5E2MA

Crystal structure of human carbonic anhydrase isozyme i with 3-(cyclooctylamino)-2,5,6-trifluoro-4-[(2-hydroxyethyl)sulfonyl]benzenesulfonamide
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
Knots found
sequence length
256
structure length
256
Chain Sequence
WGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Intrinsic Thermodynamics and Structures of 2,4- and 3,4-Substituted Fluorinated Benzenesulfonamides Binding to Carbonic Anhydrases.
pubmed doi rcsb
molecule keywords Carbonic anhydrase 1
molecule tags Lyase
source organism Homo sapiens
total genus 76
structure length 256
sequence length 256
chains with identical sequence B
other databases KnotProt 2.0: S +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2015-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 5e2mA00
1J9WA 4XE1A 3IBIA 3IEOA 3RZ0B 2WEHA 3ZP9A 3DAZA 1CZMA 2H15A 1Z9YA 3F7BA 4WUPA 3DCSA 3OY0A 4CNXA 3Q31A 1KEQA 1CVBA 2AW1A 5JEHB 5EH8A 3M67A 3M98A 4KNIA 4YGLA 2Q1QA 1CNGA 4TWLA 5JQ0A 5BRVA 3R16A 3R17B 3RYXB 2WEOA 5BRUA 3MYQA 3KS3A 4Q6EA 1CAYA 4KV0A 4WW6A 3S78B 4Z1NA 7CA2A 1KWQA 5SZ0A 1CRAA 1CVHA 2NNOA 3M5SA 1V9IC 3NJ9A 2QP6A 4Q08A 4XZ5A 5SZ1A 4Q7WA 4K13A 3MHIA 1BNVA 5DVXA 2OSMA 1T9NA 2EU2A 1BZMA 5EIJA 1IF8A 4MDGA 1RAYA 4QK2A 1TG9A 1CVCA 4DZ9A 1RZBA 2EZ7A 4YGKA 3V3IB 3RZ8A 1HEAA 4RH2A 3IGPA 3M40A 5BYIA 1CAMA 3KOIA 4KNMA 4XIXA 3T85A 4L5VA 4KP8A 3M3XA 1JD0A 4QEFA 4E3GA 3RZ1B 3D93A 1IF9A 2HD6A 3U45X 1LZVA 2NXSA 3JXFA 4K0TA 2HOCA 1IF7A 5J8ZA 3C7PA 4ZWIA 1G54A 5EZTX 5LMDA 12CAA 1KOQA 5FL5A 5E5UA 2NXRA 3DA2A 3M2YA 3MNAA 3OKUA 5DSQA 4ITOA 1XPZA 4CQ0A 5JEGB 3T83A 1CAJA 1G4OA 2AX2A 1HECA 2CA2A 2WEJA 1Y7WA 5JG5B 4E3DA 5FNLA 4C3TA 4PQ7A 2CBAA 1AM6A 5E2MA 1I8ZA 5FLOA 1G52A 3M2NA 1LGDA 1H4NA 4QSAA 1BN4A 4XIWA 3P5LA 3W6HA 1LG6A 2FW4A 1HVAA 4L5WA 5EOIA 4Q81A 4QIYA 4QTLA 5FL6A 3P3HA 3MHMA 3OIKA 4IWZA 1CCTA 2ILIA 2X7UA 3RZ7A 3P58A 1CVAA 1CCUA 4CA2A 5DOGA 3S8XA 3MHOA 4Q8ZA 5JG3B 4KNNA 5EHEA 5FNMA 1KWRA 4KP5A 4YXUA 3GZ0A 2HKKA 5CACA 4MDMA 4HEWA 1MUAA 4RUZA 5FNJA 4ZX1A 4Q0LA 4Q78A 4RUXA 3KWAA 1TEQX 4CNVA 3N0NA 1AVNA 3RG3A 1CNHA 3KKXA 5E2NA 1FQMA 3HKUA 4ZWZA 1G0EA 4DZ7A 4K0SA 4MDLA 4XFWA 1RJ5A 4LHIA 3RYYA 1I9MA 4WL4A 4YXOA 1FSNA 2NN7A 1I9PA 3RZ5A 1CNJA 1LUGA 1RJ6A 4JSWA 4Q7SA 2POWA 5HPJA 2NNGA 3M14A 2NNVA 4ITPA 1CVDA 5DSLA 4KAPA 1UGAA 4COQA 4PYYA 4Z1KA 1CAIA 1CAHA 4KUVA 3T82A 4Q49A 1THKA 1I9OA 1YDDA 5A25A 1Z93A 1ZSAA 3M96A 3MNUA 1CNBA 2NWOA 1FR4A 5G0BA 3V3GB 1Z97A 5FLPA 3HKQA 4E3FA 2VVBX 3L14A 2ABEA 3DC3A 3S71B 1URTA 5SZ6A 2GEHA 1G46A 3KNEA 4RN4A 5L3OA 5G0CA 1CVEA 3N2PA 5G01A 1I9QA 3LXEA 4FVNA 1CNWA 4HT2A 3DVDA 3M1JA 5EHVA 5EKMA 4E49A 2F14A 1ZGFA 1I9LA 3B1BA 4ETQC 3SAXA 4CNWA 4Q09A 4E5QA 1HCBA 5DSPA 5SZ2A 1BNUA 4Q7PA 1HUGA 3DD8A 1XEVA 2POUA 4IDRX 2X7TA 3MNHA 1ZFQA 2FOQA 4QSIA 4Q9YA 1G4JA 4M2WA 4RIUA 3B4FA 1CNKA 1G48A 1HEBA 5EH5A 5DRSA 1BNQA 1CALA 3T84A 4HEYA 1BN1A 1ZSBA 2CBEA 2IT4A 4QJOA 4MO8A 1ZE8A 1G0FA 2NNSA 4BF1A 4Q8YA 3RYJB 5EKHA 2POVA 4HT0A 3DC9A 4E3HA 4YGJA 5FNHA 3M5EA 3CAJA 1FQRA 4RIVA 3P3JA 3FW3A 4RFCA 5A6HA 2FOVA 4Q87A 5JESB 1BN3A 1OQ5A 3HS4A 3DCWA 1TTMA 2WD2A 3M5TA 4KUWA 4R59A 3JXHC 1G6VA 2HL4A 3K2FA 4YVYA 4YYTA 5FDIA 9CA2A 2Q1BA 1G45A 3DVBA 4FRCA 3D92A 1OKNA 4Q06A 3S74B 3W6IA 1TB0X 1DMXA 3CA2A 2W2JA 3DBUA 1OKLA 1UGBA 3SBHA 3MMFA 3OYSA 4Z0QA 1HUHA 5BRWA 1FSRA 3JXGA 2EU3A 3UYNA 3TVOX 5L6KA 5SZ7A 4QJPA 2NWPA 2ZNCA 3MNJA 4QSJA 1UGGA 4M2RA 4QJMA 4PXXA 3K34A 3MHCA 1ZGEA 5JGTB 1G3ZA 3M2ZA 3D8WA 2GD8A 4QK1A 3N3JA 1FR7A 2FOUA 3QYKA 5FLTA 3SBIA 3V3FA 4GL1X 5BNLA 4HF3A 3KONA 4FPTA 4M2VA 4YXIA 1I9NA 4QJXA 2CBBA 4UOVA 3NI5A 4YWPA 1XQ0A 1KOPA 3NB5A 3HLJA 4BF6A 5AMLA 5JQTA 3M1QA 3T5ZA 4HU1A 5AMDA 3RLDA 3RYZA 5FNKA 3F4XA 3RGEA 2CABA 1H9QA 1CNXA 3IBUA 3P55A 5AMGA 3MNKA 4Z1JA 3OIMA 2HFWA 3V2MA 3U7CA 3CZVA 1UGFA 3V3JA 4Q8XA 3M1KA 5FLQA 1RZEA 2FOYA 4N0XB 1CAKA 3MDZA 3N4BA 1OKMA 6CA2A 4ZAOA 4M2UA 3RG4A 5IPZA 2FNKA 3HKTA 5E2KA 5DSJA 1JCZA 1FLJA 3KOKA 4Q99A 4ZWYA 1G53A 3EFIA 1CA3A 1YDBA 3KIGA 2NWYA 3CYUA 1ZFKA 1BV3A 4YGNA 5G03A 1RZDA 3BL1A 3M04A 5FNIA 2OSFA 4JSSA 1ZH9A 4MLXA 4G7AA 4ZWXA 3S97A 3ML2A 1UGEA 1TH9A 5E28A 4TWMA 5JDVB 4E4AA 1YDCA 3S75B 5E5RA 1UGCA 3DD0A 1CIMA 3P44A 1AZMA 1HCAA 2QOAA 1CVFA 3FFPX 3ML5A 3HKNA 4X5SA 3V2JA 4QY3A 5DOHA 4QJWA 1TE3X 2CBDA 5SZ5A 4CACA 1TG3A 1CNIA 5FLRA 3F7UA 2QO8A 4WW8A 4ZX0A 4Q7VA 3MNIA 4R5BA 5EH7A 4MTYA 5EHWA 5JEPB 1BNNA 4E9OX 4HBAA 2HNCA 3MZCA 5DSKA 5EKJA 1BICA 3MHLA 1CCSA 5C8IA 5DSIA 5E2RA 3IBNA 2NXTA 1BCDA 3OKVA 3P5AA 3V5GA 4PZHA 1XEGA 4Q83A 3RJ7A 