The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
37
|
sequence length |
167
|
structure length |
147
|
Chain Sequence |
ATPAYMSITGTKQGLITAGAFTEDSVGNTYQEGHEDQVMVQGFNHEVIIPRVHKPVVITKVFDKASPLLLAALTSGERLTKVEIQWYRTSAAGTQEHYYTTVLEDAIIVDIKDYMHFTHLEDVHFTYRKITWTHEVSGTSGSDDWRS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Structural genomics, unknown function
|
molecule keywords |
Major exported Hcp3 protein
|
publication title |
Crystal structure of secretory protein Hcp3 from Pseudomonas aeruginosa.
pubmed doi rcsb |
source organism |
Pseudomonas aeruginosa
|
total genus |
37
|
structure length |
147
|
sequence length |
167
|
chains with identical sequence |
B, C, D, E, F
|
ec nomenclature | |
pdb deposition date | 2009-05-07 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF05638 | T6SS_HCP | Type VI secretion system effector, Hcp |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Roll | Pnp Oxidase; Chain A | Hcp1-like |
#chains in the Genus database with same CATH superfamily 4HKH A; 4W64 A; 3HE1 A; 1Y12 A; 3EAA A; 4TV4 A; 3V4H A; #chains in the Genus database with same CATH topology 1RZ0 A; 2HQ7 A; 2RE7 A; 2HTD A; 3HY8 A; 1JNW A; 4QVB A; 3HE1 A; 5BNC A; 2FG9 A; 3FKH A; 2ECU A; 2ASF A; 3R5P A; 1W3P A; 2I02 A; 3AMF A; 2E83 A; 5JAB A; 1WV4 A; 1I0S A; 2NR4 A; 5CHO A; 2ECR A; 2QEA A; 4YBN A; 2GJG A; 2PTF A; 4Y9I A; 1EJE A; 4HMU A; 2OU5 A; 4N7R C; 1W3Q A; 2OL5 A; 2D37 A; 1RZ1 A; 2ARZ A; 4HX6 A; 1G78 A; 2X1K A; 2FHQ A; 2QCK A; 3V4H A; 3VY2 A; 2D36 A; 3ZOF A; 1W3R A; 4XJ2 A; 4HMX A; 3VYA A; 2Q9K A; 1AXJ A; 1FLM A; 3ZOD A; 1USC A; 3ZOH A; 1T9M A; 2RDE A; 3U35 A; 1G76 A; 4ZKY A; 3ZOE A; 1Y12 A; 3EAA A; 1W3O A; 3R5Z A; 4MTK A; 1XHN A; 1WLK A; 2R6V A; 2IML A; 3EC6 A; 1CI0 A; 1G79 A; 4HMV A; 4UHV A; 2L1T A; 4XHY A; 1W9A A; 3TGV A; 3A6R A; 3B5M A; 5ESC A; 3BA3 A; 3CP3 A; 2D38 A; 2GUJ A; 4HMS A; 4R82 A; 4Z85 A; 1G77 A; 4TV4 A; 2AQ6 A; 4HMT A; 2VPA A; 3A6Q A; 3K86 A; 3R5Y A; 1WGB A; 2R0X A; 3BPK A; 4L82 A; 4F07 A; 3DB0 A; 3HMZ A; 3ZOG A; 4HMW A; 3DNH A; 3BNK A; 1YOA A; 3H96 A; 1Y30 A; 1VL7 A; 2IAB A; 3E4V A; 2HQ9 A; 2I51 A; 3AWH A; 4YWN A; 2ED4 A; 3R5W A; 3PFT A; 3U5W A; 2K4Q A; 3K87 A; 1DNL A; 3NFW A; 1NRG A; 3DMB A; 3IN6 A; 2HTI A; 2A2J A; 2IG6 A; 3VY5 A; 3CB0 A; 3K88 A; 4HKH A; 3ZOC A; 4IRA A; 3RH7 A; 2FUR A; 3KYF A; 3R5L A; 3FGE A; 2D5M A; 3U0I A; 1YLN A; 1WLI A; 3U34 A; 4W64 A; 5CHE C; 2P5Z X; 2HHZ A; 1USF A; 1XXO A; 2X1J A; 3SWJ A; 3R5R A; 3GAS A; 3F7E A; 3A20 A; 1I0R A; 1TY9 A; 1RFE A; 3KYG A; #chains in the Genus database with same CATH homology 4HKH A; 4W64 A; 3HE1 A; 1Y12 A; 3EAA A; 4TV4 A; 3V4H A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...