2RDEA

Crystal structure of vca0042 complexed with c-di-gmp
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
224
structure length
224
Chain Sequence
VSTINSTDALAMVEHSSELTLSITTPVGTKFVCRTPFIGTHTDKFLLVEMPKISADDLQYFFQEGFWMNIRAISPRGEGALIHFRSQLMHILQEPVPMAFLSIPNTMQVSQLRKEPRFELNLAGKVLFDEHRGDCELRDLSRSGCRFITPPLGKTYQVGDLVALEIFSDLRGTKTFPPLTGKICNLQRSLHHARYGLEFNEEGRNNAKNLLAQLKFNGTKLTLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein VCA0042
publication title The structural basis of cyclic diguanylate signal transduction by PilZ domains.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Structural genomics, unknown function
total genus 42
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07238 PilZ PilZ domain
A PF12945 YcgR_2 Flagellar protein YcgR
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.110.10 Mainly Beta Roll Pnp Oxidase; Chain A Electron Transport, Fmn-binding Protein; Chain A 2rdeA01
2.40.10.220 Mainly Beta Beta Barrel Thrombin, subunit H predicted glycosyltransferase like domains 2rdeA02
5KGOA 4IRAA 2L74A 1YOAA 2D36A 2PTFA 3ZOFA 2FHQA 1AXJA 5ESCA 3U5WA 4RT0A 1WLIA 4HG6A 3DB0A 2ASFA 1G79A 3TGVA 2IMLA 2I02A 3R5LA 1W3OA 2VPAA 3EC6A 3GASA 3NFWA 3H96A 2HQ9A 3DNHA 2I51A 3FGEA 4RT1A 3R5YA 4XJ2A 3ZOHA 4HMUA 1RZ0A 4F48B 3K87A 4Z85A 4P02A 4P00A 1DNLA 3E4VA 1Y30A 3U34A 1NRGA 4QVBA 3PFTA 3DSGA 2HHZA 1G77A 5EIYA 1W3RA 3R5ZA 4HMSA 3ZOEA 3ZODA 1RFEA 1VL7A 3BA3A 4XRNA 4XHYA 2OL5A 2HTIA 3HMZA 2NR4A 3B5MA 1G78A 2X1KA 4Y9IA 4FOUC 3A6RA 1YLNA 5CHOA 1YWUA 1USFA 2HQ7A 1G76A 2QEAA 1WV4A 2D37A 4HMWA 5EJ1A 2FURA 3U35A 4N7RC 3A20A 2IABA 3ZOGA 2X1JA 3HY8A 4HMXA 1W3PA 1EJEA 3BNKA 3A6QA 3R5WA 2ED4A 4HX6A 4YWNA 3VY2A 2RE7A 3CP3A 3K86A 5EJZA 1CI0A 1RZ1A 4HMTA 2ECRA 3AWHA 2D38A 3KYFA 2R6VA 2D5MA 2Q9KA 3F7EA 3VY5A 2ECUA 3VYAA 1I0SA 2E83A 2OU5A 1XXOA 2ARZA 1USCA 4L82A 4I86A 2HTDA 3U0IA 5KEDA 3IN6A 3AMFA 3FKHA 3BPKA 3DMBA 2FG9A 3CNRA 1T9MA 1JNWA 2RDEA 5JABA 3ZOCA 2IG6A 3R5PA 4R82A 4ZKYA 5EJLA 4HMVA 1XHNA 1FLMA 5CHEC 2QCKA 3KYGA 1WLKA 4F07A 2AQ6A 3RH7A 2A2JA 2GJGA 1TY9A 3R5RA 2R0XA 3SWJA 1WGBA 1W3QA 1W9AA 1I0RA 5BNCA 3CB0A 4YBNA 5KECA 3K88A
chains in the Genus database with same CATH superfamily
1AB9B 1QJ7B 4FUEA 5FX6A 3KNXA 1MH0A 1UHBB 1O2NA 4BAKB 3R3GB 4Y76A 1PQ7A 2Y7ZA 8LPRA 3A89A 2ZQ2A 1FIZA 3DB0A 2Y81A 5AFYH 4B2AA 2IMLA 1AIXH 1O5AB 1C2MA 5HXFA 4KTCA 2ZDLA 3WW7A 3GASA 1V2WT 4K2YA 2HQ9A 1DX5M 2FS8A 4MVNA 2FDAA 1PQ5A 1EP6A 4ISIH 3OE7D 3BEIB 3MHWU 4NA8A 3RXFA 1BTPA 1B0FA 1BTXA 4X6PA 2UWLA 4DG4A 2FOHA 1AQ7A 1J17T 2OD3B 1OP8A 1C1RA 4KP0A 4U30A 1G32B 4B76A 4CR5A 1E0FD 4GUXA 1TPSA 1G3DA 5E2OA 3U98H 3NKKA 1TRYA 2BXTH 3BG4C 3LC3A 1NRRH 2BDBA 1UTLM 4CBOA 3E8LA 2ZQ1A 4TYDA 3ZYEA 4X1QU 1O3DA 1C5PA 1ZSJA 3U35A 1BMAA 3VB7A 1TONA 4K5ZA 5CE1A 3LONA 3F1SB 4XE4A 1XUJA 2H9TH 3RC6A 3SGAE 4HMXA 1GBTA 1YC0A 1N1LA 2PP6A 4FVDA 4JZDH 2GZ8A 1EZSC 3LC5A 1KXFA 1S83A 2R3YA 1VR1H 1WCZA 4WH8A 3BTWE 4ISOA 4HMTA 1SHHB 1Z8IB 4IMQA 1XUHA 2QAAA 1DWDH 2CHAB 2PKSC 2GCHG 4RKOB 2P8OC 5C3NA 5F8TA 3PROA 1UK4A 4BANB 1OOKB 1ZTJA 2P94A 3A7XA 3V12A 1LVBA 1O2GH 3MI4A 3OX7U 2FMJA 3PTNA 4TY7A 4Y71A 1ZRBA 4K1TA 1DSTA 4XBCA 2KZ4A 2HWLB 1O3KA 1A5GH 2C8YB 3GY2A 2VWMA 1CBWB 2PFEA 3W95A 3MU8A 1V2ST 2WPIS 1GDQA 2OC0A 1SR5C 1OP0A 1SB1H 1TRNA 2J5UA 3SV2H 2AIQA 3LU9B 3RUOA 3FP7E 3LJOA 1Z7KA 2Z9GA 1CT2E 3SV7A 1WQSA 1NU7B 3RXVA 3EAAA 1J14A 1A1RA 1S6FA 1AWFH 2J98B 2PGQB 2D36A 2K4QA 5C5NA 1QJ1B 2H5CA 1F0TA 1MTNC 1LHCH 4RT0A 1DSUA 2M5TA 2J2UA 2Y5GA 4Y11E 1O2KA 1J8AA 1EJAA 3BIVH 1QRWA 2BD2A 4O3UA 1MU8B 3ZVBA 1FN6A 1HJAB 2QF0A 4Y0ZE 1GJCB 3T2NA 3R5YA 4INLA 1D6RA 4AYVB 3K87A 5LPRA 3RU4D 3GCOA 1J16A 1TIOA 5C1XA 1C5VA 4HFPB 1YLDA 5T6DA 3OEHD 4AC9A 1AUTC 1LQDB 1KLTA 1W10U 1O3OA 1VCQA 3E0PB 3PWCA 3L33A 1DOJA 1NFUA 1KXAA 1HRTH 1UTMA 1W12U 1O2WA 3AVZA 4R0IA 3KF2A 1TBZH 1LCYA 1LMWB 1MBMA 2QEAA 3SYJA 1G76A 4Y8XA 1NBME 3V13A 1D3PB 1S6LA 4A1XA 5C20A 2J92A 2SGPE 2VIPA 1BHXB 4X2XA 2WV9A 2GUJA 1L4DA 1WXRA 4LK4A 4ASHA 2OCVB 4XBBA 1AO5A 4HX6A 2VIVA 2BLWA 1V2PT 3VB6A 2ESTE 1AHTH 2CN0H 1Q2WA 5EPNA 1A0LA 1F0SA 2V3HH 4DW2U 2BM2A 5EJZA 2JJ1D 1NRNH 1COWD 4HTCH 2P16A 3UFAA 2LPRA 2H1UA 2AFQB 3VY5A 2PV9B 3U8RH 2OQ5A 2E83A 1K1OA 3BG8A 3M7QA 3QGNB 1FY5A 1ELVA 1C2EA 5JABA 1IQHA 1QA7A 2FOBA 4K3JA 3FVFB 1UTPA 5EOKA 1W3CA 1T31A 4MNXA 1P9UA 2TRMA 2JKHA 1GBJA 2VGCC 4INKA 3LOXA 2AGIX 3MNBA 1C1WH 2A0QB 1WBGB 4I31A 5EXLA 1ZPBA 3ESTA 4ZKNU 1C5YB 1GHVH 1CA0B 5GXPA 1NC6A 3K9XB 3OTPA 4DVAU 4FUHA 2B0FA 2XBYA 4K1SA 3SUDA 5GCHF 1QL9A 2TGAA 5FBIA 2GV6A 1P2JA 1NRQH 4A5TS 2ZCLP 2YMSB 1O2LA 2F9OA 3KHVA 1E1RD 3U8OH 4YOJA 1BB0B 4K1EA 2ASFA 1G79A 3D49H 1GI7B 5G4BA 3A8BA 4Y8YA 3WY8A 2WHXA 2SFAA 2ANWA 2NU4E 2HGTH 1TOCB 1ELFA 1MZAA 3FGEA 4OM9A 2OXSA 1FY4A 1BTUA 1O33A 2ZU5A 1C1OA 2CMYA 3LDXH 1SHYA 2OUAA 2BY8X 4IC5A 5DP5A 1Z1IA 1T7CA 1C2HA 1KXDA 3A87A 3S69A 1ZZZA 1YPKH 1O2ZA 1LVOA 1YPGH 2JH5D 3PRBA 1UMAH 2BD8A 3TGKE 2ZU3A 4AFSA 1EAWA 1S5SA 2JH6D 1RFNA 2BX3A 3MOCA 1O3IA 1SQTA 4BXWA 2BVSH 1G36A 3S0NA 1BBRK 1GHWH 3ZZBA 3PMJA 3VGCB 1TGCA 1NFWA 4CR9A 4CRDA 3HK6B 1XUGA 1DPOA 1O34A 4YWNA 1ETTH 3F9FA 1XUKA 4DJZB 4GLYA 1QHRB 4Y6DA 2XCNA 1HYLA 1V2MT 2GT7A 2Y5HA 5A0CA 1KTSB 4O3TA 2A7HA 1XXOA 3SI3H 2R0LA 3A7ZA 1PJPA 3AMFA 3KQCA 2FXRA 3CNRA 2AEIH 4XDEA 2GP9B 1GJ7B 3TJOA 4D76A 4CREA 1H9IE 2FM2A 4X8SH 5DP7A 5EODA 2QCKA 2VIDA 3W1EA 5T1VA 2ZKSA 1BTYA 2ZU4A 2EQNA 1XMNB 3ATMA 1ELCA 2FP7B 1W11U 3NWUA 1VITF 1GDNA 2XC5A 1A0HB 3E3TA 1W9AA 1O5GH 3HGNA 2QXIA 2WINI 1HCGA 1SGIB 2O8WA 5C2ZA 1BOQA 1BITA 1GHAF 1GI6A 3QZQA 1EASA 4UFGH 5HM9A 2A32A 1W3OA 3T5FH 1NFYA 1LKAA 1SI5H 2QV1A 4B73A 2HLCA 3LPRA 1K1PA 2W3IA 2I51A 1CGHA 2GVFA 1D9IA 1L4ZA 1RJXB 3Q00A 1VITH 3EA7A 1O2JA 1V2TT 2V6NA 6GCHG 2GDEH 5B6OA 4ZKSU 1Y30A 1GI0A 1O5FH 4HKHA 3DFJA 4JYTA 1G77A 3A7YA 3RXIA 1HB0B 2HOBA 1EZXC 1UJ1A 3PLPA 1LVMA 1F5KU 2H6MA 4NA9H 2YNBA 1HXFH 2PTCE 2BLOA 2IPQX 3M3TA 2D37A 2F4LA 1SKYE 2G5VA 5F53A 4ABGA 2VVCA 2QC2A 1A2CH 5EJ1A 1UCYK 4YLQH 3GCNA 3KIDU 1ARBA 1DT2A 3E6PH 4LOYH 4AFZA 1EPTC 5EU8A 1H8ED 2G51A 1GJ9B 1WSSH 3TIUA 3MH5A 1V6DA 3STIA 