 4QJMA 3U3AX 3DCWA 3FE4A 3RGEA 3B1BA 4ZX0A 2CBCA 4Y0JA 5L6KA 4LP6A 1EOUA 4QK1A 2FNNA 2NWPA 1UGCA 3V3IB 4IDRX 3DCCA 1CAIA 3DD0A 3P3HA 5SZ1A 5DSNA 5CJFA 4Q0LA 4RIUA 2FOSA 1FSRA 3RZ1B 1FR4A 1G54A 4Z1EA 2EU2A 3M5EA 3HKUA 5JEGB 1I9MA 4MTYA 1DCBA 5LMDA 3L14A 3NB5A 5DSKA 3IBIA 5SZ2A 3M1JA 4LU3A 5DSPA 4HF3A 1V9EA 4QSAA 5JGSB 4Q7VA 2QOAA 1BCDA 1J9WA 3MNIA 1CILA 4RUZA 1HCBA 1IF8A 1AM6A 3DV7A 4L5VA 5DVXA 4R5BA 4WUPA 4YGKA 4UOVA 5FDCA 5JDVB 5FLPA 1ZFQA 4K0TA 3OILA 4RN4A 2O4ZA 3KONA 1BV3A 1RZBA 4ZWXA 4K0ZA 3VBDA 1I9OA 4N16A 1YO0A 2ILIA 1CANA 3RJ7A 4YXOA 4RH2A 3FFPX 1OKLA 1G45A 5EOIA 1YDDA 1YDAA 5JEHB 4FU5A 2WEGA 5FDIA 1RZAA 1LG5A 3MNUA 3PYKA 4YX4A 1DCAA 3D9ZA 3S75B 4HBAA 4Q6EA 3K7KA 2NXSA 4ITOA 3S73B 3RYYA 4QIZA 1BZMA 4PQ7A 1FLJA 1ZGFA 2H15A 3MHIA 3Q31A 2CBDA 4QEFA 5E28A 3T85A 2POWA 3MNAA 1BN4A 1CIMA 2CBBA 3TVOX 3MHCA 1RAZA 3M98A 4Q78A 1TEQX 2HD6A 2EZ7A 4ILXA 12CAA 1XQ0A 4LHIA 5E2RA 1CCTA 3K34A 4E3DA 3MNKA 2X7UA 2OSMA 3W6HA 4KAPA 1CALA 3T5ZA 3RYVB 3OKUA 4KNNA 4E3HA 3CA2A 4FPTA 1IF5A 4M2WA 1T9NA 5DSQA 4K0SA 5BRWA 2POUA 5JESB 3RLDA 3V5GA 4HEWA 4WW6A 4RUYA 2WEHA 5JGTB 4YVYA 1BNTA 1FR7A 4WR7A 4X5SA 1CNCA 1KEQA 4MDGA 1CAKA 4Z1KA 1RJ6A 1XPZA 2NN7A 3SBIA 2CBAA 2WEOA 5E2MA 5JG3B 3KOKA 3ZNCA 5FNHA 1FQLA 2GEHA 3DCSA 1CAJA 1V9IC 1F2WA 5EHWA 4KUVA 4E9OX 2AW1A 5AMDA 4Z1JA 8CA2A 4YXUA 2NNVA 2HOCA 2AX2A 5FLSA 1CVCA 3F7BA 1KWRA 4QJXA 5G0BA 4L5WA 4KUYA 1FSQA 5DSIA 3EFIA 4HT2A 1CAOA 1H9NA 1KOPA 5JG5B 3M1KA 1OKNA 3N3JA 2CA2A 5J8ZA 3OKVA 2FOYA 4Q8YA 5DOHA 2NN1A 3KLDB 5FNLA 5E5UA 5G01A 2POVA 3IGPA 5AMLA 1HEBA 3MZCA 1URTA 4R5AA 3S76A 4Q8ZA 3UYNA 1DMXA 3D93A 4Q06A 1CRMA 1ZSCA 1CNHA 5SZ6A 5A6HA 2Q38A 1YDCA 1UGEA 3V3FA 3DC3A 4PZHA 4Q7PA 2HFWA 2VVAX 4ZX1A 1IF6A 3DAZA 4CNXA 1CA3A 3F7UA 3HLJA 3MNHA 5EIJA 3UYQA 1BNVA 2HKKA 3N0NA 1ZE8A 5DSOA 1UGGA 2EU3A 3MWOA 3F8EA 4HEZA 4QK2A 5FL6A 1CNXA 5CA2A 1CAMA 3OY0A 4CNWA 1CNYA 4KNIA 3OIMA 4WL4A 4XE1A 4Q7WA 5DRSA 3RZ0B 2FOUA 4RUXA 4COQA 2NNGA 5E2NA 4JSAA 3IAIA 3OYQA 1CNGA 1AVNA 4QSBA 4RFCA 2HNCA 1HEDA 4KNJA 1FQRA 1CRAA 5DSRA 1TG9A 4CA2A 3S78B 3V2JA 5JEPB 5BRVA 3SAXA 1LGDA 4FVOA 1YO2A 1G3ZA 5DSJA 1MOOA 1ZSBA 4QY3A 1CVBA 5FNIA 1Y7WA 1CCUA 1UGFA 3P55A 3T82A 1LZVA 3TMJA 3ZP9A 5EHVA 2X7TA 2VVBX 3V2MA 1TTMA 1RJ5A 3F4XA
chains in the Genus database with same CATH topology
1TG3A 2IT4A 1TH9A 3M2ZA 3ML5A 1DMYA 3CYUA 3P4VA 1UGBA 5SZ5A 3MNJA 3PO6A 1ZFKA 4YGJA 3M04A 3D92A 1I90A 4K13A 4YGLA 1KOQA 2QO8A 3KIGA 4JSSA 1RZCA 4JSWA 3KWAA 4Q49A 4Q83A 4CNRA 1HCAA 4Q07A 4QTLA 1MUAA 3R17B 1XEGA 3MHOA 4ITPA 3HS4A 3RYZA 4QJWA 1BNUA 3P58A 1BNMA 5E5RA 1TB0X 1BICA 4XZ5A 3U47A 1H9QA 5DOGA 4YWPA 3NJ9A 4M2UA 1ZNCA 3JXFA 3M40A 4FVNA 4E49A 4ZAOA 4FL7A 4L5UA 3DBUA 3RG4A 4MDLA 1YDBA 1G52A 3BETA 1CA2A 1CVDA 1I9QA 5AMGA 3DC9A 3RZ5A 5IPZA 3OYSA 1TE3X 3TVNX 1OQ5A 5EKHA 4Q90A 2NMXA 1G1DA 3DVCA 5SZ3A 4DZ7A 1HUHA 5FL5A 4R59A 3M1WA 5FLTA 5FLQA 1CCSA 3SAPA 1CZMA 4QJOA 3M1QA 3DA2A 3V3GB 1JCZA 3ML2A 2WD3A 2ABEA 4C3TA 1Z93A 4KP8A 4PYYA 3M3XA 5BYIA 2NXRA 4Q7SA 4Q9YA 4BF1A 3S72B 4Q8XA 5C8IA 4TWLA 4GL1X 3P44A 4KUWA 4Q08A 5FNMA 3S71B 2WD2A 3C7PA 3JXGA 4YXIA 1G48A 1HUGA 4BF6A 3M2XA 5E2SA 4E5QA 3V7XA 1RZEA 3T83A 2Q1BA 2FNMA 4QJ0A 3D8WA 4Z1NA 5FLRA 4CACA 4Q99A 4CQ0A 2F14A 4IWZA 5BNLA 1UGAA 1Z97A 3P3JA 4TWMA 3KKXA 5SZ7A 1XEVA 5JQ0A 3M5TA 9CA2A 2HL4A 4FIKA 1TBTX 1TEUX 4PXXA 6CA2A 5FNKA 4ZWZA 1Z9YA 5EZTX 1HVAA 1I9NA 2GD8A 2WEJA 1KWQA 1BN3A 3N2PA 3P5LA 4XFWA 4BCWA 3MYQA 1HECA 4QIYA 2H4NA 5EH5A 4Z0QA 1LUGA 3T5UA 4MLXA 5EKJA 3P5AA 5E2KA 4DZ9A 4M2RA 1BNNA 5EH7A 4MO8A 