3V3HB 3TMJA 3MWOA 5CLUA 3BL0A 1RZCA 3M2XA 5DSOA 3DVCA 1RAZA 1ZNCA 3KLDB 5DSNA 4Z1EA 2NMXA 2O4ZA 3PJJA 4KNJA 2FNMA 8CA2A 3EFTA 5SZ4A 1TEUX 4LP6A 4QJ0A 3VBDA 5JGSB 1YO2A 2X7SA 1ZSCA 5SZ3A 2VVAX 3BETA 4JSZA 4JS6A 4MLTA 4N16A 4WUQA 3T5UA 1I90A 4PYXA 2CBCA 1TBTX 5FNGA 3TVNX 3DCCA 4FIKA 4RUYA 5FLSA 4HEZA 3IAIA 3S72B 4YGFA 2WEGA 1IF6A 1CAOA 1DMYA 4K0ZA 5DSRA 3RYVB 1YO0A 3UYQA 1I91A 2FMGA 4QIZA 1BNTA 1BNWA 1UGDA 4LU3A 3PYKA 1FQLA 3P4VA 1DCAA 4FL7A 4YHAA 1CINA 1CRMA 4FVOA 2FNNA 1HEDA 4WR7A 3FE4A 3S73B 1CANA 3D9ZA 1CA2A 4K1QA 4JSAA 5E2SA 2WD3A 3ZNCA 4FU5A 1YO1A 3V7XA 2H4NA 4R5AA 3U47A 2FOSA 3IBLA 1JV0A 1FQNA 1LG5A 2Q38A 1IF4A 3K7KA 3PO6A 5DSMA 2NN1A 3HFPA 4G0CA 1CNCA 1G1DA 1A42A 4KUYA 4QSBA 1BNMA 4Q90A 4Q07A 3S77B 4Y0JA 1IF5A 4BCWA 1DCBA 3M1WA 1FSQA 1CAZA 2NWZA 3OYQA 4Q6DA 3U3AX 5CA2A 1EOUA 1CNYA 3D0NA 3F8EA 1F2WA 3S9TA 1RZAA 3OILA 3S76A 4CNRA 4YX4A 1V9EA 5FDCA 3SAPA 4ILXA 1YDAA 5CJFA 5FL4A 1CILA 4QK3A 2FMZA 1MOOA 4L5UA 3DV7A 1H9NA 4RFDA
chains in the Genus database with same CATH superfamily
1J9WA 4XE1A 3IBIA 3IEOA 3RZ0B 2WEHA 3ZP9A 3DAZA 1CZMA 2H15A 1Z9YA 3F7BA 4WUPA 3DCSA 3OY0A 4CNXA 3Q31A 1KEQA 1CVBA 2AW1A 5JEHB 5EH8A 3M67A 3M98A 4KNIA 4YGLA 2Q1QA 1CNGA 4TWLA 5JQ0A 5BRVA 3R16A 3R17B 3RYXB 2WEOA 5BRUA 3MYQA 3KS3A 4Q6EA 1CAYA 4KV0A 4WW6A 3S78B 4Z1NA 7CA2A 1KWQA 5SZ0A 1CRAA 1CVHA 2NNOA 3M5SA 1V9IC 3NJ9A 2QP6A 4Q08A 4XZ5A 5SZ1A 4Q7WA 4K13A 3MHIA 1BNVA 5DVXA 2OSMA 1T9NA 2EU2A 1BZMA 5EIJA 1IF8A 4MDGA 1RAYA 4QK2A 1TG9A 1CVCA 4DZ9A 1RZBA 2EZ7A 4YGKA 3V3IB 3RZ8A 1HEAA 4RH2A 3IGPA 3M40A 5BYIA 1CAMA 3KOIA 4KNMA 4XIXA 3T85A 4L5VA 4KP8A 3M3XA 1JD0A 4QEFA 4E3GA 3RZ1B 3D93A 1IF9A 2HD6A 3U45X 1LZVA 2NXSA 3JXFA 4K0TA 2HOCA 1IF7A 5J8ZA 3C7PA 4ZWIA 1G54A 5EZTX 5LMDA 12CAA 1KOQA 5FL5A 5E5UA 2NXRA 3DA2A 3M2YA 3MNAA 3OKUA 5DSQA 4ITOA 1XPZA 4CQ0A 5JEGB 3T83A 1CAJA 1G4OA 2AX2A 1HECA 2CA2A 2WEJA 1Y7WA 5JG5B 4E3DA 5FNLA 4C3TA 4PQ7A 2CBAA 1AM6A 5E2MA 1I8ZA 5FLOA 1G52A 3M2NA 1LGDA 1H4NA 4QSAA 1BN4A 4XIWA 3P5LA 3W6HA 1LG6A 2FW4A 1HVAA 4L5WA 5EOIA 4Q81A 4QIYA 4QTLA 5FL6A 3P3HA 3MHMA 3OIKA 4IWZA 1CCTA 2ILIA 2X7UA 3RZ7A 3P58A 1CVAA 1CCUA 4CA2A 5DOGA 3S8XA 3MHOA 4Q8ZA 5JG3B 4KNNA 5EHEA 5FNMA 1KWRA 4KP5A 4YXUA 3GZ0A 2HKKA 5CACA 4MDMA 4HEWA 1MUAA 4RUZA 5FNJA 4ZX1A 4Q0LA 4Q78A 4RUXA 3KWAA 1TEQX 4CNVA 3N0NA 1AVNA 3RG3A 1CNHA 3KKXA 5E2NA 1FQMA 3HKUA 4ZWZA 1G0EA 4DZ7A 4K0SA 4MDLA 4XFWA 1RJ5A 4LHIA 3RYYA 1I9MA 4WL4A 4YXOA 1FSNA 2NN7A 1I9PA 3RZ5A 1CNJA 1LUGA 1RJ6A 4JSWA 4Q7SA 2POWA 5HPJA 2NNGA 3M14A 2NNVA 4ITPA 1CVDA 5DSLA 4KAPA 1UGAA 4COQA 4PYYA 4Z1KA 1CAIA 1CAHA 4KUVA 3T82A 4Q49A 1THKA 1I9OA 1YDDA 5A25A 1Z93A 1ZSAA 3M96A 3MNUA 1CNBA 2NWOA 1FR4A 5G0BA 3V3GB 1Z97A 5FLPA 3HKQA 4E3FA 2VVBX 3L14A 2ABEA 3DC3A 3S71B 1URTA 5SZ6A 2GEHA 1G46A 3KNEA 4RN4A 5L3OA 5G0CA 1CVEA 3N2PA 5G01A 1I9QA 3LXEA 4FVNA 1CNWA 4HT2A 3DVDA 3M1JA 5EHVA 5EKMA 4E49A 2F14A 1ZGFA 1I9LA 3B1BA 4ETQC 3SAXA 4CNWA 4Q09A 4E5QA 1HCBA 5DSPA 5SZ2A 1BNUA 4Q7PA 1HUGA 3DD8A 1XEVA 2POUA 4IDRX 2X7TA 3MNHA 1ZFQA 2FOQA 4QSIA 4Q9YA 1G4JA 4M2WA 4RIUA 3B4FA 1CNKA 1G48A 1HEBA 5EH5A 5DRSA 1BNQA 1CALA 3T84A 4HEYA 1BN1A 1ZSBA 2CBEA 2IT4A 4QJOA 4MO8A 1ZE8A 1G0FA 2NNSA 4BF1A 4Q8YA 3RYJB 5EKHA 2POVA 4HT0A 3DC9A 4E3HA 4YGJA 5FNHA 3M5EA 3CAJA 1FQRA 4RIVA 3P3JA 3FW3A 4RFCA 5A6HA 2FOVA 4Q87A 5JESB 1BN3A 1OQ5A 3HS4A 3DCWA 1TTMA 2WD2A 3M5TA 4KUWA 4R59A 3JXHC 1G6VA 2HL4A 3K2FA 4YVYA 4YYTA 5FDIA 9CA2A 2Q1BA 1G45A 3DVBA 4FRCA 3D92A 1OKNA 4Q06A 3S74B 3W6IA 1TB0X 1DMXA 3CA2A 2W2JA 3DBUA 1OKLA 1UGBA 3SBHA 3MMFA 3OYSA 4Z0QA 1HUHA 5BRWA 1FSRA 3JXGA 2EU3A 3UYNA 3TVOX 5L6KA 5SZ7A 4QJPA 2NWPA 2ZNCA 3MNJA 4QSJA 1UGGA 4M2RA 4QJMA 4PXXA 3K34A 3MHCA 1ZGEA 5JGTB 1G3ZA 3M2ZA 3D8WA 2GD8A 4QK1A 3N3JA 1FR7A 2FOUA 3QYKA 5FLTA 3SBIA 3V3FA 4GL1X 5BNLA 4HF3A 3KONA 4FPTA 4M2VA 4YXIA 1I9NA 4QJXA 2CBBA 4UOVA 3NI5A 4YWPA 1XQ0A 1KOPA 3NB5A 3HLJA 4BF6A 5AMLA 5JQTA 3M1QA 3T5ZA 4HU1A 5AMDA 3RLDA 3RYZA 5FNKA 3F4XA 3RGEA 2CABA 1H9QA 1CNXA 3IBUA 3P55A 5AMGA 3MNKA 4Z1JA 3OIMA 2HFWA 3V2MA 3U7CA 3CZVA 1UGFA 3V3JA 4Q8XA 3M1KA 5FLQA 1RZEA 2FOYA 4N0XB 1CAKA 3MDZA 3N4BA 1OKMA 6CA2A 4ZAOA 4M2UA 3RG4A 5IPZA 2FNKA 3HKTA 5E2KA 5DSJA 1JCZA 1FLJA 3KOKA 4Q99A 4ZWYA 1G53A 3EFIA 1CA3A 1YDBA 3KIGA 2NWYA 3CYUA 1ZFKA 1BV3A 4YGNA 5G03A 1RZDA 3BL1A 3M04A 5FNIA 2OSFA 4JSSA 1ZH9A 4MLXA 4G7AA 4ZWXA 3S97A 3ML2A 1UGEA 1TH9A 5E28A 4TWMA 5JDVB 4E4AA 1YDCA 3S75B 5E5RA 1UGCA 3DD0A 1CIMA 3P44A 1AZMA 1HCAA 2QOAA 1CVFA 3FFPX 3ML5A 3HKNA 4X5SA 3V2JA 4QY3A 5DOHA 4QJWA 1TE3X 2CBDA 5SZ5A 4CACA 1TG3A 1CNIA 5FLRA 3F7UA 