2BX4A 4D7FA 1TABE 1TGNA 1C5LH 1ACBE 1MCVA 2FOEA 3M36A 4ZUHA 4VGCB 1EAUA 4CRFA 1BCUH 5B6LA 1F2SE 1MKXK 1ZGVA 2ZNKH 4L82A 3K6ZA 4ABIA 2J9NA 4ZCNA 3S7KB 1DY9A 1P2NA 5EQSA 1YCPK 1ZR0A 2IG6A 2AGEX 3RC4A 2YMSC 1O35A 4XOJA 3UQOA 1IQIA 1W13U 2TBSA 3KQBA 3M37A 1WLKA 2CF9H 2Z3EA 4UHVA 4F07A 2H9HA 4ZXYH 2HNTE 3RH7A 4NFEA 4FVBA 1TNGA 3SOSA 2VJ1A 2WPDD 3BG4B 5C17A 3AASA 1KLIH 1UVUH 1GHXH 1IQEA 5A0AE 3WWBA 1BMNH 4MNYA 1C1NA 2UUJB 5J4SA 1C1PA 2UUFB 4GAWA 4JMYA 1K1MA 1D4PB 3K6YA 3TU7H 1UTKA 1PPBH 3ZVFA 5DJ7A 1O2OA 1NESE 3A7VA 1KXBA 2ANYA 3UR9A 5ESCA 4Y7AA 5A8ZA 3RXMA 3T25A 3E1XB 3P8FA 2BDHA 2FODA 2EY4C 3ZZCA 1JRSA 3SQHE 1KSNA 1DS2E 4F55A 1UHBA 1YLCA 3CS0A 1MD8A 4WF8A 3GDUA 2PKSB 1OWKA 1EKBB 1HJ9A 4ISLA 3ZZ5A 2P8OB 4P02A 1VCWA 2WUBA 3VGCC 1O37A 1SOTA 3MFJA 1C1TA 3Q3XA 4TWYA 3P8GA 4KKDA 2A4GA 1RXPA 3SV6A 2F43B 1F92A 3QGJA 4X8VH 4AYYB 1W14U 3SNBA 1HLTH 3SV9A 1Y59T 2YOLA 2ZGCA 2CGAA 2Z7FE 4DT7B 4YOGA 2KAIB 1CA8B 3KEEA 1AI8H 1KDQB 3A20A 4K60A 1GCTC 1KY9A 2AERH 4TPIZ 2BQWB 1QRXA 1C5WB 1XUFA 2B5TB 2BTCE 2G8TA 4ACAA 3GY6A 4FU9A 5GCHG 3NXPA 1GI2A 3R5WA 1GI4A 4B2CA 3O8CA 1TQ7B 1H8IH 3LGYA 3P6ZB 1MBQA 1HXEH 1TBQH 1UVPA 2R6VA 8GCHF 2PUQH 3MO6A 2AHME 3N7DA 3TNTA 2A4RA 1EZQA 2BLVA 1FQ3A 2P93A 3EE0B 2LELA 1C2LA 3BPKA 1KIGH 2ZGJA 3ZVEA 1T9MA 4A92A 2RDEA 1ZHMA 3DHKH 4F49A 4CHAB 5IK2D 2FEQH 1GBIA 5EJLA 1UVTH 2ZTXA 3O8BA 2ZDMA 1G3CA 2FX4A 1LTOA 1E34B 1FPHH 4Q63A 1G9IE 1P03A 1T8NA 4H4FA 2AQ6A 3URDA 4Y10E 2KCPA 2ZTZA 1TPOA 4O03A 2HRVA 1MZDA 3EGKH 2VWOA 2R2MB 3UR6A 5FBEA 3D62A 2WUCA 4BAMB 2HVYB 1TNIA 1PPCE 1FUJA 5GJ4B 2QF4A 1EJNA 2Z3DA 1RS0A 4OS7A 1KMHB 2KFWA 2J38A 3TJUA 2PTFA 1OWIA 2HALA 1NROH 5F6MA 1WQVH 1GMHF 1GVKB 2ILNA 1C5MD 2C90B 2ZFQH 1DITH 2FOCA 2J98A 1P8VC 1EZUC 3GY4A 3H96A 5DP8A 1F5RA 1SVPA 3GS9A 3SHCH 4ZKRU 1BRBE 1TA6A 3IG6B 2JIZD 1DUAA 5ABWA 2A5IA 5K7RA 2HNTC 3UB0A 3GCHB 3U34A 1SC8U 5SGAE 3OFND 4HMSA 4XFQA 4BTIB 3ZOEA 3ZODA 1LPGB 3A83A 5EW1H 2HTIA 5DK1A 4CRBA 2VGCB 3GYMA 1ZOMA 2BMGB 1A46H 1CHGA 1E36B 1S84A 4UFFH 3BIUH 3ITIA 2ZWLH 3DSOA 4VGCC 1C5ZB 4NSYA 2ODYB 1HAPH 4MQAA 2KR7A 3UIRA 1GBMA 2PSYA 2Z6BD 3TJNA 1QL8A 2P95A 4N7RC 3SJ8A 1YPMH 1O2XA 2XTTB 4ZHAA 2RA0A 1QL7A 2ZU1A 2IN2A 3A6QA 1NN6A 3GDVA 5T3HA 1BTHH 3P92A 3V3MA 1K22H 1SGCA 1TE0A 1TMUH 2XC4A 1LVYA 3M3VA 1E38B 3A7TA 4BTUB 2G00A 3EA9A 2UUYA 3OAAD 2GV7A 1GHBG 4MTBA 3SNCA 3RXSA 4UFDH 3TLOA 1V2UT 3NPSA 4DURA 1JNWA 4FUDA 4X2VA 2BOHB 3RDZA 1AUJA 2P59A 1BMMH 2FS9A 4ZKYA 2VB0A 1GBAA 5DG6A 2SGFE 3MU4A 2GCTB 1N6XA 1TOMH 1Y3XA 4TY6A 2EA3A 3OU0A 1GL1A 5HIZA 3JZ1B 5LPFA 2ZGXH 3R5RA 4B1TA 1DWBH 3SU0A 1BZXE 1I0RA 1NTPA 3MU5A 1AE8H 1JWTA 2ZHWH 2L74A 1YOAA 1GVLA 1F7ZA 1SL3A 3MNCA 1EAIA 3NK8A 3QUMP 2F9UA 4OS1A 1L1JA 2Z9IA 4MLFB 3MTYA 3PV2A 1XXFA 1O36A 2QY0B 2ALPA 3F2FA 1GI8B 1YY3A 2F9NA 2PKAB 2ZU2A 2C4FH 3TITA 1O3HA 3OTJE 3E91A 1TB6H 2WV4A 1HAGE 1G37A 1O3NA 2H2ZA 2SGDE 3MWIU 5BRRE 1G3BA 1PQAA 1C1SA 4QVBA 3LGWA 3OSYA 1Y12A 1U6QA 3BTDE 3T28A 1C5RA 3Q77A 4ABJA 1H8DH 1P10A 3PB1E 4NZQA 1TPPA 4RI0A 1OKXA 1O3BA 3M5MA 4FUCA 1P01A 4JCNA 2BLQA 1AMHA 3A85A 1P05A 1S6HA 2BDAA 2HQ7A 2FYQA 2THFB 3BTEE 1GBEA 1RIWB 1C4Y2 1GI3A 3O8DA 5A09A 1GBLA 2GTBA 1IOEA 3M7UA 4IN1A 1O3FA 4NIXA 2IJOB 2ZDNA 2ZPRA 4CHAC 2B8OH 2OINA 2EI8A 5CHBA 1P3EA 4X8UH 1P06A 3SN8A 2AYWA 1AZZA 3Q3YA 1J15A 1JXPA 2EC9H 2ECRA 3GY8A 3PM3A 3DT0H 1T32A 4X6NA 3TVJB 5L2YH 3UOPA 4I8GA 3UAIC 2OU5A 3KQDA 1W2KH 1BJUA 4OS2A 2Z9JA 4FUJA 3S7HB 3KQ5A 1CSOE 3LT3A 1SPJA 1OS8A 4IC6A 4BOHA 3A82A 2KCOA 5T6FA 3SJ9A 1IAUA 1C5SA 5HM2A 1O3JA 1UK2A 1GPZA 1P2IA 3W94A 3KYGA 3QLPH 2L1TA 1ZSLA 5A0BA 5A2MH 1B5GH 1A3EH 1C2GA 1SGFA 1D6WA 1GBBA 1PPZA 2TPIZ 2ZDAH 2ANMH 2UUKB 2Z9KA 3LJJA 2ZP0H 4B6FA 5HIYA 2WYGA 5BNCA 3A8DA 3CB0A 2XRCA 4YBNA 3F6UH 3GCHC 5C1UA 1GMDG 1BBRE 1O3CA 2ZDKA 3BTKE 2XBWA 1EPTB 1ZYOA 3TGJE 4NGAH 3B8JA 3FOAA 1FY1A 1PYTD 2V3MA 4ZH8A 4HG6A 2Q6DA 3HGPA 2ZGHA 1DFPA 3SZNA 3R5LA 1FAXA 2C3SA 2Y7XA 2K0QA 4ZROA 1L0ZA 5JB9S 1SLVB 1Z6EA 1FDPA 2EI6A 2JETC 4JZ1A 3LH3A 2BZAA 3QTVH 1BHXF 1JIMA 1O38A 2G52A 4F48B 4JYVH 3SGBE 3U1IB 1O2MA 1CHOF 1SQAA 3FP8E 3PV4A 1GHYH 1ZJKA 1AE5A 4K69A 2HHZA 4X1RU 1TRMA 1W0JD 2B9LA 2FIRH 1AD8H 4IMZA 2NR4A 1MD7A 1SGEE 2ZHFH 2C8XB 3L6PA 1SLWB 3A81A 5FCKA 3U1JB 3QWCH 1YWUA 1V2NT 1SBWA 2O8UA 2F9PA 2V0BA 1O3PB 1TYNA 2FURA 3F9GA 3ZVDA 4R8TB 1ZPCA 3SBKA 1XXDA 3RXUA 3N99A 4K8BA 3FKSD 4DIHH 1PFXC 2RE7A 2GCTC 2FTLE 1TAWA 4KELA 3K86A 3F2HA 1EX3A 1YPEH 4YO9A 2GGVB 1C5UA 1SGNE 1QZ8A 4J2YB 3F7EA 3RM2H 5FXLA 1A5HA 3IWMA 3T26A 3OY5U 3D65E 4I86A 4DT4A 3O8RA 2ZIQH 1P11E 1P2MA 2G55A 5HGGA 3DSPA 3NZIA 2AGGX 1TGTA 3FZZA 4CRAA 3MQKC 3M61U 1QB9A 1QQ4A 1VZQH 1H9LB 4RKJB 3VG8A 1HFDA 1KXEA 3ZV8A 2ZA5A 2AIPA 1ESTA 1TBRH 4THNH 4BAOB 2OQUA 2BB4A 3EDXB 3GICB 2Z3CA 2BVRH 2OLGA 3IITA 1HAYB 2R9PA 3ZZ8A 1QBNA 4GPGA 1UCYE 4ZHLU 3SNAA 1GCTB 1MABB 2FWWA 2QYIA 2TGDA 5HKKD 4GHTA 1A4WH 1RGQA 3BSQA 2EI7A 3F9EA 1M9UA 1QIXB 1YKTA 4X0WU 4CBNA 3ZVCA 1GBHA 3UNSA 4AGKA 1C4V2 1ABIH 1RIWC 2C8ZB 5DP3A 5EGMA 4HMUA 1MAYA 4FUIA 4D9RA 2VWNA 1C5XB 3BEUA 3GOVB 4I33A 1DNLA 1BDAA 1S0QA 1TNKA 4JZFH 2O8TA 1GBDA 4ZHMU 5EIYA 5JBCS 4B2BA 2FI5E 2VIQA 2ZZUH 1A7SA 1NO9H 4B75A 3PV5A 1WUNH 2WPLS 2BYAX 4DOQA 2JDID 1UTJA 3S9CA 3BTTE 1QY6A 3A86A 3C27B 3RU4T 4XSKU 4Z6AH 4AORA 1BT7A 4AFQA 4ISNA 4ACBA 2G4UA 4UONA 4RN6A 3AW0A 2C93B 7GCHF 1O3AA 5DGJA 1C5NH 3TK5A 1C2KA 4BNRA 2KAIA 1XUIA 5JPMH 1KDQA 1Q31A 1AKSA 1W7GH 2XNIA 3ZZ4A 1W7XH 1RZ1A 1V2QT 3HPTB 2R0KA 4PROA 3M7TA 1INCA 3HKJB 1OSSA 3AK5A 2UWPA 2K1QA 2FOFA 2ZPSA 3RMNH 1USCA 3HATH 4W64A 1VGCB 3RXEA 3EE7A 4A1VA 1AVGH 2GT8A 3R5PA 4R82A 1GL0E 2GX4A 2FYRA 1C1QA 2OBOA 2XC0A 3P17H 1BRCE 1NY22 1P57B 5C0TA 2H9EH 3UNRA 5TJXA 1ZTKA 2A2QH 3QK1A 4MPXA 4DGJA 2GCHF 1OWHA 2DUCA 3LGUA 1ELDE 2WV5A 4NFFA 3GY7A 4NG9H 4E7NA 3ZZDA 1SMFE 1THRH 4Z1MD 1GJ8B 1HIAB 7KMEH 1XKAC 1P2OA 5GDSH 1AFQC 3ZOCA 1JBUH 5L2ZH 1HAXB 3BTFE 2BQ7B 4YLUA 3ZOFA 3A80A 1SLUB 3M5NA 1YGCH 2CXVA 1TPAE 3QZRA 2O8MA 1WLIA 1ZGIA 1GJAB 1ZHRA 1ELEE 1JRTA 3H7TA 3PLBA 3NCLA 1YYY1 2G5NA 1ELTA 1P12E 2AMPA 1O2QA 2IJD1 1OWDA 1EQ9A 2A1DB 4WMFA 2HNTF 1MTUA 3R5ZA 1N8OC 1DXPA 