3S74B 3CZVA 1BNQA 2NNOA 2NXTA 3MHMA 4MDMA 3S77B 3U7CA 1JD0A 1CVAA 3HKTA 2ZNCA 2FMZA 5FNGA 5FNJA 1CNBA 3MDZA 4MLTA 5DSLA 2Q1QA 1HEAA 5EH8A 4RIVA 5BRUA 1I91A 4N0XB 4XIWA 5G0CA 1CAZA 1ZH9A 4YGNA 2FW4A 3M96A 4QK3A 1CVFA 4PYXA 1YO1A 3BL1A 3RG3A 5FL4A 4KNMA 4CNVA 4HU1A 5G03A 3M2NA 1OKMA 3DD8A 3IEOA 4YHAA 4ZWIA 1THKA 3DVDA 3FW3A 4KV0A 4Q6DA 4WW8A 2OSFA 4HEYA 4E4AA 1G6VA 3HFPA 3MMFA 3BL0A 1CAYA 3M14A 1I9PA 4YGFA 3V3HB 5L3OA 3M5SA 1CVEA 4G0CA 4YYTA 1CNWA 3EFTA 2FOQA 3M67A 3SBHA 3HKNA 3RYXB 2FOVA 1FQMA 3KS3A 3QYKA 1IF9A 3CAJA 1RAYA 2NWOA 2QP6A 4QSIA 3JXHC 4JSZA 3IBNA 3GZ0A 5JQTA 3K2FA 3PJJA 1H4NA 3B4FA 1CINA 2FNKA 3RZ8A 3RYJB 2NWYA 1G46A 3V3JA 3R16A 5FLOA 4E3FA 3MHLA 3N4BA 1UGDA 2W2JA 5CLUA 2X7SA 4Q81A 5CACA 3IBLA 3KNEA 5EHEA 1AZMA 4Q87A 1A42A 1BN1A 1IF4A 1FSNA 2NNSA 1ZGEA 3M2YA 3U45X 1G4JA 5SZ4A 4ZWYA 2NWZA 5EKMA 5SZ0A 4RFDA 1CNJA 1G0EA 5HPJA 3HKQA 4JS6A 2CBEA 4E3GA 1JV0A 3LXEA 4M2VA 4G7AA 7CA2A 3T84A 1I9LA 4QJPA 4FRCA 1CVHA 1RZDA 3NI5A 3S9TA 3KOIA 1LG6A 1I8ZA 2FMGA 4K1QA 4Q09A 3S8XA 4WUQA 4ETQC 3DVBA 1CNKA 4KP5A 3S97A 3W6IA 1G53A 1CNIA 3RZ7A 1BNWA 1CAHA 5A25A 1ZSAA 5DSMA 4XIXA 4QSJA 1FQNA 1G4OA 1G0FA 3IBUA 2CABA 1IF7A 3D0NA 4HT0A 3OIKA 4QJMA 3U3AX 3DCWA 3FE4A 3RGEA 3B1BA 4ZX0A 2CBCA 4Y0JA 5L6KA 4LP6A 1EOUA 4QK1A 2FNNA 2NWPA 1UGCA 3V3IB 4IDRX 3DCCA 1CAIA 3DD0A 3P3HA 5SZ1A 5DSNA 5CJFA 4Q0LA 4RIUA 2FOSA 1FSRA 3RZ1B 1FR4A 1G54A 4Z1EA 2EU2A 3M5EA 3HKUA 5JEGB 1I9MA 4MTYA 1DCBA 5LMDA 3L14A 3NB5A 5DSKA 3IBIA 5SZ2A 3M1JA 4LU3A 5DSPA 4HF3A 1V9EA 4QSAA 5JGSB 4Q7VA 2QOAA 1BCDA 1J9WA 3MNIA 1CILA 4RUZA 1HCBA 1IF8A 1AM6A 3DV7A 4L5VA 5DVXA 4R5BA 4WUPA 4YGKA 4UOVA 5FDCA 5JDVB 5FLPA 1ZFQA 4K0TA 3OILA 4RN4A 2O4ZA 3KONA 1BV3A 1RZBA 4ZWXA 4K0ZA 3VBDA 1I9OA 4N16A 1YO0A 2ILIA 1CANA 3RJ7A 4YXOA 4RH2A 3FFPX 1OKLA 1G45A 5EOIA 1YDDA 1YDAA 5JEHB 4FU5A 2WEGA 5FDIA 1RZAA 1LG5A 3MNUA 3PYKA 4YX4A 1DCAA 3D9ZA 3S75B 4HBAA 4Q6EA 3K7KA 2NXSA 4ITOA 3S73B 3RYYA 4QIZA 1BZMA 4PQ7A 1FLJA 1ZGFA 2H15A 3MHIA 3Q31A 2CBDA 4QEFA 5E28A 3T85A 2POWA 3MNAA 1BN4A 1CIMA 2CBBA 3TVOX 3MHCA 1RAZA 3M98A 4Q78A 1TEQX 2HD6A 2EZ7A 4ILXA 12CAA 1XQ0A 4LHIA 5E2RA 1CCTA 3K34A 4E3DA 3MNKA 2X7UA 2OSMA 3W6HA 4KAPA 1CALA 3T5ZA 3RYVB 3OKUA 4KNNA 4E3HA 3CA2A 4FPTA 1IF5A 4M2WA 1T9NA 5DSQA 4K0SA 5BRWA 2POUA 5JESB 3RLDA 3V5GA 4HEWA 4WW6A 4RUYA 2WEHA 5JGTB 4YVYA 1BNTA 1FR7A 4WR7A 4X5SA 1CNCA 1KEQA 4MDGA 1CAKA 4Z1KA 1RJ6A 1XPZA 2NN7A 3SBIA 2CBAA 2WEOA 5E2MA 5JG3B 3KOKA 3ZNCA 5FNHA 1FQLA 2GEHA 3DCSA 1CAJA 1V9IC 1F2WA 5EHWA 4KUVA 4E9OX 2AW1A 5AMDA 4Z1JA 8CA2A 4YXUA 2NNVA 2HOCA 2AX2A 5FLSA 1CVCA 3F7BA 1KWRA 4QJXA 5G0BA 4L5WA 4KUYA 1FSQA 5DSIA 3EFIA 4HT2A 1CAOA 1H9NA 1KOPA 5JG5B 3M1KA 1OKNA 3N3JA 2CA2A 5J8ZA 3OKVA 2FOYA 4Q8YA 5DOHA 2NN1A 3KLDB 5FNLA 5E5UA 5G01A 2POVA 3IGPA 5AMLA 1HEBA 3MZCA 1URTA 4R5AA 3S76A 4Q8ZA 3UYNA 1DMXA 3D93A 4Q06A 1CRMA 1ZSCA 1CNHA 5SZ6A 5A6HA 2Q38A 1YDCA 1UGEA 3V3FA 3DC3A 4PZHA 4Q7PA 2HFWA 2VVAX 4ZX1A 1IF6A 3DAZA 4CNXA 1CA3A 3F7UA 3HLJA 3MNHA 5EIJA 3UYQA 1BNVA 2HKKA 3N0NA 1ZE8A 5DSOA 1UGGA 2EU3A 3MWOA 3F8EA 4HEZA 4QK2A 5FL6A 1CNXA 5CA2A 1CAMA 3OY0A 4CNWA 1CNYA 4KNIA 3OIMA 4WL4A 4XE1A 4Q7WA 5DRSA 3RZ0B 2FOUA 4RUXA 4COQA 2NNGA 5E2NA 4JSAA 3IAIA 3OYQA 1CNGA 1AVNA 4QSBA 4RFCA 2HNCA 1HEDA 4KNJA 1FQRA 1CRAA 5DSRA 1TG9A 4CA2A 3S78B 3V2JA 5JEPB 5BRVA 3SAXA 1LGDA 4FVOA 1YO2A 1G3ZA 5DSJA 1MOOA 1ZSBA 4QY3A 1CVBA 5FNIA 1Y7WA 1CCUA 1UGFA 3P55A 3T82A 1LZVA 3TMJA 3ZP9A 5EHVA 2X7TA 2VVBX 3V2MA 1TTMA 1RJ5A 3F4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TG3 A;  2IT4 A;  1TH9 