2QO8A 4WW8A 4ZX0A 4Q7VA 3MNIA 4R5BA 5EH7A 4MTYA 5EHWA 5JEPB 1BNNA 4E9OX 4HBAA 2HNCA 3MZCA 5DSKA 5EKJA 1BICA 3MHLA 1CCSA 5C8IA 5DSIA 5E2RA 3IBNA 2NXTA 1BCDA 3OKVA 3P5AA 3V5GA 4PZHA 1XEGA 4Q83A 3RJ7A 3V3HB 3TMJA 3MWOA 5CLUA 3BL0A 1RZCA 3M2XA 5DSOA 3DVCA 1RAZA 1ZNCA 3KLDB 5DSNA 4Z1EA 2NMXA 2O4ZA 3PJJA 4KNJA 2FNMA 8CA2A 3EFTA 5SZ4A 1TEUX 4LP6A 4QJ0A 3VBDA 5JGSB 1YO2A 2X7SA 1ZSCA 5SZ3A 2VVAX 3BETA 4JSZA 4JS6A 4MLTA 4N16A 4WUQA 3T5UA 1I90A 4PYXA 2CBCA 1TBTX 5FNGA 3TVNX 3DCCA 4FIKA 4RUYA 5FLSA 4HEZA 3IAIA 3S72B 4YGFA 2WEGA 1IF6A 1CAOA 1DMYA 4K0ZA 5DSRA 3RYVB 1YO0A 3UYQA 1I91A 2FMGA 4QIZA 1BNTA 1BNWA 1UGDA 4LU3A 3PYKA 1FQLA 3P4VA 1DCAA 4FL7A 4YHAA 1CINA 1CRMA 4FVOA 2FNNA 1HEDA 4WR7A 3FE4A 3S73B 1CANA 3D9ZA 1CA2A 4K1QA 4JSAA 5E2SA 2WD3A 3ZNCA 4FU5A 1YO1A 3V7XA 2H4NA 4R5AA 3U47A 2FOSA 3IBLA 1JV0A 1FQNA 1LG5A 2Q38A 1IF4A 3K7KA 3PO6A 5DSMA 2NN1A 3HFPA 4G0CA 1CNCA 1G1DA 1A42A 4KUYA 4QSBA 1BNMA 4Q90A 4Q07A 3S77B 4Y0JA 1IF5A 4BCWA 1DCBA 3M1WA 1FSQA 1CAZA 2NWZA 3OYQA 4Q6DA 3U3AX 5CA2A 1EOUA 1CNYA 3D0NA 3F8EA 1F2WA 3S9TA 1RZAA 3OILA 3S76A 4CNRA 4YX4A 1V9EA 5FDCA 3SAPA 4ILXA 1YDAA 5CJFA 5FL4A 1CILA 4QK3A 2FMZA 1MOOA 4L5UA 3DV7A 1H9NA 4RFDA
chains in the Genus database with same CATH topology
1J9WA 4XE1A 3IBIA 3IEOA 3RZ0B 2WEHA 3ZP9A 3DAZA 1CZMA 2H15A 1Z9YA 3F7BA 4WUPA 3DCSA 3OY0A 4CNXA 3Q31A 1KEQA 1CVBA 2AW1A 5JEHB 5EH8A 3M67A 3M98A 4KNIA 4YGLA 2Q1QA 1CNGA 4TWLA 5JQ0A 5BRVA 3R16A 3R17B 3RYXB 2WEOA 5BRUA 3MYQA 3KS3A 4Q6EA 1CAYA 4KV0A 4WW6A 3S78B 4Z1NA 7CA2A 1KWQA 5SZ0A 1CRAA 1CVHA 2NNOA 3M5SA 1V9IC 3NJ9A 2QP6A 4Q08A 4XZ5A 5SZ1A 4Q7WA 4K13A 3MHIA 1BNVA 5DVXA 2OSMA 1T9NA 2EU2A 1BZMA 5EIJA 1IF8A 4MDGA 1RAYA 4QK2A 1TG9A 1CVCA 4DZ9A 1RZBA 2EZ7A 4YGKA 3V3IB 3RZ8A 1HEAA 4RH2A 3IGPA 3M40A 5BYIA 1CAMA 3KOIA 4KNMA 4XIXA 3T85A 4L5VA 4KP8A 3M3XA 1JD0A 4QEFA 4E3GA 3RZ1B 3D93A 1IF9A 2HD6A 3U45X 1LZVA 2NXSA 3JXFA 4K0TA 2HOCA 1IF7A 5J8ZA 3C7PA 4ZWIA 1G54A 5EZTX 5LMDA 12CAA 1KOQA 5FL5A 5E5UA 2NXRA 3DA2A 3M2YA 3MNAA 3OKUA 5DSQA 4ITOA 1XPZA 4CQ0A 5JEGB 3T83A 1CAJA 1G4OA 2AX2A 1HECA 2CA2A 2WEJA 1Y7WA 5JG5B 4E3DA 5FNLA 4C3TA 4PQ7A 2CBAA 1AM6A 5E2MA 1I8ZA 5FLOA 1G52A 3M2NA 1LGDA 1H4NA 4QSAA 1BN4A 4XIWA 3P5LA 3W6HA 1LG6A 2FW4A 1HVAA 4L5WA 5EOIA 4Q81A 4QIYA 4QTLA 5FL6A 3P3HA 3MHMA 3OIKA 4IWZA 1CCTA 2ILIA 2X7UA 3RZ7A 3P58A 1CVAA 1CCUA 4CA2A 5DOGA 3S8XA 3MHOA 4Q8ZA 5JG3B 4KNNA 5EHEA 5FNMA 1KWRA 4KP5A 4YXUA 3GZ0A 2HKKA 5CACA 4MDMA 4HEWA 1MUAA 4RUZA 5FNJA 4ZX1A 4Q0LA 4Q78A 4RUXA 3KWAA 1TEQX 4CNVA 3N0NA 1AVNA 3RG3A 1CNHA 3KKXA 5E2NA 1FQMA 3HKUA 4ZWZA 1G0EA 4DZ7A 4K0SA 4MDLA 4XFWA 1RJ5A 4LHIA 3RYYA 1I9MA 4WL4A 4YXOA 1FSNA 2NN7A 1I9PA 3RZ5A 1CNJA 1LUGA 1RJ6A 4JSWA 4Q7SA 2POWA 5HPJA 2NNGA 3M14A 2NNVA 4ITPA 1CVDA 5DSLA 4KAPA 1UGAA 4COQA 4PYYA 4Z1KA 1CAIA 1CAHA 4KUVA 3T82A 4Q49A 1THKA 1I9OA 1YDDA 5A25A 1Z93A 1ZSAA 3M96A 3MNUA 1CNBA 2NWOA 1FR4A 5G0BA 3V3GB 1Z97A 5FLPA 3HKQA 4E3FA 2VVBX 3L14A 2ABEA 3DC3A 3S71B 1URTA 5SZ6A 2GEHA 1G46A 3KNEA 4RN4A 5L3OA 5G0CA 1CVEA 3N2PA 5G01A 1I9QA 3LXEA 4FVNA 1CNWA 4HT2A 3DVDA 3M1JA 5EHVA 5EKMA 4E49A 2F14A 1ZGFA 1I9LA 3B1BA 4ETQC 3SAXA 4CNWA 4Q09A 4E5QA 1HCBA 5DSPA 5SZ2A 1BNUA 4Q7PA 1HUGA 3DD8A 1XEVA 2POUA 4IDRX 2X7TA 3MNHA 1ZFQA 2FOQA 4QSIA 4Q9YA 1G4JA 4M2WA 4RIUA 3B4FA 1CNKA 1G48A 1HEBA 5EH5A 5DRSA 1BNQA 1CALA 3T84A 4HEYA 1BN1A 1ZSBA 2CBEA 2IT4A 4QJOA 4MO8A 1ZE8A 1G0FA 2NNSA 4BF1A 4Q8YA 3RYJB 5EKHA 2POVA 4HT0A 3DC9A 4E3HA 4YGJA 5FNHA 3M5EA 3CAJA 1FQRA 4RIVA 3P3JA 3FW3A 4RFCA 5A6HA 2FOVA 4Q87A 5JESB 1BN3A 1OQ5A 3HS4A 3DCWA 1TTMA 2WD2A 3M5TA 4KUWA 4R59A 3JXHC 1G6VA 2HL4A 3K2FA 4YVYA 4YYTA 5FDIA 9CA2A 2Q1BA 1G45A 3DVBA 4FRCA 3D92A 1OKNA 4Q06A 3S74B 3W6IA 1TB0X 1DMXA 3CA2A 2W2JA 3DBUA 1OKLA 1UGBA 3SBHA 3MMFA 3OYSA 4Z0QA 1HUHA 5BRWA 1FSRA 3JXGA 2EU3A 3UYNA 3TVOX 5L6KA 5SZ7A 4QJPA 2NWPA 2ZNCA 3MNJA 4QSJA 1UGGA 4M2RA 4QJMA 4PXXA 3K34A 3MHCA 1ZGEA 5JGTB 1G3ZA 3M2ZA 3D8WA 2GD8A 4QK1A 3N3JA 1FR7A 2FOUA 3QYKA 5FLTA 3SBIA 3V3FA 4GL1X 5BNLA 4HF3A 3KONA 4FPTA 4M2VA 4YXIA 1I9NA 4QJXA 2CBBA 4UOVA 3NI5A 4YWPA 1XQ0A 1KOPA 3NB5A 3HLJA 4BF6A 5AMLA 5JQTA 3M1QA 3T5ZA 4HU1A 5AMDA 3RLDA 3RYZA 5FNKA 3F4XA 3RGEA 2CABA 1H9QA 1CNXA 3IBUA 3P55A 5AMGA 3MNKA 4Z1JA 3OIMA 2HFWA 3V2MA 3U7CA 3CZVA 1UGFA 3V3JA 4Q8XA 3M1KA 5FLQA 1RZEA 2FOYA 4N0XB 1CAKA 3MDZA 3N4BA 1OKMA 6CA2A 4ZAOA 4M2UA 3RG4A 5IPZA 2FNKA 3HKTA 5E2KA 5DSJA 1JCZA 1FLJA 3KOKA 4Q99A 4ZWYA 1G53A 3EFIA 1CA3A 1YDBA 3KIGA 2NWYA 3CYUA 1ZFKA 1BV3A 4YGNA 5G03A 1RZDA 3BL1A 3M04A 5FNIA 2OSFA 4JSSA 1ZH9A 4MLXA 4G7AA 4ZWXA 3S97A 3ML2A 1UGEA 