1O39A 1BIOA 5CHAC 3SU3A 2ZCKP 3S9BA 3GDSA 1QBOA 1BRAA 1P02A 3NRLA 2ZCHP 1P0SH 3L3TA 1MU6B 1XKBC 3C1KA 1SSXA 2SGAA 5CHOA 3BF6H 5F8ZA 1O3GA 4TSFD 4UEHH 3DD2H 2BDIA 4GCHF 4F4OC 3MMGA 3PWBA 2NU1E 4YZUA 2FOAA 2R3UA 1ID5H 1WAYB 2BXUH 4UDWH 6CHAC 2VIOA 2WSSD 4TWWA 2KCAA 1LPZB 4FUBA 1EAXA 4I8LA 1LHEH 2AMDA 2OC8A 2I6QA 2OTVA 1MKWH 2PR3A 1OYTH 5FPSA 1HV7A 1BA8B 1F0RA 1YPHC 3SV8A 2BY9X 1CU1A 1LKBA 3MO9A 2W5EA 3RXOA 4YTAA 2D38A 4B74A 3VXEH 3QX5H 4UE7H 2J94A 2AH4X 2PGBB 1CE5A 2VNTA 1W0YH 2ZEBA 5E0GA 2VU8E 1I0SA 1SLXB 1CGJE 1EFRD 1O31A 1FV9A 2NU0E 2ZFSA 1BTWA 2ZHDA 1K1LA 1RRKA 3DMBA 2OK5A 1P9SA 1SQRA 4Y7BA 2HLDD 3E16B 1GDUA 3F0OA 2UWOA 4YOIA 4CRCA 5DP9A 4BAHB 1ZSKA 1WYKA 2PHBA 5EQRA 4RSPA 4ZKOU 2O8LA 3EAJA 1EATA 1AY6H 2O9QA 3FP6E 5AFZH 4AZ2B 2YNAA 1NRSH 3ATWA 2NU2E 3SORA 2D1JA 2NWNA 3VEQB 3BTHE 1IQMA 2F3CE 1HJ8A 2TIOA 2F91A 5JB8S 1THPB 1MQ6A 5KECA 1GWAA 1TX8A 1IQNA 4TPYA 1AVWA 1FI8A 1TWXB 3F0PA 4NIYA 1P2KA 1O3MA 3DFLA 1K9OE 4O9VA 2QXGA 1DANH 1JMOH 3DCLA 2ZO3H 3EYDA 1O0DH 2I02A 1TQ0B 1GMCF 4AB9A 3A7WA 2W7SA 3RC5A 1VJ9U 1WV7H 2TGTA 5EXNA 4ABFA 3A8CA 1QTFA 1ABJH 1LHGH 3ZZ7A 1UW7A 4GVUA 2PKAA 1L2EA 3KQEA 1YBWA 5E0JA 1GI9B 3DSGA 1NBMD 3MH7A 3KL6A 1PYTC 1V3XA 3ZZ6A 1EUFA 1RFEA 1HAVB 2ALVA 4KGAA 1OWEA 5IYTA 1AWHB 1DLEA 1O5DH 1F0UA 2VVUA 3UY9A 1V2KT 2FOGA 1K0HA 3RXCA 3F2GA 3RXHA 2QXHA 1QQUA 2ZHQH 3ELAH 4K8YA 4CH8B 4TV4A 1DY8A 2HPQH 3RLWH 1VGCC 4JZEH 4H42U 2X1JA 1ANDA 1EXFA 2W7UA 3AAUA 1RTLA 1GBKA 4WJG2 1T4VH 1GGDC 1EJMA 2QN5T 1IQJA 3DUXH 5H4IB 3SU2A 1YPJH 1NPMA 5C0UA 5DO4H 1DE7H 1S85A 3P70B 2QGRA 5JBAS 1QB1A 1V2VT 1QBVH 2B7DH 1LQEA 1GBFA 3I78A 5AVDA 5EQQA 3VYAA 1FJSA 2ARZA 1EOJA 5KEDA 2JETB 4AOQA 3IN6A 4XBDA 3UNQA 3P8OA 1FIWA 1K28D 1VITG 4FUGA 1WTHD 3UTUH 1P3CA 2JH0D 1KLJH 2RG3A 3LH1A 3RXTA 3TJVA 5E0HA 1Z1JA 4HMVA 4MPVA 1XHNA 1FLMA 1GJ6A 2ANKH 2FI4E 2G81E 3I77A 4YT6H 3H5CB 5C94A 1L1GA 2R2WU 1AFEH 1VJAU 1GHAG 2QE7D 3BEFB 2IOTA 4YT7H 1K1IA 1X7AC 1QA0A 1LHDH 1O32A 1E79D 1DDJA 4B6EA 1LO6A 1YF4A 2VIWA 1SGYE 3TH2H 1C2DA 1IQKA 1CQQA 5KGOA 3F68H 1ZMNA 3ENSB 3ZV9A 1DWEH 3N7OA 3MH6A 7GCHG 2FHQA 1AXJA 1AGJA 1A61H 4FU8A 2AS9A 3PMHB 2ZPQA 1S0RA 5FX5A 1P09A 2XCFA 2W6ID 2BY7X 1H8HD 1NT1A 1SGFG 1EPTA 2QF5A 4WMEA 3HE1A 3SJOA 3MNSA 3CENA 1O2UA 3SU4A 5K0HA 3MNXA 2D8WA 3M35A 4NWLA 4O97A 4RT1A 3ZYDA 3M5OA 1ZTLA 5DP6A 3G01A 1K1NA 1PPEE 2A2XH 4AG2A 2ULLA 2Y80A 5IDKA 1F5LA 1EB2A 5LH8A 2RCEA 4KTSA 1W3RA 3AAVA 1ESAA 2OBQA 2YMSD 1C5QA 5EPYA 3AW1A 5JYIA 3BA3A 4XRNA 2OL5A 3FZDA 4INHA 1GG6C 3HK3B 4MNVA 3RXPA 1QNJA 2ZG0H 3RM0H 3H09A 1Y8TA 3PLKA 3OY6U 1O2IA 1YLNA 2CK3D 1FPCH 2A7JA 2BD9A 3A8AA 2WPKS 5I25A 1NFXA 1O5CB 3GCTF 3SNDA 6GCHF 3TK6A 1SGDE 2EEKA 1XVMA 2QCYA 5C1YA 4SGBE 1OX1A 1AVXA 3M5LA 1XVOA 3TGIE 1W3PA 3A84A 1O2HA 1MTWA 3GYLB 5HYOA 2A4QA 3U8TH 3VY2A 2PW8H 2FTMA 2BD3A 3RXDA 5GNDA 3S9AA 1C1UH 3RXGA 4WY3A 1SGTA 2SGQE 1WTGH 1Z8JB 1UTQA 1MQ5A 2QA9E 3ZVGA 5E8EH 4AGJA 1ELBA 2Q6FA 1TNHA 4FXGH 2XOKD 5F03A 1ARCA 4AG1A 2GZ9A 1VCPA 3ZIAD 4I32A 2FESH 2VVVA 5L6NH 3U0IA 1C1VH 4U2WA 3E0NB 2ODPA 2XW9A 3B23B 2ZFPH 5FPTA 1JOUB 3QTOH 2Q1JA 5PTPA 1D3DB 3QN7A 1IQLA 3LKWA 3WWFA 5JBBS 1WDIA 1IQGA 2XNDD 1HAOH 6LPRA 1TA2A 4NIWA 4X6OA 1XX9A 3T29A 1UK3A 1T8OA 4MDSA 1B0EA 1B7XB 2ZFFH 2RFKC 1BMFD 3UUZA 5EW2H 2C8WB 1GCDA 1UTNA 1KXCA 1ANEA 1W3QA 2GMTB 4H6TA 1CGIE 4GCHG 2TGPZ 1Y3YA 1BMLA 2BZ6H 1DWCH 3LGIA 1C2IA 1HAHH 3U5WA 1Q3XA 2QXJA 5DP4A 1ZRKA 1FNIA 3ATLA 1C5OH 4X1SU 1NM6A 1GBCA 3NFWA 1QRZA 2V7QD 3SJKA 2ZFRH 4XJ2A 1FLEE 2D2DA 1RZ0A 1MTVA 1THSH 1G2LA 5I46H 2P3TB 2RA3A 3FN8A 4OS5A 1FX0B 1SQOA 5FAHA 1MMJN 3FFGA 2ZECA 2XXLA 5T6GA 3JZ2B 1Z8RA 3HMZA 2OC1A 5BPEA 3B5MA 3H7OA 2X1KA 3P8NA 1O3LA 2GKVE 3A6RA 8ESTE 1FN8A 3UOUA 3UQVA 4X2WA 4MTKA 1O3EA 4QT8C 3ZVAA 2XBVA 3F9HA 4LXBH 1UO6A 2PSXA 4I8KA 2FPZA 2ZF0H 8GCHG 3ZOGA 1T4UH 4GHQA 3SGQE 1HBTH 3LGVA 1AB9C 1S82A 3VB3A 3BNKA 3URCA 1AFQB 5DPAA 3ZZAA 3KN2A 5CDFE 4BXSA 1C4U2 3OYPA 4NSVA 4X8TH 4ZAEA 3SW2B 1C9PA 2A45B 1V2RT 4Q7YA 5EG4A 2FZZA 1ZMLA 3AWHA 3OEED 1YPLH 2GD4B 3HKIB 1C9TA 1BBRH 2Q9KA 1FMGA 4D8NA 1GMCG 1PPFE 1W0KD 3Q3KA 3PYHA 1CT0E 1ZJDA 2F9BH 2FLRH 1AZ8A 3V4HA 1ZHPA 2BD7A 1GJ4H 1OXGA 1RD3B 3PO1B 2K8IA 2XWAA 1N8OB 5DSFA 5CHAB 3VB4A 1V2JT 1D3QB 2Y6TA 1QR3E 2STBE 2A2JA 1GMHG 2CF8H 2Y82A 4ZMAH 4OS4A 3RMLH 1TY9A 1KTTB 2SNVA 4FU7A 1ESBA 3UWIA 1WGBA 1C5TA 2W26A 4AN7A 3UREA 2BDGA 6CHAB 3K88A 4YM9A 1QFKH 1HAZB 3MU1A 4Y0YE 3T62A 1C1MA 3ODDA 3BV9B 1Y5AT 2ZHEH 4I7YH 2VWLA 1WU1A 2CV3A 1HIAA 1FZZA 2VH6A 1LPKB 3TGVA 2BD5A 1CVWH 4IW4E 5LPEA 2BD4A 2W3KA 2WPHS 4SGAE 3PTBA 4A1TA 2CHAC 4A6LA 5C5OA 4E05H 3DNHA 1MTSA 4I8HA 4YXWD 1Z71A 4Z85A 2J4IA 1O2TA 4P00A 4E06H 1HGTH 1Y5UT 3SQEE 4WVPE 1NZQH 1TGBA 2FOMB 1CT4E 3PFTA 3B9FH 3RXRA 4YESB 3SUFA 4OGXA 3V7TA 5GWZA 2A5AA 1Y3WA 3SUGA 2P3FH 1EOLA 2ZFTA 4WH6A 2STAE 2J97A 1DXWA 1CBWC 1Y5BT 3BTME 4ASUD 2CJIA 3EQ0H 1USFA 2KCYA 1QURH 3BN9A 3SU1A 3F3BA 3RXAA 2BHGA 2PUXB 1SGQE 2J34A 3STJA 5JBTA 4FUFA 2QF3A 1J9CH 3SUEA 3FANA 1TALA 1YPHE 5FCRA 4HI3A 1P04A 2KM0A 5ESBA 2ED4A 1AN1E 2A7CA 4Y79A 4X6MA 1MCTA 3SHAH 2A31A 4WXVA 4ABDA 4BTTB 4OGYA 3PMBB 2AMQA 3RU4E 3PMAB 1UCYH 1Y3VA 4Q7XA 1YP9A 3RMMH 2PLXA 4CH2B 5DN6D 3VXFH 9ESTA 1HJAC 1BJVA 1OWJA 1V2LT 5AHGH 1TMTH 4IS5A 1FY8E 1TMBH 1DVAH 1CO7E 2F9VA 2GMTC 2WZQA 4BAQB 1ETRH 1JIRA 2VH0A 2HPPH 4Y8ZA 1O2SA 2GDDA 3ATIA 5E2PA 2P3UB 3MH4A 2ODQA 1OP2A 5FPYA 2LNCA 1SFQB 5CHEC 1QCPA 5FHTA 4XD7D 1G2MA 5TCAA 2Z94A 1MKXH 2DE8A 4X2YA 3SZEA 1GHBF 2JJ2D 2FLBH 1YCPH 4AB8A 1N6YA 1GI1A 1ZMJA 5HMAA 3Q76A 2LP6A 3SU6A 1IQFA 2L6OA 2WPJS 3GCTG 3GY3A 4Q2KA 2BDYA 3TH3H 4WWYA 1GJDB 5ESTE 5J4QA 1BRUP 5LGOA 1ETSH 1K1JA 3U28C 1O2RA 1GGDB 3ATKA 1S81A 3K2UA 3GISB 3VFEA 2ZGBH 1ORFA 4I8JA 3TH4H 3RXQA 1EP5A 2Q6GA 1GJBB 8KME2 4DIIH 3QDZB 2XBXA 3EC6A 3MYWA 4D9QA 2SNWA 1BUIA 2FX6A 3ZOHA 1VKYA 3I29A 3TPIZ 3TNSA 1L1NA 3T27A 1DUEA 1NRGA 1O2VA 3R0FA 3M3SA 2Z9LA 3MO3A 1MUEB 4TT3D 1VL7A 1WOFA 4ABEA 4GSOA 1G78A 4ABHA 4Y9IA 4FOUC 2A5KA 1PPHE 4JK6A 1AU8A 4ISHH 4UFEH 1HAVA 1CA0C 5DKMA 1BQYA 4HMWA 3SNEA 7ESTE 1LDTT 2KX4A 4NCYA 2IABA 2GZ7A 1D3TB 1UVOA 1ZPZA 3HY8A 2QIQA 4Z0KA 4ESTE 3SI4H 