A;  3M2Z A;  3ML5 A;  1DMY A;  3CYU A;  3P4V A;  1UGB A;  5SZ5 A;  3MNJ A;  3PO6 A;  1ZFK A;  4YGJ A;  3M04 A;  3D92 A;  1I90 A;  4K13 A;  4YGL A;  1KOQ A;  2QO8 A;  3KIG A;  4JSS A;  1RZC A;  4JSW A;  3KWA A;  4Q49 A;  4Q83 A;  4CNR A;  1HCA A;  4Q07 A;  4QTL A;  1MUA A;  3R17 B;  1XEG A;  3MHO A;  4ITP A;  3HS4 A;  3RYZ A;  4QJW A;  1BNU A;  3P58 A;  1BNM A;  5E5R A;  1TB0 X;  1BIC A;  4XZ5 A;  3U47 A;  1H9Q A;  5DOG A;  4YWP A;  3NJ9 A;  4M2U A;  1ZNC A;  3JXF A;  3M40 A;  4FVN A;  4E49 A;  4ZAO A;  4FL7 A;  4L5U A;  3DBU A;  3RG4 A;  4MDL A;  1YDB A;  1G52 A;  3BET A;  1CA2 A;  1CVD A;  1I9Q A;  5AMG A;  3DC9 A;  3RZ5 A;  5IPZ A;  3OYS A;  1TE3 X;  3TVN X;  1OQ5 A;  5EKH A;  4Q90 A;  2NMX A;  1G1D A;  3DVC A;  5SZ3 A;  4DZ7 A;  1HUH A;  5FL5 A;  4R59 A;  3M1W A;  5FLT A;  5FLQ A;  1CCS A;  3SAP A;  1CZM A;  4QJO A;  3M1Q A;  3DA2 A;  3V3G B;  1JCZ A;  3ML2 A;  2WD3 A;  2ABE A;  4C3T A;  1Z93 A;  4KP8 A;  4PYY A;  3M3X A;  5BYI A;  2NXR A;  4Q7S A;  4Q9Y A;  4BF1 A;  3S72 B;  4Q8X A;  5C8I A;  4TWL A;  4GL1 X;  3P44 A;  4KUW A;  4Q08 A;  5FNM A;  3S71 B;  2WD2 A;  3C7P A;  3JXG A;  4YXI A;  1G48 A;  1HUG A;  4BF6 A;  3M2X A;  5E2S A;  4E5Q A;  3V7X A;  1RZE A;  3T83 A;  2Q1B A;  2FNM A;  4QJ0 A;  3D8W A;  4Z1N A;  5FLR A;  4CAC A;  4Q99 A;  4CQ0 A;  2F14 A;  4IWZ A;  5BNL A;  1UGA A;  1Z97 A;  3P3J A;  4TWM A;  3KKX A;  5SZ7 A;  1XEV A;  5JQ0 A;  3M5T A;  9CA2 A;  2HL4 A;  4FIK A;  1TBT X;  1TEU X;  4PXX A;  6CA2 A;  5FNK A;  4ZWZ A;  1Z9Y A;  5EZT X;  1HVA A;  1I9N A;  2GD8 A;  2WEJ A;  1KWQ A;  1BN3 A;  3N2P A;  3P5L A;  4XFW A;  4BCW A;  3MYQ A;  1HEC A;  4QIY A;  2H4N A;  5EH5 A;  4Z0Q A;  1LUG A;  3T5U A;  4MLX A;  5EKJ A;  3P5A A;  5E2K A;  4DZ9 A;  4M2R A;  1BNN A;  5EH7 A;  4MO8 A;  3S74 B;  3CZV A;  1BNQ A;  2NNO A;  2NXT A;  3MHM A;  4MDM A;  3S77 B;  3U7C A;  1JD0 A;  1CVA A;  3HKT A;  2ZNC A;  2FMZ A;  5FNG A;  5FNJ A;  1CNB A;  3MDZ A;  4MLT A;  5DSL A;  2Q1Q A;  1HEA A;  5EH8 A;  4RIV A;  5BRU A;  1I91 A;  4N0X B;  4XIW A;  5G0C A;  1CAZ A;  1ZH9 A;  4YGN A;  2FW4 A;  3M96 A;  4QK3 A;  1CVF A;  4PYX A;  1YO1 A;  3BL1 A;  3RG3 A;  5FL4 A;  4KNM A;  4CNV A;  4HU1 A;  5G03 A;  3M2N A;  1OKM A;  3DD8 A;  3IEO A;  4YHA A;  4ZWI A;  1THK A;  3DVD A;  3FW3 A;  4KV0 A;  4Q6D A;  4WW8 A;  2OSF A;  4HEY A;  4E4A A;  1G6V A;  3HFP A;  3MMF A;  3BL0 A;  1CAY A;  3M14 A;  1I9P A;  4YGF A;  3V3H B;  5L3O A;  3M5S A;  1CVE A;  4G0C A;  4YYT A;  1CNW A;  3EFT A;  2FOQ A;  3M67 A;  3SBH A;  3HKN A;  3RYX B;  2FOV A;  1FQM A;  3KS3 A;  3QYK A;  1IF9 A;  3CAJ A;  1RAY A;  2NWO A;  2QP6 A;  4QSI A;  3JXH C;  4JSZ A;  3IBN A;  3GZ0 A;  5JQT A;  3K2F A;  3PJJ A;  1H4N A;  3B4F A;  1CIN A;  2FNK A;  3RZ8 A;  3RYJ B;  2NWY A;  1G46 A;  3V3J A;  3R16 A;  5FLO A;  4E3F A;  3MHL A;  3N4B A;  1UGD A;  2W2J A;  5CLU A;  2X7S A;  4Q81 A;  5CAC A;  3IBL A;  3KNE A;  5EHE A;  1AZM A;  4Q87 A;  1A42 A;  1BN1 A;  1IF4 A;  1FSN A;  2NNS A;  1ZGE A;  3M2Y A;  3U45 X;  1G4J A;  5SZ4 A;  4ZWY A;  2NWZ A;  5EKM A;  5SZ0 A;  4RFD A;  1CNJ A;  1G0E A;  5HPJ A;  3HKQ A;  4JS6 A;  2CBE A;  4E3G A;  1JV0 A;  3LXE A;  4M2V A;  4G7A A;  7CA2 A;  3T84 A;  1I9L A;  4QJP A;  4FRC A;  1CVH A;  1RZD A;  3NI5 A;  3S9T A;  3KOI A;  1LG6 A;  1I8Z A;  2FMG A;  4K1Q A;  4Q09 A;  3S8X A;  4WUQ A;  4ETQ C;  3DVB A;  1CNK A;  4KP5 A;  3S97 A;  3W6I A;  1G53 A;  1CNI A;  3RZ7 A;  1BNW A;  1CAH A;  5A25 A;  1ZSA A;  5DSM A;  4XIX A;  4QSJ A;  1FQN