1TH9A 5E28A 4TWMA 5JDVB 4E4AA 1YDCA 3S75B 5E5RA 1UGCA 3DD0A 1CIMA 3P44A 1AZMA 1HCAA 2QOAA 1CVFA 3FFPX 3ML5A 3HKNA 4X5SA 3V2JA 4QY3A 5DOHA 4QJWA 1TE3X 2CBDA 5SZ5A 4CACA 1TG3A 1CNIA 5FLRA 3F7UA 2QO8A 4WW8A 4ZX0A 4Q7VA 3MNIA 4R5BA 5EH7A 4MTYA 5EHWA 5JEPB 1BNNA 4E9OX 4HBAA 2HNCA 3MZCA 5DSKA 5EKJA 1BICA 3MHLA 1CCSA 5C8IA 5DSIA 5E2RA 3IBNA 2NXTA 1BCDA 3OKVA 3P5AA 3V5GA 4PZHA 1XEGA 4Q83A 3RJ7A 3V3HB 3TMJA 3MWOA 5CLUA 3BL0A 1RZCA 3M2XA 5DSOA 3DVCA 1RAZA 1ZNCA 3KLDB 5DSNA 4Z1EA 2NMXA 2O4ZA 3PJJA 4KNJA 2FNMA 8CA2A 3EFTA 5SZ4A 1TEUX 4LP6A 4QJ0A 3VBDA 5JGSB 1YO2A 2X7SA 1ZSCA 5SZ3A 2VVAX 3BETA 4JSZA 4JS6A 4MLTA 4N16A 4WUQA 3T5UA 1I90A 4PYXA 2CBCA 1TBTX 5FNGA 3TVNX 3DCCA 4FIKA 4RUYA 5FLSA 4HEZA 3IAIA 3S72B 4YGFA 2WEGA 1IF6A 1CAOA 1DMYA 4K0ZA 5DSRA 3RYVB 1YO0A 3UYQA 1I91A 2FMGA 4QIZA 1BNTA 1BNWA 1UGDA 4LU3A 3PYKA 1FQLA 3P4VA 1DCAA 4FL7A 4YHAA 1CINA 1CRMA 4FVOA 2FNNA 1HEDA 4WR7A 3FE4A 3S73B 1CANA 3D9ZA 1CA2A 4K1QA 4JSAA 5E2SA 2WD3A 3ZNCA 4FU5A 1YO1A 3V7XA 2H4NA 4R5AA 3U47A 2FOSA 3IBLA 1JV0A 1FQNA 1LG5A 2Q38A 1IF4A 3K7KA 3PO6A 5DSMA 2NN1A 3HFPA 4G0CA 1CNCA 1G1DA 1A42A 4KUYA 4QSBA 1BNMA 4Q90A 4Q07A 3S77B 4Y0JA 1IF5A 4BCWA 1DCBA 3M1WA 1FSQA 1CAZA 2NWZA 3OYQA 4Q6DA 3U3AX 5CA2A 1EOUA 1CNYA 3D0NA 3F8EA 1F2WA 3S9TA 1RZAA 3OILA 3S76A 4CNRA 4YX4A 1V9EA 5FDCA 3SAPA 4ILXA 1YDAA 5CJFA 5FL4A 1CILA 4QK3A 2FMZA 1MOOA 4L5UA 3DV7A 1H9NA 4RFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J9W A;  4XE1 A;  3IBI A;  3IEO A;  3RZ0 B;  2WEH A;  3ZP9 A;  3DAZ A;  1CZM A;  2H15 A;  1Z9Y A;  3F7B A;  4WUP A;  3DCS A;  3OY0 A;  4CNX A;  3Q31 A;  1KEQ A;  1CVB A;  2AW1 A;  5JEH B;  5EH8 A;  3M67 A;  3M98 A;  4KNI A;  4YGL A;  2Q1Q A;  1CNG A;  4TWL A;  5JQ0 A;  5BRV A;  3R16 A;  3R17 B;  3RYX B;  2WEO A;  5BRU A;  3MYQ A;  3KS3 A;  4Q6E A;  1CAY A;  4KV0 A;  4WW6 A;  3S78 B;  4Z1N A;  7CA2 A;  1KWQ A;  5SZ0 A;  1CRA A;  1CVH A;  2NNO A;  3M5S A;  1V9I C;  3NJ9 A;  2QP6 A;  4Q08 A;  4XZ5 A;  5SZ1 A;  4Q7W A;  4K13 A;  3MHI A;  1BNV A;  5DVX A;  2OSM A;  1T9N A;  2EU2 A;  1BZM A;  5EIJ A;  1IF8 A;  4MDG A;  1RAY A;  4QK2 A;  1TG9 A;  1CVC A;  4DZ9 A;  1RZB A;  2EZ7 A;  4YGK A;  3V3I B;  3RZ8 A;  1HEA A;  4RH2 A;  3IGP A;  3M40 A;  5BYI A;  1CAM A;  3KOI A;  4KNM A;  4XIX A;  3T85 A;  4L5V A;  4KP8 A;  3M3X A;  1JD0 A;  4QEF A;  4E3G A;  3RZ1 B;  3D93 A;  1IF9 A;  2HD6 A;  3U45 X;  1LZV A;  2NXS A;  3JXF A;  4K0T A;  2HOC A;  1IF7 A;  5J8Z A;  3C7P A;  4ZWI A;  1G54 A;  5EZT X;  5LMD A;  12CA A;  1KOQ A;  5FL5 A;  5E5U A;  2NXR A;  3DA2 A;  3M2Y A;  3MNA A;  3OKU A;  5DSQ A;  4ITO A;  1XPZ A;  4CQ0 A;  5JEG B;  3T83 A;  1CAJ A;  1G4O A;  2AX2 A;  1HEC A;  2CA2 A;  2WEJ A;  1Y7W A;  5JG5 B;  4E3D A;  5FNL A;  4C3T A;  4PQ7 A;  2CBA A;  1AM6 A;  5E2M A;  1I8Z A;  5FLO A;  1G52 A;  3M2N A;  1LGD A;  1H4N A;  4QSA A;  1BN4 A;  4XIW A;  3P5L A;  3W6H A;  1LG6 A;  2FW4 A;  1HVA A;  4L5W A;  5EOI A;  4Q81 A;  4QIY A;  4QTL A;  5FL6 A;  3P3H A;  3MHM A;  3OIK A;  4IWZ A;  1CCT A;  2ILI A;  2X7U A;  3RZ7 A;  3P58 A;  1CVA A;  1CCU A;  4CA2 A;  5DOG A;  3S8X A;  3MHO A;  4Q8Z A;  5JG3 B;  4KNN A;  5EHE A;  5FNM A;  1KWR A;  4KP5 A;  4YXU A;  3GZ0 A;  2HKK A;  5CAC A;  4MDM A;  4HEW A;  1MUA A;  4RUZ A;  5FNJ A;  4ZX1 A;  4Q0L A;  4Q78 A;  4RUX A;  3KWA A;  1TEQ X;  4CNV A;  3N0N A;  1AVN A;  3RG3 A;  1CNH A;  3KKX A;  5E2N A;  1FQM A;  3HKU A;  4ZWZ A;  1G0E A;  4DZ7 A;  4K0S A;  4MDL A;  4XFW A;  1RJ5 A;  4LHI A;  3RYY A;  1I9M A;  4WL4 A;  4YXO A;  1FSN A;  2NN7 A;  1I9P A;  3RZ5 A;  1CNJ A;  1LUG A;  1RJ6 A;  4JSW A;  4Q7S A;  2POW A;  5HPJ A;  2NNG A;  3M14 A;  2NNV A;  4ITP A;  1CVD A;  5DSL A;  4KAP A;  1UGA A;  4COQ A;  4PYY A;  4Z1K A;  1CAI A;  1CAH A;  4KUV A;  3T82 A;  4Q49 A;  1THK A;  1I9O A;  1YDD A;  5A25 A;  1Z93 A;  1ZSA A;  3M96 A;  3MNU A;  1CNB A;  2NWO A;  1FR4 A;  5G0B A;  3V3G B;  1Z97 A;  5FLP A;  3HKQ A;  4E3F A;  2VVB X;  3L14 A;  2ABE A;  3DC3 A;  3S71 B;  1URT A;  5SZ6 A;  2GEH A;  1G46 A;  3KNE A;  4RN4 A;  5L3O A;  5G0C A;  1CVE A;  3N2P A;  5G01 A;  1I9Q A;  3LXE A;  4FVN A;  1CNW A;  4HT2 A;  3DVD A;  3M1J A;  5EHV A;  5EKM A;  4E49 A;  2F14 A;  1ZGF A;  1I9L A;  3B1B A;  4ETQ C;  3SAX A;  4CNW A;  4Q09 A;  4E5Q A;  1HCB A;  5DSP A;  5SZ2 A;  1BNU A;  4Q7P A;  1HUG A;  3DD8 A;  1XEV A;  2POU A;  4IDR X;  2X7T A;  3MNH A;  1ZFQ A;  2FOQ A;  4QSI A;  4Q9Y A;  1G4J A;  4M2W A;  4RIU A;  3B4F A;  1CNK A;  1G48 A;  1HEB A;  5EH5 A;  5DRS A;  1BNQ A;  1CAL A;  3T84 A;  4HEY A;  1BN1 A;  1ZSB A;  2CBE A;  2IT4 A;  4QJO A;  4MO8 A;  1ZE8 A;  1G0F A;  2NNS A;  4BF1 A;  4Q8Y A;  3RYJ B;  5EKH A;  2POV A;  4HT0 A;  3DC9 A;  4E3H A;  4YGJ A;  5FNH A;  3M5E A;  3CAJ A;  1FQR A;  4RIV A;  3P3J A;  3FW3 A;  4RFC A;  5A6H A;  2FOV A;  4Q87 A;  5JES B;  1BN3 A;  1OQ5 A;  3HS4 A;  3DCW A;  1TTM A;  2WD2 A;  3M5T A;  4KUW A;  4R59 A;  3JXH C;  1G6V A;  2HL4 A;  3K2F A;  4YVY A;  4YYT A;  5FDI A;  9CA2 A;  2Q1B A;  1G45 A;  3DVB A;  4FRC A;  3D92 A;  1OKN A;  4Q06 A;  3S74 B;  3W6I A;  1TB0 X;  1DMX A;  3CA2 A;  2W2J A;  3DBU A;  1OKL A;  1UGB A;  3SBH A;  3MMF A;  3OYS A;  4Z0Q A;  1HUH A;  5BRW A;  1FSR A;  3JXG A;  2EU3 A;  3UYN A;  3TVO X;  5L6K A;  5SZ7 A;  4QJP A;  2NWP A;  2ZNC A;  3MNJ A;  4QSJ A;  1UGG A;  4M2R A;  4QJM A;  4PXX A;  3K34 A;  3MHC A;  1ZGE A;  5JGT B;  1G3Z A;  3M2Z A;  3D8W A;  2GD8 A;  4QK1 A;  3N3J A;  1FR7 A;  2FOU A;  3QYK A;  5FLT A;  3SBI A;  3V3F A;  4GL1 X;  5BNL A;  4HF3 A;  3KON A;  4FPT A;  4M2V A;  4YXI A;  1I9N A;  4QJX A;  2CBB A;  4UOV A;  3NI5 A;  4YWP A;  1XQ0 A;  1KOP A;  3NB5 A;  3HLJ A;  4BF6 A;  5AML A;  5JQT A;  3M1Q A;  3T5Z A;  4HU1 A;  5AMD A;  3RLD A;  3RYZ A;  5FNK A;  3F4X A;  3RGE A;  2CAB A;  1H9Q A;  1CNX A;  3IBU A;  3P55 A;  5AMG A;  3MNK A;  4Z1J A;  3OIM A;  2HFW A;  3V2M A;  3U7C A;  3CZV A;  1UGF A;  3V3J A;  4Q8X A;  3M1K A;  5FLQ A;  1RZE A;  2FOY A;  4N0X B;  1CAK A;  3MDZ A;  3N4B A;  1OKM A;  6CA2 A;  4ZAO A;  4M2U A;  3RG4 A;  5IPZ A;  2FNK A;  3HKT A;  5E2K A;  5DSJ A;  1JCZ A;  1FLJ A;  3KOK A;  4Q99 A;  4ZWY A;  1G53 A;  3EFI A;  1CA3 A;  1YDB A;  3KIG A;  2NWY A;  3CYU A;  1ZFK A;  1BV3 A;  4YGN A;  5G03 A;  1RZD A;  3BL1 A;  3M04 A;  5FNI A;  2OSF A;  4JSS A;  1ZH9 A;  4MLX A;  4G7A A;  4ZWX A;  3S97 A;  3ML2 A;  1UGE A;  1TH9 A;  5E28 A;  4TWM A;  5JDV B;  4E4A A;  1YDC A;  3S75 B;  5E5R A;  1UGC A;  3DD0 A;  1CIM A;  3P44 A;  1AZM A;  1HCA A;  2QOA A;  1CVF A;  3FFP X;  3ML5 A;  3HKN A;  4X5S A;  3V2J A;  4QY3 A;  5DOH A;  4QJW A;  1TE3 X;  2CBD A;  5SZ5 A;  4CAC A;  1TG3 A;  1CNI A;  5FLR A;  3F7U A;  2QO8 A;  4WW8 A;  4ZX0 A;  4Q7V A;  3MNI A;  4R5B A;  5EH7 A;  4MTY A;  5EHW A;  5JEP B;  1BNN A;  4E9O X;  4HBA A;  2HNC A;  3MZC A;  5DSK A;  5EKJ A;  1BIC A;  3MHL A;  1CCS A;  5C8I A;  5DSI A;  5E2R A;  3IBN A;  2NXT A;  1BCD A;  3OKV A;  3P5A A;  3V5G A;  4PZH A;  1XEG A;  4Q83 A;  3RJ7 A;  3V3H B;  3TMJ A;  3MWO A;  5CLU A;  3BL0 A;  1RZC A;  3M2X A;  5DSO A;  3DVC A;  1RAZ A;  1ZNC A;  3KLD B;  5DSN A;  4Z1E A;  2NMX A;  2O4Z A;  3PJJ A;  4KNJ A;  2FNM A;  8CA2 A;  3EFT A;  5SZ4 A;  1TEU X;  4LP6 A;  4QJ0 A;  3VBD A;  5JGS B;  1YO2 A;  2X7S A;  1ZSC A;  5SZ3 A;  2VVA X;  3BET A;  4JSZ A;  4JS6 A;  4MLT A;  4N16 A;  4WUQ A;  3T5U A;  1I90 A;  4PYX A;  2CBC A;  1TBT X;  5FNG A;  3TVN X;  3DCC A;  4FIK A;  4RUY A;  5FLS A;  4HEZ A;  3IAI A;  3S72 B;  4YGF A;  2WEG A;  1IF6 A;  1CAO A;  1DMY A;  4K0Z A;  5DSR A;  3RYV B;  1YO0 A;  3UYQ A;  1I91 A;  2FMG A;  4QIZ A;  1BNT A;  1BNW A;  1UGD A;  4LU3 A;  3PYK A;  1FQL A;  3P4V A;  1DCA A;  4FL7 A;  4YHA A;  1CIN A;  1CRM A;  4FVO A;  2FNN A;  1HED A;  4WR7 A;  3FE4 A;  3S73 B;  1CAN A;  3D9Z A;  1CA2 A;  4K1Q A;  4JSA A;  5E2S A;  2WD3 A;  3ZNC A;  4FU5 A;  1YO1 A;  3V7X A;  2H4N A;  4R5A A;  3U47 A;  2FOS A;  3IBL A;  1JV0 A;  1FQN A;  1LG5 A;  2Q38 A;  1IF4 A;  3K7K A;  3PO6 A;  5DSM A;  2NN1 A;  3HFP A;  4G0C A;  1CNC A;  1G1D A;  1A42 A;  4KUY A;  4QSB A;  1BNM A;  4Q90 A;  4Q07 A;  3S77 B;  4Y0J A;  1IF5 A;  4BCW A;  1DCB A;  3M1W A;  1FSQ A;  1CAZ A;  2NWZ A;  3OYQ A;  4Q6D A;  3U3A X;  5CA2 A;  1EOU A;  1CNY A;  3D0N A;  3F8E A;  1F2W A;  3S9T A;  1RZA A;  3OIL A;  3S76 A;  4CNR A;  4YX4 A;  1V9E A;  5FDC A;  3SAP A;  4ILX A;  1YDA A;  5CJF A;  5FL4 A;  1CIL A;  4QK3 A;  2FMZ A;  1MOO A;  4L5U A;  3DV7 A;  1H9N A;  4RFD A; 
#chains in the Genus database with same CATH topology