1EJEA 1DM4B 3ZZ3A 3PO1C 1TX7A 1A5IA 2XWBI 4IBLH 4WXIA 1K2I1 3CP3A 1IHSH 1TLDA 5TCCA 2J95A 1GVZA 5F8XA 3KYFA 1EB1H 2FI3E 1IHTH 1OHHD 3LIWA 5FL7D 4NWKA 1PPGE 2ECUA 1LHFH 2ZTYA 3ODFA 4WMDA 1G30B 3FO8D 1H1BA 2OP9A 3UWJH 2HTDA 4NZLA 3FKHA 2OC7A 4ZXXH 2FG9A 1SOZA 2I6SA 3RXLA 1SGRE 1SG8B 1W8BH 3SU5A 1NS3A 1KYNA 1O2YA 4ABBA 3RP2A 3UPEA 1A0JA 1DICA 3RLYH 1H9HE 3E90B 1HDTH 3LGTA 4MPUA 1ANCA 1GG6B 4U01A 1YM0A 3KGPA 1ELGA 4Q4LA 3VB5A 2V35A 2BY5X 1HPGA 4H6SB 3U9AH 3SWJA 3D23A 2DE9A 3RMOH 5JDUB 2WYJA 3N7EA 2BY6X 1OPHB 2VBCA 1YCPM 3VPKA 3BTQE 3V0XA 4E7RG 4IRAA 2ZC9H 3U69H 5AF9H 3CP7A 1V2OT 4DY7B 1CHOG 1GI5A 3QO6A 4MPWA 2M2AA 1A3BH 5L30H 4B71A 1HAIH 1RTFB 2BQ6B 4CRGA 2VPAA 1E1QD 5CMXH 4HGCA 7LPRA 2BVXH 4ABAA 1UVSH 2FO9A 4M7GA 1O30A 1GMDF 2BOKA 1PQ8A 1T8LA 3A88A 1AKSB 4NA7A 5A8YA 1FXYA 2HVXA 3E4VA 2PTNA 2ZI2H 4X1PU 2SGEE 4A7IB 1GJ5H 1O2PA 4U32A 1TGSZ 3SO3A 1G3EA 3P95A 1E35B 3CS7A 1MTNB 1TNLA 4XHYA 1O5EH 2ZDVH 3K65B 3PRDA 4IN2A 1DLKB 1QJ6B 1MKWK 3RXJA 4AFUA 9LPRA 1WV4A 3NUMA 5C67A 1Z8GA 2P5ZX 1FONA 1Z6JH 1HUTH 1K21H 1ANBA 1P2QA 1UTOA 2ASUB 1ELAA 3RXKA 1BTZA 1GHZA 2BDCA 3MU0A 1TFXA 4HZHA 2A4OA 3EA8A 3FAOA 4NIVA 1CI0A 2Y5FA 3TK9A 1C2JA 1FAKH 1XM1A 2VINA 3SJIA 4OS6A 3GY5A 1FY3A 2D5MA 3KCGH 1C2FA 4FETA 1HNEE 2RDLA 2NU3E 4KTUA 4D7GA 4JK5A 5ETXA 2PWXA 2G4TA 5GPIB 1MAXA 4MG3A 1OYQA 2F83A 5EXMA 2H5DA 1Y3UA 1NRPH 4Q80A 1RTKA 1SGPE 4J1YA 2IPHA 2W6JD 1TNJA 4LZ1H 2XYAA 2D26C 3BTGE 1QGFA 4AX9H 4M9FA 1SFIA 4LZ4B 2V3OH 2GJGA 1NU9A 4UD9H 2R0XA 1QB6A 1ZLRA 2WPMS 4DCDA 4MNWA 4Q7ZA 4IGDA 4JZIA 1H4WA 5GIBA 1T8MA 1E37B 3RXBA 5A8XA 3ZZ9A 4X1NU 6ESTA 1TX6A 1W0ZU 3DA9B 1O5BB 4JYUH
chains in the Genus database with same CATH topology
5KGOA 4IRAA 2L74A 1YOAA 2D36A 2PTFA 3ZOFA 2FHQA 1AXJA 5ESCA 3U5WA 4RT0A 1WLIA 4HG6A 3DB0A 2ASFA 1G79A 3TGVA 2IMLA 2I02A 3R5LA 1W3OA 2VPAA 3EC6A 3GASA 3NFWA 3H96A 2HQ9A 3DNHA 2I51A 3FGEA 4RT1A 3R5YA 4XJ2A 3ZOHA 4HMUA 1RZ0A 4F48B 3K87A 4Z85A 4P02A 4P00A 1DNLA 3E4VA 1Y30A 3U34A 1NRGA 4QVBA 3PFTA 3DSGA 2HHZA 1G77A 5EIYA 1W3RA 3R5ZA 4HMSA 3ZOEA 3ZODA 1RFEA 1VL7A 3BA3A 4XRNA 4XHYA 2OL5A 2HTIA 3HMZA 2NR4A 3B5MA 1G78A 2X1KA 4Y9IA 4FOUC 3A6RA 1YLNA 5CHOA 1YWUA 1USFA 2HQ7A 1G76A 2QEAA 1WV4A 2D37A 4HMWA 5EJ1A 2FURA 3U35A 4N7RC 3A20A 2IABA 3ZOGA 2X1JA 3HY8A 4HMXA 1W3PA 1EJEA 3BNKA 3A6QA 3R5WA 2ED4A 4HX6A 4YWNA 3VY2A 2RE7A 3CP3A 3K86A 5EJZA 1CI0A 1RZ1A 4HMTA 2ECRA 3AWHA 2D38A 3KYFA 2R6VA 2D5MA 2Q9KA 3F7EA 3VY5A 2ECUA 3VYAA 1I0SA 2E83A 2OU5A 1XXOA 2ARZA 1USCA 4L82A 4I86A 2HTDA 3U0IA 5KEDA 3IN6A 3AMFA 3FKHA 3BPKA 3DMBA 2FG9A 3CNRA 1T9MA 1JNWA 2RDEA 5JABA 3ZOCA 2IG6A 3R5PA 4R82A 4ZKYA 5EJLA 4HMVA 1XHNA 1FLMA 5CHEC 2QCKA 3KYGA 1WLKA 4F07A 2AQ6A 3RH7A 2A2JA 2GJGA 1TY9A 3R5RA 2R0XA 3SWJA 1WGBA 1W3QA 1W9AA 1I0RA 5BNCA 3CB0A 4YBNA 5KECA 3K88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KGO A;  4IRA A;  2L74 A;  1YOA A;  2D36 A;  2PTF A;  3ZOF A;  2FHQ A;  1AXJ A;  5ESC A;  3U5W A;  4RT0 A;  1WLI A;  4HG6 A;  3DB0 A;  2ASF A;  1G79 A;  3TGV A;  2IML A;  2I02 A;  3R5L A;  1W3O A;  2VPA A;  3EC6 A;  3GAS A;  3NFW A;  3H96 A;  2HQ9 A;  3DNH A;  2I51 A;  3FGE A;  4RT1 A;  3R5Y A;  4XJ2 A;  3ZOH A;  4HMU A;  1RZ0 A;  4F48 B;  3K87 A;  4Z85 A;  4P02 A;  4P00 A;  1DNL A;  3E4V A;  1Y30 A;  3U34 A;  1NRG A;  4QVB A;  3PFT A;  3DSG A;  2HHZ A;  1G77 A;  5EIY A;  1W3R A;  3R5Z A;  4HMS A;  3ZOE A;  3ZOD A;  1RFE A;  1VL7 A;  3BA3 A;  4XRN A;  4XHY A;  2OL5 A;  2HTI A;  3HMZ A;  2NR4 A;  3B5M A;  1G78 A;  2X1K A;  4Y9I A;  4FOU C;  3A6R A;  1YLN A;  5CHO A;  1YWU A;  1USF A;  2HQ7 A;  1G76 A;  2QEA A;  1WV4 A;  2D37 A;  4HMW A;  5EJ1 A;  2FUR A;  3U35 A;  4N7R C;  3A20 A;  2IAB A;  3ZOG A;  2X1J A;  3HY8 A;  4HMX A;  1W3P A;  1EJE A;  3BNK A;  3A6Q A;  3R5W A;  2ED4 A;  4HX6 A;  4YWN A;  3VY2 A;  2RE7 A;  3CP3 A;  3K86 A;  5EJZ A;  1CI0 A;  1RZ1 A;  4HMT A;  2ECR A;  3AWH A;  2D38 A;  3KYF A;  2R6V A;  2D5M A;  2Q9K A;  3F7E A;  3VY5 A;  2ECU A;  3VYA A;  1I0S A;  2E83 A;  2OU5 A;  1XXO A;  2ARZ A;  1USC A;  4L82 A;  4I86 A;  2HTD A;  3U0I A;  5KED A;  3IN6 A;  3AMF A;  3FKH A;  3BPK A;  3DMB A;  2FG9 A;  3CNR A;  1T9M A;  1JNW A;  2RDE A;  5JAB A;  3ZOC A;  2IG6 A;  3R5P A;  4R82 A;  4ZKY A;  5EJL A;  4HMV A;  1XHN A;  1FLM A;  5CHE C;  2QCK A;  3KYG A;  1WLK A;  4F07 A;  2AQ6 A;  3RH7 A;  2A2J A;  2GJG A;  1TY9 A;  3R5R A;  2R0X A;  3SWJ A;  1WGB A;  1W3Q A;  1W9A A;  1I0R A;  5BNC A;  3CB0 A;  4YBN A;  5KEC A;  3K88 A; 
#chains in the Genus database with same CATH topology
 1AB9 B;  1QJ7 B;  4FUE A;  5FX6 A;  3KNX A;  1MH0 A;  1UHB B;  1O2N A;  4BAK B;  3R3G B;  4Y76 A;  1PQ7 A;  2Y7Z A;  8LPR A;  3A89 A;  2ZQ2 A;  1FIZ A;  3DB0 A;  2Y81 A;  5AFY H;  4B2A A;  2IML A;  1AIX H;  1O5A B;  1C2M A;  5HXF A;  4KTC A;  2ZDL A;  3WW7 A;  3GAS A;  1V2W T;  4K2Y A;  2HQ9 A;  1DX5 M;  2FS8 A;  4MVN A;  2FDA A;  1PQ5 A;  1EP6 A;  4ISI H;  3OE7 D;  3BEI B;  3MHW U;  4NA8 A;  3RXF A;  1BTP A;  1B0F A;  1BTX A;  4X6P A;  2UWL A;  4DG4 A;  2FOH A;  1AQ7 A;  1J17 T;  2OD3 B;  1OP8 A;  1C1R A;  4KP0 A;  4U30 A;  1G32 B;  4B76 A;  4CR5 A;  1E0F D;  4GUX A;  1TPS A;  1G3D A;  5E2O A;  3U98 H;  3NKK A;  1TRY A;  2BXT H;  3BG4 C;  3LC3 A;  1NRR H;  2BDB A;  1UTL M;  4CBO A;  3E8L A;  2ZQ1 A;  4TYD A;  3ZYE A;  4X1Q U;  1O3D A;  1C5P A;  1ZSJ A;  3U35 A;  1BMA A;  3VB7 A;  1TON A;  4K5Z A;  5CE1 A;  3LON A;  3F1S B;  4XE4 A;  1XUJ A;  2H9T H;  3RC6 A;  3SGA E;  4HMX A;  1GBT A;  1YC0 A;  1N1L A;  2PP6 A;  4FVD A;  4JZD H;  2GZ8 A;  1EZS C;  3LC5 A;  1KXF A;  1S83 A;  2R3Y A;  1VR1 H;  1WCZ A;  4WH8 A;  3BTW E;  4ISO A;  4HMT A;  1SHH B;  1Z8I B;  4IMQ A;  1XUH A;  2QAA A;  1DWD H;  2CHA B;  2PKS C;  2GCH G;  4RKO B;  2P8O C;  5C3N A;  5F8T A;  3PRO A;  1UK4 A;  4BAN B;  1OOK B;  1ZTJ A;  2P94 A;  3A7X A;  3V12 A;  1LVB A;  1O2G H;  3MI4 A;  3OX7 U;  2FMJ A;  3PTN A;  4TY7 A;  4Y71 A;  1ZRB A;  4K1T A;  1DST A;  4XBC A;  2KZ4 A;  2HWL B;  1O3K A;  1A5G H;  2C8Y B;  3GY2 A;  2VWM A;  1CBW B;  2PFE A;  3W95 A;  