A;  1G4O A;  1G0F A;  3IBU A;  2CAB A;  1IF7 A;  3D0N A;  4HT0 A;  3OIK A;  4QJM A;  3U3A X;  3DCW A;  3FE4 A;  3RGE A;  3B1B A;  4ZX0 A;  2CBC A;  4Y0J A;  5L6K A;  4LP6 A;  1EOU A;  4QK1 A;  2FNN A;  2NWP A;  1UGC A;  3V3I B;  4IDR X;  3DCC A;  1CAI A;  3DD0 A;  3P3H A;  5SZ1 A;  5DSN A;  5CJF A;  4Q0L A;  4RIU A;  2FOS A;  1FSR A;  3RZ1 B;  1FR4 A;  1G54 A;  4Z1E A;  2EU2 A;  3M5E A;  3HKU A;  5JEG B;  1I9M A;  4MTY A;  1DCB A;  5LMD A;  3L14 A;  3NB5 A;  5DSK A;  3IBI A;  5SZ2 A;  3M1J A;  4LU3 A;  5DSP A;  4HF3 A;  1V9E A;  4QSA A;  5JGS B;  4Q7V A;  2QOA A;  1BCD A;  1J9W A;  3MNI A;  1CIL A;  4RUZ A;  1HCB A;  1IF8 A;  1AM6 A;  3DV7 A;  4L5V A;  5DVX A;  4R5B A;  4WUP A;  4YGK A;  4UOV A;  5FDC A;  5JDV B;  5FLP A;  1ZFQ A;  4K0T A;  3OIL A;  4RN4 A;  2O4Z A;  3KON A;  1BV3 A;  1RZB A;  4ZWX A;  4K0Z A;  3VBD A;  1I9O A;  4N16 A;  1YO0 A;  2ILI A;  1CAN A;  3RJ7 A;  4YXO A;  4RH2 A;  3FFP X;  1OKL A;  1G45 A;  5EOI A;  1YDD A;  1YDA A;  5JEH B;  4FU5 A;  2WEG A;  5FDI A;  1RZA A;  1LG5 A;  3MNU A;  3PYK A;  4YX4 A;  1DCA A;  3D9Z A;  3S75 B;  4HBA A;  4Q6E A;  3K7K A;  2NXS A;  4ITO A;  3S73 B;  3RYY A;  4QIZ A;  1BZM A;  4PQ7 A;  1FLJ A;  1ZGF A;  2H15 A;  3MHI A;  3Q31 A;  2CBD A;  4QEF A;  5E28 A;  3T85 A;  2POW A;  3MNA A;  1BN4 A;  1CIM A;  2CBB A;  3TVO X;  3MHC A;  1RAZ A;  3M98 A;  4Q78 A;  1TEQ X;  2HD6 A;  2EZ7 A;  4ILX A;  12CA A;  1XQ0 A;  4LHI A;  5E2R A;  1CCT A;  3K34 A;  4E3D A;  3MNK A;  2X7U A;  2OSM A;  3W6H A;  4KAP A;  1CAL A;  3T5Z A;  3RYV B;  3OKU A;  4KNN A;  4E3H A;  3CA2 A;  4FPT A;  1IF5 A;  4M2W A;  1T9N A;  5DSQ A;  4K0S A;  5BRW A;  2POU A;  5JES B;  3RLD A;  3V5G A;  4HEW A;  4WW6 A;  4RUY A;  2WEH A;  5JGT B;  4YVY A;  1BNT A;  1FR7 A;  4WR7 A;  4X5S A;  1CNC A;  1KEQ A;  4MDG A;  1CAK A;  4Z1K A;  1RJ6 A;  1XPZ A;  2NN7 A;  3SBI A;  2CBA A;  2WEO A;  5E2M A;  5JG3 B;  3KOK A;  3ZNC A;  5FNH A;  1FQL A;  2GEH A;  3DCS A;  1CAJ A;  1V9I C;  1F2W A;  5EHW A;  4KUV A;  4E9O X;  2AW1 A;  5AMD A;  4Z1J A;  8CA2 A;  4YXU A;  2NNV A;  2HOC A;  2AX2 A;  5FLS A;  1CVC A;  3F7B A;  1KWR A;  4QJX A;  5G0B A;  4L5W A;  4KUY A;  1FSQ A;  5DSI A;  3EFI A;  4HT2 A;  1CAO A;  1H9N A;  1KOP A;  5JG5 B;  3M1K A;  1OKN A;  3N3J A;  2CA2 A;  5J8Z A;  3OKV A;  2FOY A;  4Q8Y A;  5DOH A;  2NN1 A;  3KLD B;  5FNL A;  5E5U A;  5G01 A;  2POV A;  3IGP A;  5AML A;  1HEB A;  3MZC A;  1URT A;  4R5A A;  3S76 A;  4Q8Z A;  3UYN A;  1DMX A;  3D93 A;  4Q06 A;  1CRM A;  1ZSC A;  1CNH A;  5SZ6 A;  5A6H A;  2Q38 A;  1YDC A;  1UGE A;  3V3F A;  3DC3 A;  4PZH A;  4Q7P A;  2HFW A;  2VVA X;  4ZX1 A;  1IF6 A;  3DAZ A;  4CNX A;  1CA3 A;  3F7U A;  3HLJ A;  3MNH A;  5EIJ A;  3UYQ A;  1BNV A;  2HKK A;  3N0N A;  1ZE8 A;  5DSO A;  1UGG A;  2EU3 A;  3MWO A;  3F8E A;  4HEZ A;  4QK2 A;  5FL6 A;  1CNX A;  5CA2 A;  1CAM A;  3OY0 A;  4CNW A;  1CNY A;  4KNI A;  3OIM A;  4WL4 A;  4XE1 A;  4Q7W A;  5DRS A;  3RZ0 B;  2FOU A;  4RUX A;  4COQ A;  2NNG A;  5E2N A;  4JSA A;  3IAI A;  3OYQ A;  1CNG A;  1AVN A;  4QSB A;  4RFC A;  2HNC A;  1HED A;  4KNJ A;  1FQR A;  1CRA A;  5DSR A;  1TG9 A;  4CA2 A;  3S78 B;  3V2J A;  5JEP B;  5BRV A;  3SAX A;  1LGD A;  4FVO A;  1YO2 A;  1G3Z A;  5DSJ A;  1MOO A;  1ZSB A;  4QY3 A;  1CVB A;  5FNI A;  1Y7W A;  1CCU A;  1UGF A;  3P55 A;  3T82 A;  1LZV A;  3TMJ A;  3ZP9 A;  5EHV A;  2X7T A;  2VVB X;  3V2M A;  1TTM A;  1RJ5 A;  3F4X A; 
#chains in the Genus database with same CATH topology