 1J9W A;  4XE1 A;  3IBI A;  3IEO A;  3RZ0 B;  2WEH A;  3ZP9 A;  3DAZ A;  1CZM A;  2H15 A;  1Z9Y A;  3F7B A;  4WUP A;  3DCS A;  3OY0 A;  4CNX A;  3Q31 A;  1KEQ A;  1CVB A;  2AW1 A;  5JEH B;  5EH8 A;  3M67 A;  3M98 A;  4KNI A;  4YGL A;  2Q1Q A;  1CNG A;  4TWL A;  5JQ0 A;  5BRV A;  3R16 A;  3R17 B;  3RYX B;  2WEO A;  5BRU A;  3MYQ A;  3KS3 A;  4Q6E A;  1CAY A;  4KV0 A;  4WW6 A;  3S78 B;  4Z1N A;  7CA2 A;  1KWQ A;  5SZ0 A;  1CRA A;  1CVH A;  2NNO A;  3M5S A;  1V9I C;  3NJ9 A;  2QP6 A;  4Q08 A;  4XZ5 A;  5SZ1 A;  4Q7W A;  4K13 A;  3MHI A;  1BNV A;  5DVX A;  2OSM A;  1T9N A;  2EU2 A;  1BZM A;  5EIJ A;  1IF8 A;  4MDG A;  1RAY A;  4QK2 A;  1TG9 A;  1CVC A;  4DZ9 A;  1RZB A;  2EZ7 A;  4YGK A;  3V3I B;  3RZ8 A;  1HEA A;  4RH2 A;  3IGP A;  3M40 A;  5BYI A;  1CAM A;  3KOI A;  4KNM A;  4XIX A;  3T85 A;  4L5V A;  4KP8 A;  3M3X A;  1JD0 A;  4QEF A;  4E3G A;  3RZ1 B;  3D93 A;  1IF9 A;  2HD6 A;  3U45 X;  1LZV A;  2NXS A;  3JXF A;  4K0T A;  2HOC A;  1IF7 A;  5J8Z A;  3C7P A;  4ZWI A;  1G54 A;  5EZT X;  5LMD A;  12CA A;  1KOQ A;  5FL5 A;  5E5U A;  2NXR A;  3DA2 A;  3M2Y A;  3MNA A;  3OKU A;  5DSQ A;  4ITO A;  1XPZ A;  4CQ0 A;  5JEG B;  3T83 A;  1CAJ A;  1G4O A;  2AX2 A;  1HEC A;  2CA2 A;  2WEJ A;  1Y7W A;  5JG5 B;  4E3D A;  5FNL A;  4C3T A;  4PQ7 A;  2CBA A;  1AM6 A;  5E2M A;  1I8Z A;  5FLO A;  1G52 A;  3M2N A;  1LGD A;  1H4N A;  4QSA A;  1BN4 A;  4XIW A;  3P5L A;  3W6H A;  1LG6 A;  2FW4 A;  1HVA A;  4L5W A;  5EOI A;  4Q81 A;  4QIY A;  4QTL A;  5FL6 A;  3P3H A;  3MHM A;  3OIK A;  4IWZ A;  1CCT A;  2ILI A;  2X7U A;  3RZ7 A;  3P58 A;  1CVA A;  1CCU A;  4CA2 A;  5DOG A;  3S8X A;  3MHO A;  4Q8Z A;  5JG3 B;  4KNN A;  5EHE A;  5FNM A;  1KWR A;  4KP5 A;  4YXU A;  3GZ0 A;  2HKK A;  5CAC A;  4MDM A;  4HEW A;  1MUA A;  4RUZ A;  5FNJ A;  4ZX1 A;  4Q0L A;  4Q78 A;  4RUX A;  3KWA A;  1TEQ X;  4CNV A;  3N0N A;  1AVN A;  3RG3 A;  1CNH A;  3KKX A;  5E2N A;  1FQM A;  3HKU A;  4ZWZ A;  1G0E A;  4DZ7 A;  4K0S A;  4MDL A;  4XFW A;  1RJ5 A;  4LHI A;  3RYY A;  1I9M A;  4WL4 A;  4YXO A;  1FSN A;  2NN7 A;  1I9P A;  3RZ5 A;  1CNJ A;  1LUG A;  1RJ6 A;  4JSW A;  4Q7S A;  2POW A;  5HPJ A;  2NNG A;  3M14 A;  2NNV A;  4ITP A;  1CVD A;  5DSL A;  4KAP A;  1UGA A;  4COQ A;  4PYY A;  4Z1K A;  1CAI A;  1CAH A;  4KUV A;  3T82 A;  4Q49 A;  1THK A;  1I9O A;  1YDD A;  5A25 A;  1Z93 A;  1ZSA A;  3M96 A;  3MNU A;  1CNB A;  2NWO A;  1FR4 A;  5G0B A;  3V3G B;  1Z97 A;  5FLP A;  3HKQ A;  4E3F A;  2VVB X;  3L14 A;  2ABE A;  3DC3 A;  3S71 B;  1URT A;  5SZ6 A;  2GEH A;  1G46 A;  3KNE A;  4RN4 A;  5L3O A;  5G0C A;  1CVE A;  3N2P A;  5G01 A;  1I9Q A;  3LXE A;  4FVN A;  1CNW A;  4HT2 A;  3DVD A;  3M1J A;  5EHV A;  5EKM A;  4E49 A;  2F14 A;  1ZGF A;  1I9L A;  3B1B A;  4ETQ C;  3SAX A;  4CNW A;  4Q09 A;  4E5Q A;  1HCB A;  5DSP A;  5SZ2 A;  1BNU A;  4Q7P A;  1HUG A;  3DD8 A;  1XEV A;  2POU A;  4IDR X;  2X7T A;  3MNH A;  1ZFQ A;  2FOQ A;  4QSI A;  4Q9Y A;  1G4J A;  4M2W A;  4RIU A;  3B4F A;  1CNK A;  1G48 A;  1HEB A;  5EH5 A;  5DRS A;  1BNQ A;  1CAL A;  3T84 A;  4HEY A;  1BN1 A;  1ZSB A;  2CBE A;  2IT4 A;  4QJO A;  4MO8 A;  1ZE8 A;  1G0F A;  2NNS A;  4BF1 A;  4Q8Y A;  3RYJ B;  5EKH A;  2POV A;  4HT0 A;  3DC9 A;  4E3H A;  4YGJ A;  5FNH A;  3M5E A;  3CAJ A;  1FQR A;  4RIV A;  3P3J A;  3FW3 A;  4RFC A;  5A6H A;  2FOV A;  4Q87 A;  5JES B;  1BN3 A;  1OQ5 A;  3HS4 A;  3DCW A;  1TTM A;  2WD2 A;  3M5T A;  4KUW A;  4R59 A;  3JXH C;  1G6V A;  2HL4 A;  3K2F A;  4YVY A;  4YYT A;  5FDI A;  9CA2 A;  2Q1B A;  1G45 A;  3DVB A;  4FRC A;  3D92 A;  1OKN A;  4Q06 A;  3S74 B;  3W6I A;  1TB0 X;  1DMX A;  3CA2 A;  2W2J A;  3DBU A;  1OKL A;  1UGB A;  3SBH A;  3MMF A;  3OYS A;  4Z0Q A;  1HUH A;  5BRW A;  1FSR A;  3JXG A;  2EU3 A;  3UYN A;  3TVO X;  5L6K A;  5SZ7 A;  4QJP A;  2NWP A;  2ZNC A;  3MNJ A;  4QSJ A;  1UGG A;  4M2R A;  4QJM A;  4PXX A;  3K34 A;  3MHC A;  1ZGE A;  5JGT B;  1G3Z A;  3M2Z A;  3D8W A;  2GD8 A;  4QK1 A;  3N3J A;  1FR7 A;  2FOU A;  3QYK A;  5FLT A;  3SBI A;  3V3F A;  4GL1 X;  5BNL A;  4HF3 A;  3KON A;  4FPT A;  4M2V A;  4YXI A;  1I9N A;  4QJX A;  2CBB A;  4UOV A;  3NI5 A;  4YWP A;  1XQ0 A;  1KOP A;  3NB5 A;  3HLJ A;  4BF6 A;  5AML A;  5JQT A;  3M1Q A;  3T5Z A;  4HU1 A;  5AMD A;  3RLD A;  3RYZ A;  5FNK A;  3F4X A;  3RGE A;  2CAB A;  1H9Q A;  1CNX A;  3IBU A;  3P55 A;  5AMG A;  3MNK A;  4Z1J A;  3OIM A;  2HFW A;  3V2M A;  3U7C A;  3CZV A;  1UGF A;  3V3J A;  4Q8X A;  3M1K A;  5FLQ A;  1RZE A;  2FOY A;  4N0X B;  1CAK A;  3MDZ A;  3N4B A;  1OKM A;  6CA2 A;  4ZAO A;  4M2U A;  3RG4 A;  5IPZ A;  2FNK A;  3HKT A;  5E2K A;  5DSJ A;  1JCZ A;  1FLJ A;  3KOK A;  4Q99 A;  4ZWY A;  1G53 A;  3EFI A;  1CA3 A;  1YDB A;  3KIG A;  2NWY A;  3CYU A;  1ZFK A;  1BV3 A;  4YGN A;  5G03 A;  1RZD A;  3BL1 A;  3M04 A;  5FNI A;  2OSF A;  4JSS A;  1ZH9 A;  4MLX A;  4G7A A;  4ZWX A;  3S97 A;  3ML2 A;  1UGE A;  1TH9 A;  5E28 A;  4TWM A;  5JDV B;  4E4A A;  1YDC A;  3S75 B;  5E5R A;  1UGC A;  3DD0 A;  1CIM A;  3P44 A;  1AZM A;  1HCA A;  2QOA A;  1CVF A;  3FFP