3MU8 A;  1V2S T;  2WPI S;  1GDQ A;  2OC0 A;  1SR5 C;  1OP0 A;  1SB1 H;  1TRN A;  2J5U A;  3SV2 H;  2AIQ A;  3LU9 B;  3RUO A;  3FP7 E;  3LJO A;  1Z7K A;  2Z9G A;  1CT2 E;  3SV7 A;  1WQS A;  1NU7 B;  3RXV A;  3EAA A;  1J14 A;  1A1R A;  1S6F A;  1AWF H;  2J98 B;  2PGQ B;  2D36 A;  2K4Q A;  5C5N A;  1QJ1 B;  2H5C A;  1F0T A;  1MTN C;  1LHC H;  4RT0 A;  1DSU A;  2M5T A;  2J2U A;  2Y5G A;  4Y11 E;  1O2K A;  1J8A A;  1EJA A;  3BIV H;  1QRW A;  2BD2 A;  4O3U A;  1MU8 B;  3ZVB A;  1FN6 A;  1HJA B;  2QF0 A;  4Y0Z E;  1GJC B;  3T2N A;  3R5Y A;  4INL A;  1D6R A;  4AYV B;  3K87 A;  5LPR A;  3RU4 D;  3GCO A;  1J16 A;  1TIO A;  5C1X A;  1C5V A;  4HFP B;  1YLD A;  5T6D A;  3OEH D;  4AC9 A;  1AUT C;  1LQD B;  1KLT A;  1W10 U;  1O3O A;  1VCQ A;  3E0P B;  3PWC A;  3L33 A;  1DOJ A;  1NFU A;  1KXA A;  1HRT H;  1UTM A;  1W12 U;  1O2W A;  3AVZ A;  4R0I A;  3KF2 A;  1TBZ H;  1LCY A;  1LMW B;  1MBM A;  2QEA A;  3SYJ A;  1G76 A;  4Y8X A;  1NBM E;  3V13 A;  1D3P B;  1S6L A;  4A1X A;  5C20 A;  2J92 A;  2SGP E;  2VIP A;  1BHX B;  4X2X A;  2WV9 A;  2GUJ A;  1L4D A;  1WXR A;  4LK4 A;  4ASH A;  2OCV B;  4XBB A;  1AO5 A;  4HX6 A;  2VIV A;  2BLW A;  1V2P T;  3VB6 A;  2EST E;  1AHT H;  2CN0 H;  1Q2W A;  5EPN A;  1A0L A;  1F0S A;  2V3H H;  4DW2 U;  2BM2 A;  5EJZ A;  2JJ1 D;  1NRN H;  1COW D;  4HTC H;  2P16 A;  3UFA A;  2LPR A;  2H1U A;  2AFQ B;  3VY5 A;  2PV9 B;  3U8R H;  2OQ5 A;  2E83 A;  1K1O A;  3BG8 A;  3M7Q A;  3QGN B;  1FY5 A;  1ELV A;  1C2E A;  5JAB A;  1IQH A;  1QA7 A;  2FOB A;  4K3J A;  3FVF B;  1UTP A;  5EOK A;  1W3C A;  1T31 A;  4MNX A;  1P9U A;  2TRM A;  2JKH A;  1GBJ A;  2VGC C;  4INK A;  3LOX A;  2AGI X;  3MNB A;  1C1W H;  2A0Q B;  1WBG B;  4I31 A;  5EXL A;  1ZPB A;  3EST A;  4ZKN U;  1C5Y B;  1GHV H;  1CA0 B;  5GXP A;  1NC6 A;  3K9X B;  3OTP A;  4DVA U;  4FUH A;  2B0F A;  2XBY A;  4K1S A;  3SUD A;  5GCH F;  1QL9 A;  2TGA A;  5FBI A;  2GV6 A;  1P2J A;  1NRQ H;  4A5T S;  2ZCL P;  2YMS B;  1O2L A;  2F9O A;  3KHV A;  1E1R D;  3U8O H;  4YOJ A;  1BB0 B;  4K1E A;  2ASF A;  1G79 A;  3D49 H;  1GI7 B;  5G4B A;  3A8B A;  4Y8Y A;  3WY8 A;  2WHX A;  2SFA A;  2ANW A;  2NU4 E;  2HGT H;  1TOC B;  1ELF A;  1MZA A;  3FGE A;  4OM9 A;  2OXS A;  1FY4 A;  1BTU A;  1O33 A;  2ZU5 A;  1C1O A;  2CMY A;  3LDX H;  1SHY A;  2OUA A;  2BY8 X;  4IC5 A;  5DP5 A;  1Z1I A;  1T7C A;  1C2H A;  1KXD A;  3A87 A;  3S69 A;  1ZZZ A;  1YPK H;  1O2Z A;  1LVO A;  1YPG H;  2JH5 D;  3PRB A;  1UMA H;  2BD8 A;  3TGK E;  2ZU3 A;  4AFS A;  1EAW A;  1S5S A;  2JH6 D;  1RFN A;  2BX3 A;  3MOC A;  1O3I A;  1SQT A;  4BXW A;  2BVS H;  1G36 A;  3S0N A;  1BBR K;  1GHW H;  3ZZB A;  3PMJ A;  3VGC B;  1TGC A;  1NFW A;  4CR9 A;  4CRD A;  3HK6 B;  1XUG A;  1DPO A;  1O34 A;  4YWN A;  1ETT H;  3F9F A;  1XUK A;  4DJZ B;  4GLY A;  1QHR B;  4Y6D A;  2XCN A;  1HYL A;  1V2M T;  2GT7 A;  2Y5H A;  5A0C A;  1KTS B;  4O3T A;  2A7H A;  1XXO A;  3SI3 H;  2R0L A;  3A7Z A;  1PJP A;  3AMF A;  3KQC A;  2FXR A;  3CNR A;  2AEI H;  4XDE A;  2GP9 B;  1GJ7 B;  3TJO A;  4D76 A;  4CRE A;  1H9I E;  2FM2 A;  4X8S H;  5DP7 A;  5EOD A;  2QCK A;  2VID A;  3W1E A;  5T1V A;  2ZKS A;  1BTY A;  2ZU4 A;  2EQN A;  1XMN B;  3ATM A;  1ELC A;  2FP7 B;  1W11 U;  3NWU A;  1VIT F;  1GDN A;  2XC5 A;  1A0H B;  3E3T A;  1W9A A;  1O5G H;  3HGN A;  2QXI A;  2WIN I;  1HCG A;  1SGI B;  2O8W A;  5C2Z A;  1BOQ A;  1BIT A;  1GHA F;  1GI6 A;  3QZQ A;  1EAS A;  4UFG H;  5HM9 A;  2A32 A;  1W3O A;  3T5F H;  1NFY A;  1LKA A;  1SI5 H;  2QV1 A;  4B73 A;  2HLC A;  3LPR A;  1K1P A;  2W3I A;  2I51 A;  1CGH A;  2GVF A;  1D9I A;  1L4Z A;  1RJX B;  3Q00 A;  1VIT H;  3EA7 A;  1O2J A;  1V2T T;  2V6N A;  6GCH G;  2GDE H;  5B6O A;  4ZKS U;  1Y30 A;  1GI0 A;  1O5F H;  4HKH A;  3DFJ A;  4JYT A;  1G77 A;  3A7Y A;  3RXI A;  1HB0 B;  2HOB A;  1EZX C;  1UJ1 A;  3PLP A;  1LVM A;  1F5K U;  2H6M A;  4NA9 H;  2YNB A;  1HXF H;  2PTC E;  2BLO A;  2IPQ X;  3M3T A;  2D37 A;  2F4L A;  1SKY E;  2G5V A;  5F53 A;  4ABG A;  2VVC A;  2QC2 A;  1A2C H;  5EJ1 A;  1UCY K;  4YLQ H;  3GCN A;  3KID U;  1ARB A;  1DT2 A;  3E6P H;  4LOY H;  4AFZ A;  1EPT C;  5EU8 A;  1H8E D;  2G51 A;  1GJ9 B;  1WSS H;  3TIU A;  3MH5 A;  1V6D A;  3STI A;  2BX4 A;  4D7F A;  1TAB E;  1TGN A;  1C5L H;  1ACB E;  1MCV A;  2FOE A;  3M36 A;  4ZUH A;  4VGC B;  1EAU A;  4CRF A;  1BCU H;  5B6L A;  1F2S E;  1MKX K;  1ZGV A;  2ZNK H;  4L82 A;  3K6Z A;  4ABI A;  2J9N A;  4ZCN A;  3S7K B;  1DY9 A;  1P2N A;  5EQS A;  1YCP K;  1ZR0 A;  2IG6 A;  2AGE X;  3RC4 A;  2YMS C;  1O35 A;  4XOJ A;  3UQO A;  1IQI A;  1W13 U;  2TBS A;  3KQB A;  3M37 A;  1WLK A;  2CF9 H;  2Z3E A;  4UHV A;  4F07 A;  2H9H A;  4ZXY H;  2HNT E;  3RH7 A;  4NFE A;  4FVB A;  1TNG A;  3SOS A;  2VJ1 A;  2WPD D;  3BG4 B;  5C17 A;  3AAS A;  1KLI H;  1UVU H;  1GHX H;  1IQE A;  5A0A E;  3WWB A;  1BMN H;  4MNY A;  1C1N A;  2UUJ B;  5J4S A;  1C1P A;  2UUF B;  4GAW A;  4JMY A;  1K1M A;  1D4P B;  3K6Y A;  3TU7 H;  1UTK A;  1PPB H;  3ZVF A;  5DJ7 A;  1O2O A;  1NES E;  3A7V A;  1KXB A;  2ANY A;  3UR9 A;  5ESC A;  4Y7A A;  5A8Z A;  3RXM A;  3T25 A;  3E1X B;  3P8F A;  2BDH A;  2FOD A;  2EY4 C;  3ZZC A;  1JRS A;  3SQH E;  1KSN A;  1DS2 E;  4F55 A;  1UHB A;  1YLC A;  3CS0 A;  1MD8 A;  4WF8 A;  3GDU A;  2PKS B;  1OWK A;  1EKB B;  1HJ9 A;  4ISL A;  3ZZ5 A;  2P8O B;  4P02 A;  1VCW A;  2WUB A;  3VGC C;  1O37 A;  1SOT A;  3MFJ A;  1C1T A;  3Q3X A;  4TWY A;  3P8G A;  4KKD A;  2A4G A;  1RXP A;  3SV6 A;  2F43 B;  1F92 A;  3QGJ A;  4X8V H;  4AYY B;  1W14 U;  3SNB A;  1HLT H;  3SV9 A;  1Y59 T;  2YOL A;  2ZGC A;  2CGA A;  2Z7F E;  4DT7 B;  4YOG A;  2KAI B;  1CA8 B;  3KEE A;  1AI8 H;  1KDQ B;  3A20 A;  4K60 A;  1GCT C;  1KY9 A;  2AER H;  4TPI Z;  2BQW B;  1QRX A;  1C5W B;  1XUF A;  2B5T B;  2BTC E;  2G8T A;  4ACA A;  3GY6 A;  4FU9 A;  5GCH G;  3NXP A;  1GI2 A;  3R5W A;  1GI4 A;  4B2C A;  3O8C A;  1TQ7 B;  1H8I H;  3LGY A;  3P6Z B;  1MBQ A;  1HXE H;  1TBQ H;  1UVP A;  2R6V A;  8GCH F;  2PUQ H;  3MO6 A;  2AHM E;  3N7D A;  3TNT A;  2A4R