 1TG3 A;  2IT4 A;  1TH9 A;  3M2Z A;  3ML5 A;  1DMY A;  3CYU A;  3P4V A;  1UGB A;  5SZ5 A;  3MNJ A;  3PO6 A;  1ZFK A;  4YGJ A;  3M04 A;  3D92 A;  1I90 A;  4K13 A;  4YGL A;  1KOQ A;  2QO8 A;  3KIG A;  4JSS A;  1RZC A;  4JSW A;  3KWA A;  4Q49 A;  4Q83 A;  4CNR A;  1HCA A;  4Q07 A;  4QTL A;  1MUA A;  3R17 B;  1XEG A;  3MHO A;  4ITP A;  3HS4 A;  3RYZ A;  4QJW A;  1BNU A;  3P58 A;  1BNM A;  5E5R A;  1TB0 X;  1BIC A;  4XZ5 A;  3U47 A;  1H9Q A;  5DOG A;  4YWP A;  3NJ9 A;  4M2U A;  1ZNC A;  3JXF A;  3M40 A;  4FVN A;  4E49 A;  4ZAO A;  4FL7 A;  4L5U A;  3DBU A;  3RG4 A;  4MDL A;  1YDB A;  1G52 A;  3BET A;  1CA2 A;  1CVD A;  1I9Q A;  5AMG A;  3DC9 A;  3RZ5 A;  5IPZ A;  3OYS A;  1TE3 X;  3TVN X;  1OQ5 A;  5EKH A;  4Q90 A;  2NMX A;  1G1D A;  3DVC A;  5SZ3 A;  4DZ7 A;  1HUH A;  5FL5 A;  4R59 A;  3M1W A;  5FLT A;  5FLQ A;  1CCS A;  3SAP A;  1CZM A;  4QJO A;  3M1Q A;  3DA2 A;  3V3G B;  1JCZ A;  3ML2 A;  2WD3 A;  2ABE A;  4C3T A;  1Z93 A;  4KP8 A;  4PYY A;  3M3X A;  5BYI A;  2NXR A;  4Q7S A;  4Q9Y A;  4BF1 A;  3S72 B;  4Q8X A;  5C8I A;  4TWL A;  4GL1 X;  3P44 A;  4KUW A;  4Q08 A;  5FNM A;  3S71 B;  2WD2 A;  3C7P A;  3JXG A;  4YXI A;  1G48 A;  1HUG A;  4BF6 A;  3M2X A;  5E2S A;  4E5Q A;  3V7X A;  1RZE A;  3T83 A;  2Q1B A;  2FNM A;  4QJ0 A;  3D8W A;  4Z1N A;  5FLR A;  4CAC A;  4Q99 A;  4CQ0 A;  2F14 A;  4IWZ A;  5BNL A;  1UGA A;  1Z97 A;  3P3J A;  4TWM A;  3KKX A;  5SZ7 A;  1XEV A;  5JQ0 A;  3M5T A;  9CA2 A;  2HL4 A;  4FIK A;  1TBT X;  1TEU X;  4PXX A;  6CA2 A;  5FNK A;  4ZWZ A;  1Z9Y A;  5EZT X;  1HVA A;  1I9N A;  2GD8 A;  2WEJ A;  1KWQ A;  1BN3 A;  3N2P A;  3P5L A;  4XFW A;  4BCW A;  3MYQ A;  1HEC A;  4QIY A;  2H4N A;  5EH5 A;  4Z0Q A;  1LUG A;  3T5U A;  4MLX A;  5EKJ A;  3P5A A;  5E2K A;  4DZ9 A;  4M2R A;  1BNN A;  5EH7 A;  4MO8 A;  3S74 B;  3CZV A;  1BNQ A;  2NNO A;  2NXT A;  3MHM A;  4MDM A;  3S77 B;  3U7C A;  1JD0 A;  1CVA A;  3HKT A;  2ZNC A;  2FMZ A;  5FNG A;  5FNJ A;  1CNB A;  3MDZ A;  4MLT A;  5DSL A;  2Q1Q A;  1HEA A;  5EH8 A;  4RIV A;  5BRU A;  1I91 A;  4N0X B;  4XIW A;  5G0C A;  1CAZ A;  1ZH9 A;  4YGN A;  2FW4 A;  3M96 A;  4QK3 A;  1CVF A;  4PYX A;  1YO1 A;  3BL1 A;  3RG3 A;  5FL4 A;  4KNM A;  4CNV A;  4HU1 A;  5G03 A;  3M2N A;  1OKM A;  3DD8 A;  3IEO A;  4YHA A;  4ZWI A;  1THK A;  3DVD A;  3FW3 A;  4KV0 A;  4Q6D A;  4WW8 A;  2OSF A;  4HEY A;  4E4A A;  1G6V A;  3HFP A;  3MMF A;  3BL0 A;  1CAY A;  3M14 A;  1I9P A;  4YGF A;  3V3H B;  5L3O A;  3M5S A;  1CVE A;  4G0C A;  4YYT A;  1CNW A;  3EFT A;  2FOQ A;  3M67 A;  3SBH A;  3HKN A;  3RYX B;  2FOV A;  1FQM A;  3KS3 A;  3QYK A;  1IF9 A;  3CAJ A;  1RAY A;  2NWO A;  2QP6 A;  4QSI A;  3JXH C;  4JSZ A;  3IBN A;  3GZ0 A;  5JQT A;  3K2F A;  3PJJ A;  1H4N A;  3B4F A;  1CIN A;  2FNK A;  3RZ8 A;  3RYJ B;  2NWY A;  1G46 A;  3V3J A;  3R16 A;  5FLO A;  4E3F A;  3MHL A;  3N4B A;  1UGD A;  2W2J A;  5CLU A;  2X7S A;  4Q81 A;  5CAC A;  3IBL A;  3KNE A;  5EHE A;  1AZM A;  4Q87 A;  1A42 A;  1BN1 A;  1IF4 A;  1FSN A;  2NNS A;  1ZGE A;  3M2Y A;  3U45 X;  1G4J A;  5SZ4 A;  4ZWY A;  2NWZ A;  5EKM A;  5SZ0 A;  4RFD A;  1CNJ A;  1G0E A;  5HPJ A;  3HKQ A;  4JS6 A;  2CBE A;  4E3G A;  1JV0 A;  3LXE A;  4M2V A;  4G7A A;  7CA2 A;  3T84 A;  1I9L A;  4QJP A;  4FRC A;  1CVH A;  1RZD A;  3NI5 A;  3S9T A;  3KOI A;  1LG6 A;  1I8Z A;  2FMG A;  4K1Q A;  4Q09 A;  3S8X A;  4WUQ A;  4ETQ C;  3DVB A;  1CNK A;  4KP5 A;  3S97 A;  3W6I A;  1G53 A;  1CNI A;  3RZ7 A;  1BNW A;  1CAH A;  5A25 A;  1ZSA A;  5DSM A;  4XIX A;  4QSJ A;  1FQN A;  1G4O A;  1G0F A;  3IBU A;  2CAB A;  1IF7 A;  3D0N A;  4HT0 A;  3OIK A;  4QJM A;  3U3A X;  3DCW A;  3FE4 A;  3RGE A;  3B1B A;  4ZX0 A;  2CBC A;  4Y0J A;  5L6K A;  4LP6 A;  1EOU A;  4QK1 A;  2FNN A;  2NWP A;  1UGC A;  3V3I B;  4IDR X;  3DCC A;  1CAI A;  3DD0 A;  3P3H A;  5SZ1 A;  5DSN A;  5CJF A;  4Q0L A;  4RIU A;  2FOS A;  1FSR A;  3RZ1 B;  1FR4 A;  1G54 A;  4Z1E A;  2EU2 A;  3M5E A;  3HKU A;  5JEG B;  1I9M A;  4MTY A;  1DCB A;  5LMD A;  3L14 A;  3NB5 A;  5DSK A;  3IBI A;  5SZ2 A;  3M1J A;  4LU3 A;  5DSP A;  4HF3 A;  1V9E A;  4QSA A;  5JGS B;  4Q7V A;  2QOA A;  1BCD A;  1J9W A;  3MNI A;  1CIL A;  4RUZ A;  1HCB A;  1IF8 A;  1AM6 A;  3DV7 A;  4L5V A;  5DVX A;  4R5B A;  4WUP A;  4YGK A;  4UOV A;  5FDC A;  5JDV B;  5FLP A;  1ZFQ A;  4K0T A;  3OIL A;  4RN4 A;  2O4Z A;  3KON A;  1BV3 A;  1RZB A;  4ZWX A;  4K0Z A;  3VBD A;  1I9O A;  4N16 A;  1YO0 A;  2ILI A;  1CAN A;  3RJ7 A;  4YXO A;  4RH2 A;  3FFP X;  1OKL A;  1G45 A;  5EOI A;  1YDD A;  1YDA A;  5JEH B;  4FU5 A;  2WEG A;  5FDI A;  1RZA A;  1LG5 A;  3MNU A;  3PYK A;  4YX4 A;  1DCA A;  3D9Z A;  3S75 B;  4HBA A;  4Q6E A;  3K7K A;  2NXS A;  4ITO A;  3S73 B;  3RYY A;  4QIZ A;  1BZM A;  4PQ7 A;  1FLJ A;  1ZGF A;  2H15 A;  3MHI A;  3Q31 A;  2CBD A;  4QEF A;  5E28 A;  3T85 A;  2POW A;  3MNA A;  1BN4 A;  1CIM A;  2CBB A;  3TVO X;  3MHC A;  1RAZ A;  3M98 A;  4Q78 A;  1TEQ X;  2HD6 A;  2EZ7 A;  4ILX A;  12CA A;  1XQ0 A;  4LHI A;  5E2R A;  1CCT A;  3K34 A;  4E3D A;  3MNK A;  2X7U A;  2OSM A;  3W6H A;  4KAP A;  1CAL A;  3T5Z A;  3RYV B;  3OKU A;  4KNN A;  4E3H A;  3CA2 A;  4FPT A;  1IF5 A;  4M2W A;  1T9N A;  5DSQ A;  4K0S A;  5BRW A;  2POU A;  5JES B;  3RLD A;  3V5G A;  4HEW A;  4WW6 A;  4RUY A;  2WEH A;  5JGT B;  4YVY A;  1BNT A;  1FR7 A;  4WR7 A;  4X5S A;  1CNC A;  1KEQ A;  4MDG A;  1CAK A;  4Z1K A;  1RJ6 A;  1XPZ A;  2NN7 A;  3SBI A;  2CBA A;  2WEO A;  5E2M A;  5JG3 B;  3KOK A;  3ZNC A;  5FNH A;  1FQL A;  2GEH A;  3DCS A;  1CAJ A;  1V9I C;  1F2W A;  5EHW A;  4KUV A;  4E9O X;  2AW1 A;  5AMD A;  4Z1J A;  8CA2 A;  4YXU A;  2NNV A;  2HOC A;  2AX2 A;  5FLS A;  1CVC A;  3F7B A;  1KWR A;  4QJX A;  5G0B A;  4L5W A;  4KUY A;  1FSQ A;  5DSI A;  3EFI A;  4HT2 A;  1CAO A;  1H9N A;  1KOP A;  5JG5 B;  3M1K A;  1OKN A;  3N3J A;  2CA2 A;  5J8Z A;  3OKV A;  2FOY A;  4Q8Y A;  5DOH A;  2NN1 A;  3KLD B;  5FNL A;  5E5U A;  5G01 A;  2POV A;  3IGP A;  5AML A;  1HEB A;  3MZC A;  1URT A;  4R5A A;  3S76 A;  4Q8Z A;  3UYN A;  1DMX A;  3D93 A;  4Q06 A;  1CRM A;  1ZSC A;  1CNH A;  5SZ6 A;  5A6H A;  2Q38 A;  1YDC A;  1UGE A;  3V3F A;  3DC3 A;  4PZH A;  4Q7P A;  2HFW A;  2VVA X;  4ZX1 A;  1IF6 A;  3DAZ A;  4CNX A;  1CA3 A;  3F7U A;  3HLJ A;  3MNH A;  5EIJ A;  3UYQ A;  1BNV A;  2HKK A;  3N0N A;  1ZE8 A;  5DSO A;  1UGG A;  2EU3 A;  3MWO A;  3F8E A;  4HEZ A;  4QK2 A;  5FL6 A;  1CNX A;  5CA2 A;  1CAM A;  3OY0 A;  4CNW A;  1CNY A;  4KNI A;  3OIM A;  4WL4 A;  4XE1 A;  4Q7W A;  5DRS A;  3RZ0 B;  2FOU A;  4RUX A;  4COQ A;  2NNG A;  5E2N A;  4JSA A;  3IAI A;  3OYQ A;  1CNG A;  1AVN A;  4QSB A;  4RFC A;  2HNC A;  1HED A;  4KNJ A;  1FQR A;  1CRA A;  5DSR A;  1TG9 A;  4CA2 A;  3S78 B;  3V2J A;  5JEP B;  5BRV A;  3SAX A;  1LGD A;  4FVO A;  1YO2 A;  1G3Z A;  5DSJ A;  1MOO A;  1ZSB A;  4QY3 A;  1CVB A;  5FNI A;  1Y7W A;  1CCU A;  1UGF A;  3P55 A;  3T82 A;  1LZV A;  3TMJ A;  3ZP9 A;  5EHV A;  2X7T A;  2VVB X;  3V2M A;  1TTM A;  1RJ5 A;  3F4X A; 
#chains in the Genus database with same CATH homology