X;  3ML5 A;  3HKN A;  4X5S A;  3V2J A;  4QY3 A;  5DOH A;  4QJW A;  1TE3 X;  2CBD A;  5SZ5 A;  4CAC A;  1TG3 A;  1CNI A;  5FLR A;  3F7U A;  2QO8 A;  4WW8 A;  4ZX0 A;  4Q7V A;  3MNI A;  4R5B A;  5EH7 A;  4MTY A;  5EHW A;  5JEP B;  1BNN A;  4E9O X;  4HBA A;  2HNC A;  3MZC A;  5DSK A;  5EKJ A;  1BIC A;  3MHL A;  1CCS A;  5C8I A;  5DSI A;  5E2R A;  3IBN A;  2NXT A;  1BCD A;  3OKV A;  3P5A A;  3V5G A;  4PZH A;  1XEG A;  4Q83 A;  3RJ7 A;  3V3H B;  3TMJ A;  3MWO A;  5CLU A;  3BL0 A;  1RZC A;  3M2X A;  5DSO A;  3DVC A;  1RAZ A;  1ZNC A;  3KLD B;  5DSN A;  4Z1E A;  2NMX A;  2O4Z A;  3PJJ A;  4KNJ A;  2FNM A;  8CA2 A;  3EFT A;  5SZ4 A;  1TEU X;  4LP6 A;  4QJ0 A;  3VBD A;  5JGS B;  1YO2 A;  2X7S A;  1ZSC A;  5SZ3 A;  2VVA X;  3BET A;  4JSZ A;  4JS6 A;  4MLT A;  4N16 A;  4WUQ A;  3T5U A;  1I90 A;  4PYX A;  2CBC A;  1TBT X;  5FNG A;  3TVN X;  3DCC A;  4FIK A;  4RUY A;  5FLS A;  4HEZ A;  3IAI A;  3S72 B;  4YGF A;  2WEG A;  1IF6 A;  1CAO A;  1DMY A;  4K0Z A;  5DSR A;  3RYV B;  1YO0 A;  3UYQ A;  1I91 A;  2FMG A;  4QIZ A;  1BNT A;  1BNW A;  1UGD A;  4LU3 A;  3PYK A;  1FQL A;  3P4V A;  1DCA A;  4FL7 A;  4YHA A;  1CIN A;  1CRM A;  4FVO A;  2FNN A;  1HED A;  4WR7 A;  3FE4 A;  3S73 B;  1CAN A;  3D9Z A;  1CA2 A;  4K1Q A;  4JSA A;  5E2S A;  2WD3 A;  3ZNC A;  4FU5 A;  1YO1 A;  3V7X A;  2H4N A;  4R5A A;  3U47 A;  2FOS A;  3IBL A;  1JV0 A;  1FQN A;  1LG5 A;  2Q38 A;  1IF4 A;  3K7K A;  3PO6 A;  5DSM A;  2NN1 A;  3HFP A;  4G0C A;  1CNC A;  1G1D A;  1A42 A;  4KUY A;  4QSB A;  1BNM A;  4Q90 A;  4Q07 A;  3S77 B;  4Y0J A;  1IF5 A;  4BCW A;  1DCB A;  3M1W A;  1FSQ A;  1CAZ A;  2NWZ A;  3OYQ A;  4Q6D A;  3U3A X;  5CA2 A;  1EOU A;  1CNY A;  3D0N A;  3F8E A;  1F2W A;  3S9T A;  1RZA A;  3OIL A;  3S76 A;  4CNR A;  4YX4 A;  1V9E A;  5FDC A;  3SAP A;  4ILX A;  1YDA A;  5CJF A;  5FL4 A;  1CIL A;  4QK3 A;  2FMZ A;  1MOO A;  4L5U A;  3DV7 A;  1H9N A;  4RFD A; 
#chains in the Genus database with same CATH homology
 1J9W A;  4XE1 A;  3IBI A;  3IEO A;  3RZ0 B;  2WEH A;  3ZP9 A;  3DAZ A;  1CZM A;  2H15 A;  1Z9Y A;  3F7B A;  4WUP A;  3DCS A;  3OY0 A;  4CNX A;  3Q31 A;  1KEQ A;  1CVB A;  2AW1 A;  5JEH B;  5EH8 A;  3M67 A;  3M98 A;  4KNI A;  4YGL A;  2Q1Q A;  1CNG A;  4TWL A;  5JQ0 A;  5BRV A;  3R16 A;  3R17 B;  3RYX B;  2WEO A;  5BRU A;  3MYQ A;  3KS3 A;  4Q6E A;  1CAY A;  4KV0 A;  4WW6 A;  3S78 B;  4Z1N A;  7CA2 A;  1KWQ A;  5SZ0 A;  1CRA A;  1CVH A;  2NNO A;  3M5S A;  1V9I C;  3NJ9 A;  2QP6 A;  4Q08 A;  4XZ5 A;  5SZ1 A;  4Q7W A;  4K13 A;  3MHI A;  1BNV A;  5DVX A;  2OSM A;  1T9N A;  2EU2 A;  1BZM A;  5EIJ A;  1IF8 A;  4MDG A;  1RAY A;  4QK2 A;  1TG9 A;  1CVC A;  4DZ9 A;  1RZB A;  2EZ7 A;  4YGK A;  3V3I B;  3RZ8 A;  1HEA A;  4RH2 A;  3IGP A;  3M40 A;  5BYI A;  1CAM A;  3KOI A;  4KNM A;  4XIX A;  3T85 A;  4L5V A;  4KP8 A;  3M3X A;  1JD0 A;  4QEF A;  4E3G A;  3RZ1 B;  3D93 A;  1IF9 A;  2HD6 A;  3U45 X;  1LZV A;  2NXS A;  3JXF A;  4K0T A;  2HOC A;  1IF7 A;  5J8Z A;  3C7P A;  4ZWI A;  1G54 A;  5EZT X;  5LMD A;  12CA A;  1KOQ A;  5FL5 A;  5E5U A;  2NXR A;  3DA2 A;  3M2Y A;  3MNA A;  3OKU A;  5DSQ A;  4ITO A;  1XPZ A;  4CQ0 A;  5JEG B;  3T83 A;  1CAJ A;  1G4O A;  2AX2 A;  1HEC A;  2CA2 A;  2WEJ A;  1Y7W A;  5JG5 B;  4E3D A;  5FNL A;  4C3T A;  4PQ7 A;  2CBA A;  1AM6 A;  5E2M A;  1I8Z A;  5FLO A;  1G52 A;  3M2N A;  1LGD A;  1H4N A;  4QSA A;  1BN4 A;  4XIW A;  3P5L A;  3W6H A;  1LG6 A;  2FW4 A;  1HVA A;  4L5W A;  5EOI A;  4Q81 A;  4QIY A;  4QTL A;  5FL6 A;  3P3H A;  3MHM A;  3OIK A;  4IWZ A;  1CCT A;  2ILI A;  2X7U A;  3RZ7 A;  3P58 A;  1CVA A;  1CCU A;  4CA2 A;  5DOG A;  3S8X A;  3MHO A;  4Q8Z A;  5JG3 B;  4KNN A;  5EHE A;  5FNM A;  1KWR A;  4KP5 A;  4YXU A;  3GZ0 A;  2HKK A;  5CAC A;  4MDM A;  4HEW A;  1MUA A;  4RUZ A;  5FNJ A;  4ZX1 A;  4Q0L A;  4Q78 A;  4RUX A;  3KWA A;  1TEQ X;  4CNV A;  3N0N A;  1AVN A;  3RG3 A;  1CNH A;  3KKX A;  5E2N A;  1FQM A;  3HKU A;  4ZWZ A;  1G0E A;  4DZ7 A;  4K0S A;  4MDL A;  4XFW A;  1RJ5 A;  4LHI A;  3RYY A;  1I9M A;  4WL4 A;  4YXO A;  1FSN A;  2NN7 A;  1I9P A;  3RZ5 A;  1CNJ A;  1LUG A;  1RJ6 A;  4JSW A;  4Q7S A;  2POW A;  5HPJ A;  2NNG A;  3M14 A;  2NNV A;  4ITP A;  1CVD A;  5DSL A;  4KAP A;  1UGA A;  4COQ A;  4PYY A;  4Z1K A;  1CAI A;  1CAH A;  4KUV A;  3T82 A;  4Q49 A;  1THK A;  1I9O A;  1YDD A;  5A25 A;  1Z93 A;  1ZSA A;  3M96 A;  3MNU A;  1CNB A;  2NWO A;  1FR4 A;  5G0B A;  3V3G B;  1Z97 A;  5FLP A;  3HKQ A;  4E3F A;  2VVB X;  3L14 A;  2ABE A;  3DC3 A;  3S71 