The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
19
|
sequence length |
139
|
structure length |
133
|
Chain Sequence |
AQNTISGKEGRLFLDGEEMAHIKTFEANVEKNKSEVNIMGRRMTGHKTTGANGTGTATFYKVTSKFVLLMMDYVKKGSDPYFTLQAVLDDQSSGRGTERVTLYDVNFDSAKIASLDEEEVPFTFEDFDVPEKL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Structural genomics, unknown function
|
source organism |
Bacillus subtilis
|
publication title |
Three dimensional structure of the protein P54332 from Bacillus Subtilis. Northeast Structural Genomics Consortium target sr353.
rcsb |
molecule keywords |
Phage-like element PBSX protein xkdM
|
total genus |
19
|
structure length |
133
|
sequence length |
139
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2006-04-30 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF09393 | DUF2001 | Phage tail tube protein |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Roll | Pnp Oxidase; Chain A | Pnp Oxidase; Chain A |
#chains in the Genus database with same CATH superfamily 2GUJ A; #chains in the Genus database with same CATH topology 3R5R A; 3R5Y A; 2FUR A; 1TY9 A; 4F07 A; 3HY8 A; 4YWN A; 2R0X A; 2ECU A; 1RZ0 A; 4UHV A; 4W64 A; 3U35 A; 3EAA A; 3E4V A; 3FKH A; 3V4H A; 2X1J A; 1RZ1 A; 3ZOF A; 1XHN A; 2NR4 A; 3DB0 A; 3ZOD A; 3A6Q A; 3VY2 A; 3KYF A; 2AQ6 A; 3B5M A; 3EC6 A; 3AMF A; 2ECR A; 3HMZ A; 1YLN A; 2D36 A; 4Z85 A; 1WLK A; 2ED4 A; 3VYA A; 1W9A A; 3ZOE A; 3NFW A; 1W3R A; 3CP3 A; 4HKH A; 4HMV A; 1I0R A; 5JAB A; 2PTF A; 2I02 A; 2IAB A; 4L82 A; 2FG9 A; 2QCK A; 4HMX A; 3RH7 A; 1WV4 A; 3R5Z A; 2VPA A; 2K4Q A; 5CHE C; 2HQ9 A; 2ARZ A; 4HX6 A; 4HMS A; 2R6V A; 3A6R A; 3A20 A; 1JNW A; 3ZOG A; 1I0S A; 1G79 A; 1WLI A; 2D38 A; 1YOA A; 3KYG A; 1G78 A; 4HMT A; 3U34 A; 2HHZ A; 4YBN A; 1AXJ A; 4MTK A; 3CB0 A; 2D5M A; 4QVB A; 2X1K A; 3H96 A; 3SWJ A; 1USC A; 1W3O A; 2FHQ A; 5CHO A; 3DMB A; 3FGE A; 4Y9I A; 1CI0 A; 2OL5 A; 4XHY A; 1Y30 A; 4HMU A; 4XJ2 A; 3DNH A; 2ASF A; 2GUJ A; 4IRA A; 3TGV A; 3VY5 A; 3K87 A; 5BNC A; 1XXO A; 2QEA A; 1Y12 A; 2A2J A; 2E83 A; 4N7R C; 1EJE A; 2OU5 A; 2HTI A; 2RE7 A; 3R5W A; 1FLM A; 2D37 A; 1DNL A; 3F7E A; 1WGB A; 3U5W A; 3ZOC A; 4HMW A; 3HE1 A; 2Q9K A; 4TV4 A; 2HQ7 A; 1W3P A; 3BNK A; 3BA3 A; 3GAS A; 5ESC A; 2RDE A; 1USF A; 3BPK A; 4ZKY A; 1VL7 A; 3U0I A; 3ZOH A; 2GJG A; 1W3Q A; 1NRG A; 2IML A; 3PFT A; 3AWH A; 3R5L A; 3K86 A; 2L1T A; 3R5P A; 4R82 A; 3K88 A; 1G76 A; 2IG6 A; 1G77 A; 1T9M A; 2P5Z X; 3IN6 A; 2HTD A; 2I51 A; 1RFE A; #chains in the Genus database with same CATH homology 2L1T A; 2GUJ A; 2P5Z X; 4MTK A; 2K4Q A; 4UHV A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...