 1TG3 A;  2IT4 A;  1TH9 A;  3M2Z A;  3ML5 A;  1DMY A;  3CYU A;  3P4V A;  1UGB A;  5SZ5 A;  3MNJ A;  3PO6 A;  1ZFK A;  4YGJ A;  3M04 A;  3D92 A;  1I90 A;  4K13 A;  4YGL A;  1KOQ A;  2QO8 A;  3KIG A;  4JSS A;  1RZC A;  4JSW A;  3KWA A;  4Q49 A;  4Q83 A;  4CNR A;  1HCA A;  4Q07 A;  4QTL A;  1MUA A;  3R17 B;  1XEG A;  3MHO A;  4ITP A;  3HS4 A;  3RYZ A;  4QJW A;  1BNU A;  3P58 A;  1BNM A;  5E5R A;  1TB0 X;  1BIC A;  4XZ5 A;  3U47 A;  1H9Q A;  5DOG A;  4YWP A;  3NJ9 A;  4M2U A;  1ZNC A;  3JXF A;  3M40 A;  4FVN A;  4E49 A;  4ZAO A;  4FL7 A;  4L5U A;  3DBU A;  3RG4 A;  4MDL A;  1YDB A;  1G52 A;  3BET A;  1CA2 A;  1CVD A;  1I9Q A;  5AMG A;  3DC9 A;  3RZ5 A;  5IPZ A;  3OYS A;  1TE3 X;  3TVN X;  1OQ5 A;  5EKH A;  4Q90 A;  2NMX A;  1G1D A;  3DVC A;  5SZ3 A;  4DZ7 A;  1HUH A;  5FL5 A;  4R59 A;  3M1W A;  5FLT A;  5FLQ A;  1CCS A;  3SAP A;  1CZM A;  4QJO A;  3M1Q A;  3DA2 A;  3V3G B;  1JCZ A;  3ML2 A;  2WD3 A;  2ABE A;  4C3T A;  1Z93 A;  4KP8 A;  4PYY A;  3M3X A;  5BYI A;  2NXR A;  4Q7S A;  4Q9Y A;  4BF1 A;  3S72 B;  4Q8X A;  5C8I A;  4TWL A;  4GL1 X;  3P44 A;  4KUW A;  4Q08 A;  5FNM A;  3S71 B;  2WD2 A;  3C7P A;  3JXG A;  4YXI A;  1G48 A;  1HUG A;  4BF6 A;  3M2X A;  5E2S A;  4E5Q A;  3V7X A;  1RZE A;  3T83 A;  2Q1B A;  2FNM A;  4QJ0 A;  3D8W A;  4Z1N A;  5FLR A;  4CAC A;  4Q99 A;  4CQ0 A;  2F14 A;  4IWZ A;  5BNL A;  1UGA A;  1Z97 A;  3P3J A;  4TWM A;  3KKX A;  5SZ7 A;  1XEV A;  5JQ0 A;  3M5T A;  9CA2 A;  2HL4 A;  4FIK A;  1TBT X;  1TEU X;  4PXX A;  6CA2 A;  5FNK A;  4ZWZ A;  1Z9Y A;  5EZT X;  1HVA A;  1I9N A;  2GD8 A;  2WEJ A;  1KWQ A;  1BN3 A;  3N2P A;  3P5L A;  4XFW A;  4BCW A;  3MYQ A;  1HEC A;  4QIY A;  2H4N A;  5EH5 A;  4Z0Q A;  1LUG A;  3T5U A;  4MLX A;  5EKJ A;  3P5A A;  5E2K A;  4DZ9 A;  4M2R A;  1BNN A;  5EH7 A;  4MO8 A;  3S74 B;  3CZV A;  1BNQ A;  2NNO A;  2NXT A;  3MHM A;  4MDM A;  3S77 B;  3U7C A;  1JD0 A;  1CVA A;  3HKT A;  2ZNC A;  2FMZ A;  5FNG A;  5FNJ A;  1CNB A;  3MDZ A;  4MLT A;  5DSL A;  2Q1Q A;  1HEA A;  5EH8 A;  4RIV A;  5BRU A;  1I91 A;  4N0X B;  4XIW A;  5G0C A;  1CAZ A;  1ZH9 A;  4YGN A;  2FW4 A;  3M96 A;  4QK3 A;  1CVF A;  4PYX A;  1YO1 A;  3BL1 A;  3RG3 A;  5FL4 A;  4KNM A;  4CNV A;  4HU1 A;  5G03 A;  3M2N A;  1OKM A;  3DD8 A;  3IEO A;  4YHA A;  4ZWI A;  1THK A;  3DVD A;  3FW3 A;  4KV0 A;  4Q6D A;  4WW8 A;  2OSF A;  4HEY A;  4E4A A;  1G6V A;  3HFP A;  3MMF A;  3BL0 A;  1CAY A;  3M14 A;  1I9P A;  4YGF A;  3V3H B;  5L3O A;  3M5S A;  1CVE A;  4G0C A;  4YYT A;  1CNW A;  3EFT A;  2FOQ A;  3M67 A;  3SBH A;  3HKN A;  3RYX B;  2FOV A;  1FQM A;  3KS3 A;  3QYK A;  1IF9 A;  3CAJ A;  1RAY A;  2NWO A;  2QP6 A;  4QSI A;  3JXH C;  4JSZ A;  3IBN A;  3GZ0 A;  5JQT A;  3K2F A;  3PJJ A;  1H4N A;  3B4F A;  1CIN A;  2FNK A;  3RZ8 A;  3RYJ B;  2NWY A;  1G46 A;  3V3J A;  3R16 A;  5FLO A;  4E3F A;  3MHL A;  3N4B A;  1UGD A;  2W2J A;  5CLU A;  2X7S A;  4Q81 A;  5CAC A;  3IBL A;  3KNE A;  5EHE A;  1AZM A;  4Q87 A;  1A42 A;  1BN1 A;  1IF4 A;  1FSN A;  2NNS A;  1ZGE A;  3M2Y A;  3U45 X;  1G4J A;  5SZ4 A;  4ZWY A;  2NWZ A;  5EKM A;  5SZ0 A;  4RFD A;  1CNJ A;  1G0E A;  5HPJ A;  3HKQ A;  4JS6 A;  2CBE A;  4E3G A;  1JV0 A;  3LXE A;  4M2V A;  4G7A A;  7CA2 A;  3T84 A;  1I9L A;  4QJP A;  4FRC A;  1CVH A;  1RZD A;  3NI5 A;  3S9T A;  3KOI A;  1LG6 A;  1I8Z A;  2FMG A;  4K1Q A;  4Q09 A;  3S8X A;  4WUQ A;  4ETQ C;  3DVB A;  1CNK A;  4KP5 A;  3S97 A;  3W6I A;  1G53 A;  1CNI A;  3RZ7 A;  1BNW A;  1CAH A;  5A25 A;  1ZSA A;  5DSM A;  4XIX A;  4QSJ A;  1FQN A;  1G4O A;  1G0F A;  3IBU A;  2CAB A;  1IF7 A;  3D0N A;  4HT0 A;  3OIK A;  4QJM A;  3U3A X;  3DCW A;  3FE4 A;  3RGE A;  3B1B A;  4ZX0 A;  2CBC A;  4Y0J A;  5L6K A;  4LP6 A;  1EOU A;  4QK1 A;  2FNN A;  2NWP A;  1UGC A;  3V3I B;  4IDR X;  3DCC A;  1CAI A;  3DD0 A;  3P3H A;  5SZ1 A;  5DSN A;  5CJF A;  4Q0L A;  4RIU A;  2FOS A;  1FSR A;  3RZ1 B;  1FR4 A;  1G54 A;  4Z1E A;  2EU2 A;  3M5E A;  3HKU A;  5JEG B;  1I9M A;  4MTY A;  1DCB A;  5LMD A;  3L14 A;  3NB5 A;  5DSK A;  3IBI A;  5SZ2 A;  3M1J A;  4LU3 A;  5DSP A;  4HF3 A;  1V9E A;  4QSA A;  5JGS B;  4Q7V A;  2QOA A;  1BCD A;  1J9W A;  3MNI A;  1CIL A;  4RUZ A;  1HCB A;  1IF8 A;  1AM6 A;  3DV7 A;  4L5V A;  5DVX A;  4R5B A;  4WUP A;  4YGK A;  4UOV A;  5FDC A;  5JDV B;  5FLP A;  1ZFQ A;  4K0T A;  3OIL A;  4RN4 A;  2O4Z A;  3KON A;  1BV3 A;  1RZB A;  4ZWX A;  4K0Z A;  3VBD A;  1I9O A;  4N16 A;  1YO0 A;  2ILI A;  1CAN A;  3RJ7 A;  4YXO A;  4RH2 A;  3FFP X;  1OKL A;  1G45 A;  5EOI A;  1YDD A;  1YDA A;  5JEH B;  4FU5 A;  2WEG A;  5FDI A;  1RZA A;  1LG5 A;  3MNU A;  3PYK A;  4YX4 A;  1DCA A;  3D9Z A;  3S75 B;  4HBA A;  4Q6E A;  3K7K A;  2NXS A;  4ITO A;  3S73 B;  3RYY A;  4QIZ A;  1BZM A;  4PQ7 A;  1FLJ A;  1ZGF A;  2H15 A;  3MHI A;  3Q31 A;  2CBD A;  4QEF A;  5E28 A;  3T85 A;  2POW A;  3MNA A;  1BN4 A;  1CIM A;  2CBB A;  3TVO X;  3MHC A;  1RAZ A;  3M98 A;  4Q78 A;  1TEQ X;  2HD6 A;  2EZ7 A;  4ILX A;  12CA A;  1XQ0 A;  4LHI A;  5E2R A;  1CCT A;  3K34 A;  4E3D A;  3MNK A;  2X7U A;  2OSM A;  3W6H A;  4KAP A;  1CAL A;  3T5Z A;  3RYV B;  3OKU A;  4KNN A;  4E3H A;  3CA2 A;  4FPT A;  1IF5 A;  4M2W A;  1T9N A;  5DSQ A;  4K0S A;  5BRW A;  2POU A;  5JES B;  3RLD A;  3V5G A;  4HEW A;  4WW6 A;  4RUY A;  2WEH A;  5JGT B;  4YVY A;  1BNT A;  1FR7 A;  4WR7 A;  4X5S A;  1CNC A;  1KEQ A;  4MDG A;  1CAK A;  4Z1K A;  1RJ6 A;  1XPZ A;  2NN7 A;  3SBI A;  2CBA A;  2WEO A;  5E2M A;  5JG3 B;  3KOK A;  3ZNC A;  5FNH A;  1FQL A;  2GEH A;  3DCS A;  1CAJ A;  1V9I C;  1F2W A;  5EHW A;  4KUV A;  4E9O X;  2AW1 A;  5AMD A;  4Z1J A;  8CA2 A;  4YXU A;  2NNV A;  2HOC A;  2AX2 A;  5FLS A;  1CVC A;  3F7B A;  1KWR A;  4QJX A;  5G0B A;  4L5W A;  4KUY A;  1FSQ A;  5DSI A;  3EFI A;  4HT2 A;  1CAO A;  1H9N A;  1KOP A;  5JG5 B;  3M1K A;  1OKN A;  3N3J A;  2CA2 A;  5J8Z A;  3OKV A;  2FOY A;  4Q8Y A;  5DOH A;  2NN1 A;  3KLD B;  5FNL A;  5E5U A;  5G01 A;  2POV A;  3IGP A;  5AML A;  1HEB A;  3MZC A;  1URT A;  4R5A A;  3S76 A;  4Q8Z A;  3UYN A;  1DMX A;  3D93 A;  4Q06 A;  1CRM A;  1ZSC A;  1CNH A;  5SZ6 A;  5A6H A;  2Q38 A;  1YDC A;  1UGE A;  3V3F A;  3DC3 A;  4PZH A;  4Q7P A;  2HFW A;  2VVA X;  4ZX1 A;  1IF6 A;  3DAZ A;  4CNX A;  1CA3 A;  3F7U A;  3HLJ A;  3MNH A;  5EIJ A;  3UYQ A;  1BNV A;  2HKK A;  3N0N A;  1ZE8 A;  5DSO A;  1UGG A;  2EU3 A;  3MWO A;  3F8E A;  4HEZ A;  4QK2 A;  5FL6 A;  1CNX A;  5CA2 A;  1CAM A;  3OY0 A;  4CNW A;  1CNY A;  4KNI A;  3OIM A;  4WL4 A;  4XE1 A;  4Q7W A;  5DRS A;  3RZ0 B;  2FOU A;  4RUX A;  4COQ A;  2NNG A;  5E2N A;  4JSA A;  3IAI A;  3OYQ A;  1CNG A;  1AVN A;  4QSB A;  4RFC A;  2HNC A;  1HED A;  4KNJ A;  1FQR A;  1CRA A;  5DSR A;  1TG9 A;  4CA2 A;  3S78 B;  3V2J A;  5JEP B;  5BRV A;  3SAX A;  1LGD A;  4FVO A;  1YO2 A;  1G3Z A;  5DSJ A;  1MOO A;  1ZSB A;  4QY3 A;  1CVB A;  5FNI A;  1Y7W A;  1CCU A;  1UGF A;  3P55 A;  3T82 A;  1LZV A;  3TMJ A;  3ZP9 A;  5EHV A;  2X7T A;  2VVB X;  3V2M A;  1TTM A;  1RJ5 A;  3F4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...