A;  1EZQ A;  2BLV A;  1FQ3 A;  2P93 A;  3EE0 B;  2LEL A;  1C2L A;  3BPK A;  1KIG H;  2ZGJ A;  3ZVE A;  1T9M A;  4A92 A;  2RDE A;  1ZHM A;  3DHK H;  4F49 A;  4CHA B;  5IK2 D;  2FEQ H;  1GBI A;  5EJL A;  1UVT H;  2ZTX A;  3O8B A;  2ZDM A;  1G3C A;  2FX4 A;  1LTO A;  1E34 B;  1FPH H;  4Q63 A;  1G9I E;  1P03 A;  1T8N A;  4H4F A;  2AQ6 A;  3URD A;  4Y10 E;  2KCP A;  2ZTZ A;  1TPO A;  4O03 A;  2HRV A;  1MZD A;  3EGK H;  2VWO A;  2R2M B;  3UR6 A;  5FBE A;  3D62 A;  2WUC A;  4BAM B;  2HVY B;  1TNI A;  1PPC E;  1FUJ A;  5GJ4 B;  2QF4 A;  1EJN A;  2Z3D A;  1RS0 A;  4OS7 A;  1KMH B;  2KFW A;  2J38 A;  3TJU A;  2PTF A;  1OWI A;  2HAL A;  1NRO H;  5F6M A;  1WQV H;  1GMH F;  1GVK B;  2ILN A;  1C5M D;  2C90 B;  2ZFQ H;  1DIT H;  2FOC A;  2J98 A;  1P8V C;  1EZU C;  3GY4 A;  3H96 A;  5DP8 A;  1F5R A;  1SVP A;  3GS9 A;  3SHC H;  4ZKR U;  1BRB E;  1TA6 A;  3IG6 B;  2JIZ D;  1DUA A;  5ABW A;  2A5I A;  5K7R A;  2HNT C;  3UB0 A;  3GCH B;  3U34 A;  1SC8 U;  5SGA E;  3OFN D;  4HMS A;  4XFQ A;  4BTI B;  3ZOE A;  3ZOD A;  1LPG B;  3A83 A;  5EW1 H;  2HTI A;  5DK1 A;  4CRB A;  2VGC B;  3GYM A;  1ZOM A;  2BMG B;  1A46 H;  1CHG A;  1E36 B;  1S84 A;  4UFF H;  3BIU H;  3ITI A;  2ZWL H;  3DSO A;  4VGC C;  1C5Z B;  4NSY A;  2ODY B;  1HAP H;  4MQA A;  2KR7 A;  3UIR A;  1GBM A;  2PSY A;  2Z6B D;  3TJN A;  1QL8 A;  2P95 A;  4N7R C;  3SJ8 A;  1YPM H;  1O2X A;  2XTT B;  4ZHA A;  2RA0 A;  1QL7 A;  2ZU1 A;  2IN2 A;  3A6Q A;  1NN6 A;  3GDV A;  5T3H A;  1BTH H;  3P92 A;  3V3M A;  1K22 H;  1SGC A;  1TE0 A;  1TMU H;  2XC4 A;  1LVY A;  3M3V A;  1E38 B;  3A7T A;  4BTU B;  2G00 A;  3EA9 A;  2UUY A;  3OAA D;  2GV7 A;  1GHB G;  4MTB A;  3SNC A;  3RXS A;  4UFD H;  3TLO A;  1V2U T;  3NPS A;  4DUR A;  1JNW A;  4FUD A;  4X2V A;  2BOH B;  3RDZ A;  1AUJ A;  2P59 A;  1BMM H;  2FS9 A;  4ZKY A;  2VB0 A;  1GBA A;  5DG6 A;  2SGF E;  3MU4 A;  2GCT B;  1N6X A;  1TOM H;  1Y3X A;  4TY6 A;  2EA3 A;  3OU0 A;  1GL1 A;  5HIZ A;  3JZ1 B;  5LPF A;  2ZGX H;  3R5R A;  4B1T A;  1DWB H;  3SU0 A;  1BZX E;  1I0R A;  1NTP A;  3MU5 A;  1AE8 H;  1JWT A;  2ZHW H;  2L74 A;  1YOA A;  1GVL A;  1F7Z A;  1SL3 A;  3MNC A;  1EAI A;  3NK8 A;  3QUM P;  2F9U A;  4OS1 A;  1L1J A;  2Z9I A;  4MLF B;  3MTY A;  3PV2 A;  1XXF A;  1O36 A;  2QY0 B;  2ALP A;  3F2F A;  1GI8 B;  1YY3 A;  2F9N A;  2PKA B;  2ZU2 A;  2C4F H;  3TIT A;  1O3H A;  3OTJ E;  3E91 A;  1TB6 H;  2WV4 A;  1HAG E;  1G37 A;  1O3N A;  2H2Z A;  2SGD E;  3MWI U;  5BRR E;  1G3B A;  1PQA A;  1C1S A;  4QVB A;  3LGW A;  3OSY A;  1Y12 A;  1U6Q A;  3BTD E;  3T28 A;  1C5R A;  3Q77 A;  4ABJ A;  1H8D H;  1P10 A;  3PB1 E;  4NZQ A;  1TPP A;  4RI0 A;  1OKX A;  1O3B A;  3M5M A;  4FUC A;  1P01 A;  4JCN A;  2BLQ A;  1AMH A;  3A85 A;  1P05 A;  1S6H A;  2BDA A;  2HQ7 A;  2FYQ A;  2THF B;  3BTE E;  1GBE A;  1RIW B;  1C4Y 2;  1GI3 A;  3O8D A;  5A09 A;  1GBL A;  2GTB A;  1IOE A;  3M7U A;  4IN1 A;  1O3F A;  4NIX A;  2IJO B;  2ZDN A;  2ZPR A;  4CHA C;  2B8O H;  2OIN A;  2EI8 A;  5CHB A;  1P3E A;  4X8U H;  1P06 A;  3SN8 A;  2AYW A;  1AZZ A;  3Q3Y A;  1J15 A;  1JXP A;  2EC9 H;  2ECR A;  3GY8 A;  3PM3 A;  3DT0 H;  1T32 A;  4X6N A;  3TVJ B;  5L2Y H;  3UOP A;  4I8G A;  3UAI C;  2OU5 A;  3KQD A;  1W2K H;  1BJU A;  4OS2 A;  2Z9J A;  4FUJ A;  3S7H B;  3KQ5 A;  1CSO E;  3LT3 A;  1SPJ A;  1OS8 A;  4IC6 A;  4BOH A;  3A82 A;  2KCO A;  5T6F A;  3SJ9 A;  1IAU A;  1C5S A;  5HM2 A;  1O3J A;  1UK2 A;  1GPZ A;  1P2I A;  3W94 A;  3KYG A;  3QLP H;  2L1T A;  1ZSL A;  5A0B A;  5A2M H;  1B5G H;  1A3E H;  1C2G A;  1SGF A;  1D6W A;  1GBB A;  1PPZ A;  2TPI Z;  2ZDA H;  2ANM H;  2UUK B;  2Z9K A;  3LJJ A;  2ZP0 H;  4B6F A;  5HIY A;  2WYG A;  5BNC A;  3A8D A;  3CB0 A;  2XRC A;  4YBN A;  3F6U H;  3GCH C;  5C1U A;  1GMD G;  1BBR E;  1O3C A;  2ZDK A;  3BTK E;  2XBW A;  1EPT B;  1ZYO A;  3TGJ E;  4NGA H;  3B8J A;  3FOA A;  1FY1 A;  1PYT D;  2V3M A;  4ZH8 A;  4HG6 A;  2Q6D A;  3HGP A;  2ZGH A;  1DFP A;  3SZN A;  3R5L A;  1FAX A;  2C3S A;  2Y7X A;  2K0Q A;  4ZRO A;  1L0Z A;  5JB9 S;  1SLV B;  1Z6E A;  1FDP A;  2EI6 A;  2JET C;  4JZ1 A;  3LH3 A;  2BZA A;  3QTV H;  1BHX F;  1JIM A;  1O38 A;  2G52 A;  4F48 B;  4JYV H;  3SGB E;  3U1I B;  1O2M A;  1CHO F;  1SQA A;  3FP8 E;  3PV4 A;  1GHY H;  1ZJK A;  1AE5 A;  4K69 A;  2HHZ A;  4X1R U;  1TRM A;  1W0J D;  2B9L A;  2FIR H;  1AD8 H;  4IMZ A;  2NR4 A;  1MD7 A;  1SGE E;  2ZHF H;  2C8X B;  3L6P A;  1SLW B;  3A81 A;  5FCK A;  3U1J B;  3QWC H;  1YWU A;  1V2N T;  1SBW A;  2O8U A;  2F9P A;  2V0B A;  1O3P B;  1TYN A;  2FUR A;  3F9G A;  3ZVD A;  4R8T B;  1ZPC A;  3SBK A;  1XXD A;  3RXU A;  3N99 A;  4K8B A;  3FKS D;  4DIH H;  1PFX C;  2RE7 A;  2GCT C;  2FTL E;  1TAW A;  4KEL A;  3K86 A;  3F2H A;  1EX3 A;  1YPE H;  4YO9 A;  2GGV B;  1C5U A;  1SGN E;  1QZ8 A;  4J2Y B;  3F7E A;  3RM2 H;  5FXL A;  1A5H A;  3IWM A;  3T26 A;  3OY5 U;  3D65 E;  4I86 A;  4DT4 A;  3O8R A;  2ZIQ H;  1P11 E;  1P2M A;  2G55 A;  5HGG A;  3DSP A;  3NZI A;  2AGG X;  1TGT A;  3FZZ A;  4CRA A;  3MQK C;  3M61 U;  1QB9 A;  1QQ4 A;  1VZQ H;  1H9L B;  4RKJ B;  3VG8 A;  1HFD A;  1KXE A;  3ZV8 A;  2ZA5 A;  2AIP A;  1EST A;  1TBR H;  4THN H;  4BAO B;  2OQU A;  2BB4 A;  3EDX B;  3GIC B;  2Z3C A;  2BVR H;  2OLG A;  3IIT A;  1HAY B;  2R9P A;  3ZZ8 A;  1QBN A;  4GPG A;  1UCY E;  4ZHL U;  3SNA A;  1GCT B;  1MAB B;  2FWW A;  2QYI A;  2TGD A;  5HKK D;  4GHT A;  1A4W H;  1RGQ A;  3BSQ A;  2EI7 A;  3F9E A;  1M9U A;  1QIX B;  1YKT A;  4X0W U;  4CBN A;  3ZVC A;  1GBH A;  3UNS A;  4AGK A;  1C4V 2;  1ABI H;  1RIW C;  2C8Z B;  5DP3 A;  5EGM A;  4HMU A;  1MAY A;  4FUI A;  4D9R A;  2VWN A;  1C5X B;  3BEU A;  3GOV B;  4I33 A;  1DNL A;  1BDA A;  1S0Q A;  1TNK A;  4JZF H;  2O8T A;  1GBD A;  4ZHM U;  5EIY A;  5JBC S;  4B2B A;  2FI5 E;  2VIQ A;  2ZZU H;  1A7S A;  1NO9 H;  4B75 A;  3PV5 A;  1WUN H;  2WPL S;  2BYA X;  4DOQ A;  2JDI D;  1UTJ A;  3S9C A;  3BTT E;  1QY6 A;  3A86 A;  3C27 B;  3RU4 T;  4XSK U;  4Z6A H;  4AOR A;  1BT7 A;  4AFQ A;  4ISN A;  4ACB A;  2G4U A;  4UON A;  