B;  1URT A;  5SZ6 A;  2GEH A;  1G46 A;  3KNE A;  4RN4 A;  5L3O A;  5G0C A;  1CVE A;  3N2P A;  5G01 A;  1I9Q A;  3LXE A;  4FVN A;  1CNW A;  4HT2 A;  3DVD A;  3M1J A;  5EHV A;  5EKM A;  4E49 A;  2F14 A;  1ZGF A;  1I9L A;  3B1B A;  4ETQ C;  3SAX A;  4CNW A;  4Q09 A;  4E5Q A;  1HCB A;  5DSP A;  5SZ2 A;  1BNU A;  4Q7P A;  1HUG A;  3DD8 A;  1XEV A;  2POU A;  4IDR X;  2X7T A;  3MNH A;  1ZFQ A;  2FOQ A;  4QSI A;  4Q9Y A;  1G4J A;  4M2W A;  4RIU A;  3B4F A;  1CNK A;  1G48 A;  1HEB A;  5EH5 A;  5DRS A;  1BNQ A;  1CAL A;  3T84 A;  4HEY A;  1BN1 A;  1ZSB A;  2CBE A;  2IT4 A;  4QJO A;  4MO8 A;  1ZE8 A;  1G0F A;  2NNS A;  4BF1 A;  4Q8Y A;  3RYJ B;  5EKH A;  2POV A;  4HT0 A;  3DC9 A;  4E3H A;  4YGJ A;  5FNH A;  3M5E A;  3CAJ A;  1FQR A;  4RIV A;  3P3J A;  3FW3 A;  4RFC A;  5A6H A;  2FOV A;  4Q87 A;  5JES B;  1BN3 A;  1OQ5 A;  3HS4 A;  3DCW A;  1TTM A;  2WD2 A;  3M5T A;  4KUW A;  4R59 A;  3JXH C;  1G6V A;  2HL4 A;  3K2F A;  4YVY A;  4YYT A;  5FDI A;  9CA2 A;  2Q1B A;  1G45 A;  3DVB A;  4FRC A;  3D92 A;  1OKN A;  4Q06 A;  3S74 B;  3W6I A;  1TB0 X;  1DMX A;  3CA2 A;  2W2J A;  3DBU A;  1OKL A;  1UGB A;  3SBH A;  3MMF A;  3OYS A;  4Z0Q A;  1HUH A;  5BRW A;  1FSR A;  3JXG A;  2EU3 A;  3UYN A;  3TVO X;  5L6K A;  5SZ7 A;  4QJP A;  2NWP A;  2ZNC A;  3MNJ A;  4QSJ A;  1UGG A;  4M2R A;  4QJM A;  4PXX A;  3K34 A;  3MHC A;  1ZGE A;  5JGT B;  1G3Z A;  3M2Z A;  3D8W A;  2GD8 A;  4QK1 A;  3N3J A;  1FR7 A;  2FOU A;  3QYK A;  5FLT A;  3SBI A;  3V3F A;  4GL1 X;  5BNL A;  4HF3 A;  3KON A;  4FPT A;  4M2V A;  4YXI A;  1I9N A;  4QJX A;  2CBB A;  4UOV A;  3NI5 A;  4YWP A;  1XQ0 A;  1KOP A;  3NB5 A;  3HLJ A;  4BF6 A;  5AML A;  5JQT A;  3M1Q A;  3T5Z A;  4HU1 A;  5AMD A;  3RLD A;  3RYZ A;  5FNK A;  3F4X A;  3RGE A;  2CAB A;  1H9Q A;  1CNX A;  3IBU A;  3P55 A;  5AMG A;  3MNK A;  4Z1J A;  3OIM A;  2HFW A;  3V2M A;  3U7C A;  3CZV A;  1UGF A;  3V3J A;  4Q8X A;  3M1K A;  5FLQ A;  1RZE A;  2FOY A;  4N0X B;  1CAK A;  3MDZ A;  3N4B A;  1OKM A;  6CA2 A;  4ZAO A;  4M2U A;  3RG4 A;  5IPZ A;  2FNK A;  3HKT A;  5E2K A;  5DSJ A;  1JCZ A;  1FLJ A;  3KOK A;  4Q99 A;  4ZWY A;  1G53 A;  3EFI A;  1CA3 A;  1YDB A;  3KIG A;  2NWY A;  3CYU A;  1ZFK A;  1BV3 A;  4YGN A;  5G03 A;  1RZD A;  3BL1 A;  3M04 A;  5FNI A;  2OSF A;  4JSS A;  1ZH9 A;  4MLX A;  4G7A A;  4ZWX A;  3S97 A;  3ML2 A;  1UGE A;  1TH9 A;  5E28 A;  4TWM A;  5JDV B;  4E4A A;  1YDC A;  3S75 B;  5E5R A;  1UGC A;  3DD0 A;  1CIM A;  3P44 A;  1AZM A;  1HCA A;  2QOA A;  1CVF A;  3FFP X;  3ML5 A;  3HKN A;  4X5S A;  3V2J A;  4QY3 A;  5DOH A;  4QJW A;  1TE3 X;  2CBD A;  5SZ5 A;  4CAC A;  1TG3 A;  1CNI A;  5FLR A;  3F7U A;  2QO8 A;  4WW8 A;  4ZX0 A;  4Q7V A;  3MNI A;  4R5B A;  5EH7 A;  4MTY A;  5EHW A;  5JEP B;  1BNN A;  4E9O X;  4HBA A;  2HNC A;  3MZC A;  5DSK A;  5EKJ A;  1BIC A;  3MHL A;  1CCS A;  5C8I A;  5DSI A;  5E2R A;  3IBN A;  2NXT A;  1BCD A;  3OKV A;  3P5A A;  3V5G A;  4PZH A;  1XEG A;  4Q83 A;  3RJ7 A;  3V3H B;  3TMJ A;  3MWO A;  5CLU A;  3BL0 A;  1RZC A;  3M2X A;  5DSO A;  3DVC A;  1RAZ A;  1ZNC A;  3KLD B;  5DSN A;  4Z1E A;  2NMX A;  2O4Z A;  3PJJ A;  4KNJ A;  2FNM A;  8CA2 A;  3EFT A;  5SZ4 A;  1TEU X;  4LP6 A;  4QJ0 A;  3VBD A;  5JGS B;  1YO2 A;  2X7S A;  1ZSC A;  5SZ3 A;  2VVA X;  3BET A;  4JSZ A;  4JS6 A;  4MLT A;  4N16 A;  4WUQ A;  3T5U A;  1I90 A;  4PYX A;  2CBC A;  1TBT X;  5FNG A;  3TVN X;  3DCC A;  4FIK A;  4RUY A;  5FLS A;  4HEZ A;  3IAI A;  3S72 B;  4YGF A;  2WEG A;  1IF6 A;  1CAO A;  1DMY A;  4K0Z A;  5DSR A;  3RYV B;  1YO0 A;  3UYQ A;  1I91 A;  2FMG A;  4QIZ A;  1BNT A;  1BNW A;  1UGD A;  4LU3 A;  3PYK A;  1FQL A;  3P4V A;  1DCA A;  4FL7 A;  4YHA A;  1CIN A;  1CRM A;  4FVO A;  2FNN A;  1HED A;  4WR7 A;  3FE4 A;  3S73 B;  1CAN A;  3D9Z A;  1CA2 A;  4K1Q A;  4JSA A;  5E2S A;  2WD3 A;  3ZNC A;  4FU5 A;  1YO1 A;  3V7X A;  2H4N A;  4R5A A;  3U47 A;  2FOS A;  3IBL A;  1JV0 A;  1FQN A;  1LG5 A;  2Q38 A;  1IF4 A;  3K7K A;  3PO6 A;  5DSM A;  2NN1 A;  3HFP A;  4G0C A;  1CNC A;  1G1D A;  1A42 A;  4KUY A;  4QSB A;  1BNM A;  4Q90 A;  4Q07 A;  3S77 B;  4Y0J A;  1IF5 A;  4BCW A;  1DCB A;  3M1W A;  1FSQ A;  1CAZ A;  2NWZ A;  3OYQ A;  4Q6D A;  3U3A X;  5CA2 A;  1EOU A;  1CNY A;  3D0N A;  3F8E A;  1F2W A;  3S9T A;  1RZA A;  3OIL A;  3S76 A;  4CNR A;  4YX4 A;  1V9E A;  5FDC A;  3SAP A;  4ILX A;  1YDA A;  5CJF A;  5FL4 A;  1CIL A;  4QK3 A;  2FMZ A;  1MOO A;  4L5U A;  3DV7 A;  1H9N A;  4RFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...