4RN6 A;  3AW0 A;  2C93 B;  7GCH F;  1O3A A;  5DGJ A;  1C5N H;  3TK5 A;  1C2K A;  4BNR A;  2KAI A;  1XUI A;  5JPM H;  1KDQ A;  1Q31 A;  1AKS A;  1W7G H;  2XNI A;  3ZZ4 A;  1W7X H;  1RZ1 A;  1V2Q T;  3HPT B;  2R0K A;  4PRO A;  3M7T A;  1INC A;  3HKJ B;  1OSS A;  3AK5 A;  2UWP A;  2K1Q A;  2FOF A;  2ZPS A;  3RMN H;  1USC A;  3HAT H;  4W64 A;  1VGC B;  3RXE A;  3EE7 A;  4A1V A;  1AVG H;  2GT8 A;  3R5P A;  4R82 A;  1GL0 E;  2GX4 A;  2FYR A;  1C1Q A;  2OBO A;  2XC0 A;  3P17 H;  1BRC E;  1NY2 2;  1P57 B;  5C0T A;  2H9E H;  3UNR A;  5TJX A;  1ZTK A;  2A2Q H;  3QK1 A;  4MPX A;  4DGJ A;  2GCH F;  1OWH A;  2DUC A;  3LGU A;  1ELD E;  2WV5 A;  4NFF A;  3GY7 A;  4NG9 H;  4E7N A;  3ZZD A;  1SMF E;  1THR H;  4Z1M D;  1GJ8 B;  1HIA B;  7KME H;  1XKA C;  1P2O A;  5GDS H;  1AFQ C;  3ZOC A;  1JBU H;  5L2Z H;  1HAX B;  3BTF E;  2BQ7 B;  4YLU A;  3ZOF A;  3A80 A;  1SLU B;  3M5N A;  1YGC H;  2CXV A;  1TPA E;  3QZR A;  2O8M A;  1WLI A;  1ZGI A;  1GJA B;  1ZHR A;  1ELE E;  1JRT A;  3H7T A;  3PLB A;  3NCL A;  1YYY 1;  2G5N A;  1ELT A;  1P12 E;  2AMP A;  1O2Q A;  2IJD 1;  1OWD A;  1EQ9 A;  2A1D B;  4WMF A;  2HNT F;  1MTU A;  3R5Z A;  1N8O C;  1DXP A;  1O39 A;  1BIO A;  5CHA C;  3SU3 A;  2ZCK P;  3S9B A;  3GDS A;  1QBO A;  1BRA A;  1P02 A;  3NRL A;  2ZCH P;  1P0S H;  3L3T A;  1MU6 B;  1XKB C;  3C1K A;  1SSX A;  2SGA A;  5CHO A;  3BF6 H;  5F8Z A;  1O3G A;  4TSF D;  4UEH H;  3DD2 H;  2BDI A;  4GCH F;  4F4O C;  3MMG A;  3PWB A;  2NU1 E;  4YZU A;  2FOA A;  2R3U A;  1ID5 H;  1WAY B;  2BXU H;  4UDW H;  6CHA C;  2VIO A;  2WSS D;  4TWW A;  2KCA A;  1LPZ B;  4FUB A;  1EAX A;  4I8L A;  1LHE H;  2AMD A;  2OC8 A;  2I6Q A;  2OTV A;  1MKW H;  2PR3 A;  1OYT H;  5FPS A;  1HV7 A;  1BA8 B;  1F0R A;  1YPH C;  3SV8 A;  2BY9 X;  1CU1 A;  1LKB A;  3MO9 A;  2W5E A;  3RXO A;  4YTA A;  2D38 A;  4B74 A;  3VXE H;  3QX5 H;  4UE7 H;  2J94 A;  2AH4 X;  2PGB B;  1CE5 A;  2VNT A;  1W0Y H;  2ZEB A;  5E0G A;  2VU8 E;  1I0S A;  1SLX B;  1CGJ E;  1EFR D;  1O31 A;  1FV9 A;  2NU0 E;  2ZFS A;  1BTW A;  2ZHD A;  1K1L A;  1RRK A;  3DMB A;  2OK5 A;  1P9S A;  1SQR A;  4Y7B A;  2HLD D;  3E16 B;  1GDU A;  3F0O A;  2UWO A;  4YOI A;  4CRC A;  5DP9 A;  4BAH B;  1ZSK A;  1WYK A;  2PHB A;  5EQR A;  4RSP A;  4ZKO U;  2O8L A;  3EAJ A;  1EAT A;  1AY6 H;  2O9Q A;  3FP6 E;  5AFZ H;  4AZ2 B;  2YNA A;  1NRS H;  3ATW A;  2NU2 E;  3SOR A;  2D1J A;  2NWN A;  3VEQ B;  3BTH E;  1IQM A;  2F3C E;  1HJ8 A;  2TIO A;  2F91 A;  5JB8 S;  1THP B;  1MQ6 A;  5KEC A;  1GWA A;  1TX8 A;  1IQN A;  4TPY A;  1AVW A;  1FI8 A;  1TWX B;  3F0P A;  4NIY A;  1P2K A;  1O3M A;  3DFL A;  1K9O E;  4O9V A;  2QXG A;  1DAN H;  1JMO H;  3DCL A;  2ZO3 H;  3EYD A;  1O0D H;  2I02 A;  1TQ0 B;  1GMC F;  4AB9 A;  3A7W A;  2W7S A;  3RC5 A;  1VJ9 U;  1WV7 H;  2TGT A;  5EXN A;  4ABF A;  3A8C A;  1QTF A;  1ABJ H;  1LHG H;  3ZZ7 A;  1UW7 A;  4GVU A;  2PKA A;  1L2E A;  3KQE A;  1YBW A;  5E0J A;  1GI9 B;  3DSG A;  1NBM D;  3MH7 A;  3KL6 A;  1PYT C;  1V3X A;  3ZZ6 A;  1EUF A;  1RFE A;  1HAV B;  2ALV A;  4KGA A;  1OWE A;  5IYT A;  1AWH B;  1DLE A;  1O5D H;  1F0U A;  2VVU A;  3UY9 A;  1V2K T;  2FOG A;  1K0H A;  3RXC A;  3F2G A;  3RXH A;  2QXH A;  1QQU A;  2ZHQ H;  3ELA H;  4K8Y A;  4CH8 B;  4TV4 A;  1DY8 A;  2HPQ H;  3RLW H;  1VGC C;  4JZE H;  4H42 U;  2X1J A;  1AND A;  1EXF A;  2W7U A;  3AAU A;  1RTL A;  1GBK A;  4WJG 2;  1T4V H;  1GGD C;  1EJM A;  2QN5 T;  1IQJ A;  3DUX H;  5H4I B;  3SU2 A;  1YPJ H;  1NPM A;  5C0U A;  5DO4 H;  1DE7 H;  1S85 A;  3P70 B;  2QGR A;  5JBA S;  1QB1 A;  1V2V T;  1QBV H;  2B7D H;  1LQE A;  1GBF A;  3I78 A;  5AVD A;  5EQQ A;  3VYA A;  1FJS A;  2ARZ A;  1EOJ A;  5KED A;  2JET B;  4AOQ A;  3IN6 A;  4XBD A;  3UNQ A;  3P8O A;  1FIW A;  1K28 D;  1VIT G;  4FUG A;  1WTH D;  3UTU H;  1P3C A;  2JH0 D;  1KLJ H;  2RG3 A;  3LH1 A;  3RXT A;  3TJV A;  5E0H A;  1Z1J A;  4HMV A;  4MPV A;  1XHN A;  1FLM A;  1GJ6 A;  2ANK H;  2FI4 E;  2G81 E;  3I77 A;  4YT6 H;  3H5C B;  5C94 A;  1L1G A;  2R2W U;  1AFE H;  1VJA U;  1GHA G;  2QE7 D;  3BEF B;  2IOT A;  4YT7 H;  1K1I A;  1X7A C;  1QA0 A;  1LHD H;  1O32 A;  1E79 D;  1DDJ A;  4B6E A;  1LO6 A;  1YF4 A;  2VIW A;  1SGY E;  3TH2 H;  1C2D A;  1IQK A;  1CQQ A;  5KGO A;  3F68 H;  1ZMN A;  3ENS B;  3ZV9 A;  1DWE H;  3N7O A;  3MH6 A;  7GCH G;  2FHQ A;  1AXJ A;  1AGJ A;  1A61 H;  4FU8 A;  2AS9 A;  3PMH B;  2ZPQ A;  1S0R A;  5FX5 A;  1P09 A;  2XCF A;  2W6I D;  2BY7 X;  1H8H D;  1NT1 A;  1SGF G;  1EPT A;  2QF5 A;  4WME A;  3HE1 A;  3SJO A;  3MNS A;  3CEN A;  1O2U A;  3SU4 A;  5K0H A;  3MNX A;  2D8W A;  3M35 A;  4NWL A;  4O97 A;  4RT1 A;  3ZYD A;  3M5O A;  1ZTL A;  5DP6 A;  3G01 A;  1K1N A;  1PPE E;  2A2X H;  4AG2 A;  2ULL A;  2Y80 A;  5IDK A;  1F5L A;  1EB2 A;  5LH8 A;  2RCE A;  4KTS A;  1W3R A;  3AAV A;  1ESA A;  2OBQ A;  2YMS D;  1C5Q A;  5EPY A;  3AW1 A;  5JYI A;  3BA3 A;  4XRN A;  2OL5 A;  3FZD A;  4INH A;  1GG6 C;  3HK3 B;  4MNV A;  3RXP A;  1QNJ A;  2ZG0 H;  3RM0 H;  3H09 A;  1Y8T A;  3PLK A;  3OY6 U;  1O2I A;  1YLN A;  2CK3 D;  1FPC H;  2A7J A;  2BD9 A;  3A8A A;  2WPK S;  5I25 A;  1NFX A;  1O5C B;  3GCT F;  3SND A;  6GCH F;  3TK6 A;  1SGD E;  2EEK A;  1XVM A;  2QCY A;  5C1Y A;  4SGB E;  1OX1 A;  1AVX A;  3M5L A;  1XVO A;  3TGI E;  1W3P A;  3A84 A;  1O2H A;  1MTW A;  3GYL B;  5HYO A;  2A4Q A;  3U8T H;  3VY2 A;  2PW8 H;  2FTM A;  2BD3 A;  3RXD A;  5GND A;  3S9A A;  1C1U H;  3RXG A;  4WY3 A;  1SGT A;  2SGQ E;  1WTG H;  1Z8J B;  1UTQ A;  1MQ5 A;  2QA9 E;  3ZVG A;  5E8E H;  4AGJ A;  1ELB A;  2Q6F A;  1TNH A;  4FXG H;  2XOK D;  5F03 A;  1ARC A;  4AG1 A;  2GZ9 A;  1VCP A;  3ZIA D;  4I32 A;  2FES H;  2VVV A;  5L6N H;  3U0I A;  1C1V H;  4U2W A;  3E0N B;  2ODP A;  2XW9 A;  3B23 B;  2ZFP H;  5FPT A;  1JOU B;  3QTO H;  2Q1J A;  5PTP A;  1D3D B;  3QN7 A;  1IQL A;  3LKW A;  3WWF A;  5JBB S;  1WDI A;  1IQG A;  2XND D;  1HAO H;  6LPR A;  1TA2 A;  4NIW A;  4X6O A;  1XX9 A;  3T29 A;  1UK3 A;  1T8O A;  4MDS A;  1B0E A;  1B7X B;  2ZFF H;  2RFK C;  1BMF D;  3UUZ A;  5EW2 H;  2C8W B;  1GCD A;  1UTN A;  1KXC A;  1ANE A;  1W3Q A;  2GMT B;  4H6T A;  1CGI E;  4GCH G;  2TGP Z;  1Y3Y A;  1BML A;  2BZ6 H;  1DWC H;  3LGI A;  1C2I A;  1HAH H;  3U5W A;  1Q3X A;  2QXJ A;  5DP4 A;  1ZRK A;  1FNI A;  3ATL A;  1C5O H;  4X1S U;  1NM6 A;  1GBC A;  3NFW A;  1QRZ A;  2V7Q D;  3SJK A;  2ZFR H;  4XJ2 A;  1FLE E;  2D2D A;  1RZ0 A;  1MTV A;  1THS H;  1G2L A;  5I46 H;  2P3T B;  2RA3 A;  3FN8 A;  4OS5 A;  1FX0 B;  1SQO A;  5FAH A;  1MMJ N;  3FFG A;  2ZEC A;  2XXL A;  5T6G A;  3JZ2 B;  1Z8R A;  3HMZ A;  2OC1 A;  5BPE A;  3B5M A;  3H7O A;  2X1K A;  3P8N A;  1O3L A;  2GKV E;  3A6R A;  8EST E;  1FN8 A;  3UOU A;  3UQV A;  4X2W A;  4MTK A;  1O3E A;  4QT8 C;  3ZVA A;  2XBV A;  3F9H A;  4LXB H;  1UO6 A;  2PSX A;  4I8K A;  2FPZ A;  2ZF0 H;  8GCH G;  3ZOG A;  1T4U H;  4GHQ A;  3SGQ E;  1HBT H;  3LGV A;  1AB9 C;  1S82 A;  3VB3 A;  3BNK A;  3URC A;  1AFQ B;  5DPA A;  3ZZA A;  3KN2 A;  5CDF E;  4BXS A;  1C4U 2;  3OYP A;  4NSV A;  4X8T H;  4ZAE A;  3SW2 B;  1C9P A;  2A45 B;  1V2R T;  4Q7Y A;  5EG4 A;  2FZZ A;  1ZML A;  3AWH A;  3OEE D;  1YPL H;  2GD4 B;  3HKI B;  1C9T A;  1BBR H;  2Q9K A;  1FMG A;  4D8N A;  1GMC G;  1PPF E;  1W0K D;  3Q3K A;  3PYH A;  1CT0 E;  1ZJD A;  2F9B H;  2FLR H;  1AZ8 A;  3V4H A;  1ZHP A;  2BD7 A;  1GJ4 H;  1OXG A;  1RD3 B;  3PO1 B;  2K8I A;  2XWA A;  1N8O B;  5DSF A;  5CHA B;  3VB4 A;  1V2J T;  1D3Q B;  2Y6T A;  1QR3 E;  2STB E;  2A2J A;  1GMH G;  2CF8 H;  2Y82 A;  4ZMA H;  4OS4 A;  3RML H;  1TY9 A;  1KTT B;  2SNV A;  4FU7 A;  1ESB A;  3UWI A;  1WGB A;  1C5T A;  2W26 A;  4AN7 A;  3URE A;  2BDG A;  6CHA B;  3K88 A;  4YM9 A;  1QFK H;  1HAZ B;  3MU1 A;  4Y0Y E;  3T62 A;  1C1M A;  3ODD A;  3BV9 B;  1Y5A T;  2ZHE H;  4I7Y H;  2VWL A;  1WU1 A;  2CV3 A;  1HIA A;  1FZZ A;  2VH6 A;  1LPK B;  3TGV A;  2BD5 A;  1CVW H;  4IW4 E;  5LPE A;  2BD4 A;  2W3K A;  2WPH S;  4SGA E;  3PTB A;  4A1T A;  2CHA C;  4A6L A;  5C5O A;  4E05 H;  3DNH A;  1MTS A;  4I8H A;  4YXW D;  1Z71 A;  4Z85 A;  2J4I A;  1O2T A;  4P00 A;  4E06 H;  1HGT H;  1Y5U T;  3SQE E;  4WVP E;  1NZQ H;  1TGB A;  2FOM B;  1CT4 E;  3PFT A;  3B9F H;  3RXR A;  4YES B;  3SUF A;  4OGX A;  3V7T A;  5GWZ A;  2A5A A;  1Y3W A;  3SUG A;  2P3F H;  1EOL A;  2ZFT A;  4WH6 A;  2STA E;  2J97 A;  1DXW A;  1CBW C;  1Y5B T;  3BTM E;  4ASU D;  2CJI A;  3EQ0 H;  1USF A;  2KCY A;  1QUR H;  3BN9 A;  3SU1 A;  3F3B A;  3RXA A;  2BHG A;  2PUX B;  1SGQ E;  2J34 A;  3STJ A;  5JBT A;  4FUF A;  2QF3 A;  1J9C H;  3SUE A;  3FAN A;  1TAL A;  1YPH E;  5FCR A;  4HI3 A;  1P04 A;  2KM0 A;  5ESB A;  2ED4 A;  1AN1 E;  2A7C A;  4Y79 A;  4X6M A;  1MCT A;  3SHA H;  2A31 A;  4WXV A;  4ABD A;  4BTT B;  4OGY A;  3PMB B;  2AMQ A;  3RU4 E;  3PMA B;  1UCY H;  1Y3V A;  4Q7X A;  1YP9 A;  3RMM H;  2PLX A;  4CH2 B;  5DN6 D;  3VXF H;  9EST A;  1HJA C;  1BJV A;  1OWJ A;  1V2L T;  5AHG H;  1TMT H;  4IS5 A;  1FY8 E;  1TMB H;  1DVA H;  1CO7 E;  2F9V A;  2GMT C;  2WZQ A;  4BAQ B;  1ETR H;  1JIR A;  2VH0 A;  2HPP H;  4Y8Z A;  1O2S A;  2GDD A;  3ATI A;  5E2P A;  2P3U B;  3MH4 A;  2ODQ A;  1OP2 A;  5FPY A;  2LNC A;  1SFQ B;  5CHE C;  1QCP A;  5FHT A;  4XD7 D;  1G2M A;  5TCA A;  2Z94 A;  1MKX H;  2DE8 A;  4X2Y A;  3SZE A;  1GHB F;  2JJ2 D;  2FLB H;  1YCP H;  4AB8 A;  1N6Y A;  1GI1 A;  1ZMJ A;  5HMA A;  3Q76 A;  2LP6 A;  3SU6 A;  1IQF A;  2L6O A;  2WPJ S;  3GCT G;  3GY3 A;  4Q2K A;  2BDY A;  3TH3 H;  4WWY A;  1GJD B;  5EST E;  5J4Q A;  1BRU P;  5LGO A;  1ETS H;  1K1J A;  3U28 C;  1O2R A;  1GGD B;  3ATK A;  1S81 A;  3K2U A;  3GIS B;  3VFE A;  2ZGB H;  1ORF A;  4I8J A;  3TH4 H;  3RXQ A;  1EP5 A;  2Q6G A;  1GJB B;  8KME 2;  4DII H;  3QDZ B;  2XBX A;  3EC6 A;  3MYW A;  4D9Q A;  2SNW A;  1BUI A;  2FX6 A;  3ZOH A;  1VKY A;  3I29 A;  3TPI Z;  3TNS A;  1L1N A;  3T27 A;  1DUE A;  1NRG A;  1O2V A;  3R0F A;  3M3S A;  2Z9L A;  3MO3 A;  1MUE B;  4TT3 D;  1VL7 A;  1WOF A;  4ABE A;  4GSO A;  1G78 A;  4ABH A;  4Y9I A;  4FOU C;  2A5K A;  1PPH E;  4JK6 A;  1AU8 A;  4ISH H;  4UFE H;  1HAV A;  1CA0 C;  5DKM A;  1BQY A;  4HMW A;  3SNE A;  7EST E;  1LDT T;  2KX4 A;  4NCY A;  2IAB A;  2GZ7 A;  1D3T B;  1UVO A;  1ZPZ A;  3HY8 A;  2QIQ A;  4Z0K A;  4EST E;  3SI4 H;  1EJE A;  1DM4 B;  3ZZ3 A;  3PO1 C;  1TX7 A;  1A5I A;  2XWB I;  4IBL H;  4WXI A;  1K2I 1;  3CP3 A;  1IHS H;  1TLD A;  5TCC A;  2J95 A;  1GVZ A;  5F8X A;  3KYF A;  1EB1 H;  2FI3 E;  1IHT H;  1OHH D;  3LIW A;  5FL7 D;  4NWK A;  1PPG E;  2ECU A;  1LHF H;  2ZTY A;  3ODF A;  4WMD A;  1G30 B;  3FO8 D;  1H1B A;  2OP9 A;  3UWJ H;  2HTD A;  4NZL A;  3FKH A;  2OC7 A;  4ZXX H;  2FG9 A;  1SOZ A;  2I6S A;  3RXL A;  1SGR E;  1SG8 B;  1W8B H;  3SU5 A;  1NS3 A;  1KYN A;  1O2Y A;  4ABB A;  3RP2 A;  3UPE A;  1A0J A;  1DIC A;  3RLY H;  1H9H E;  3E90 B;  1HDT H;  3LGT A;  4MPU A;  1ANC A;  1GG6 B;  4U01 A;  1YM0 A;  3KGP A;  1ELG A;  4Q4L A;  3VB5 A;  2V35 A;  2BY5 X;  1HPG A;  4H6S B;  3U9A H;  3SWJ A;  3D23 A;  2DE9 A;  3RMO H;  5JDU B;  2WYJ A;  3N7E A;  2BY6 X;  1OPH B;  2VBC A;  1YCP M;  3VPK A;  3BTQ E;  3V0X A;  4E7R G;  4IRA A;  2ZC9 H;  3U69 H;  5AF9 H;  3CP7 A;  1V2O T;  4DY7 B;  1CHO G;  1GI5 A;  3QO6 A;  4MPW A;  2M2A A;  1A3B H;  5L30 H;  4B71 A;  1HAI H;  1RTF B;  2BQ6 B;  4CRG A;  2VPA A;  1E1Q D;  5CMX H;  4HGC A;  7LPR A;  2BVX H;  4ABA A;  1UVS H;  2FO9 A;  4M7G A;  1O30 A;  1GMD F;  2BOK A;  1PQ8 A;  1T8L A;  3A88 A;  1AKS B;  4NA7 A;  5A8Y A;  1FXY A;  2HVX A;  3E4V A;  2PTN A;  2ZI2 H;  4X1P U;  2SGE E;  4A7I B;  1GJ5 H;  1O2P A;  4U32 A;  1TGS Z;  3SO3 A;  1G3E A;  3P95 A;  1E35 B;  3CS7 A;  1MTN B;  1TNL A;  4XHY A;  1O5E H;  2ZDV H;  3K65 B;  3PRD A;  4IN2 A;  1DLK B;  1QJ6 B;  1MKW K;  3RXJ A;  4AFU A;  9LPR A;  1WV4 A;  3NUM A;  5C67 A;  1Z8G A;  2P5Z X;  1FON A;  1Z6J H;  1HUT H;  1K21 H;  1ANB A;  1P2Q A;  1UTO A;  2ASU B;  1ELA A;  3RXK A;  1BTZ A;  1GHZ A;  2BDC A;  3MU0 A;  1TFX A;  4HZH A;  2A4O A;  3EA8 A;  3FAO A;  4NIV A;  1CI0 A;  2Y5F A;  3TK9 A;  1C2J A;  1FAK H;  1XM1 A;  2VIN A;  3SJI A;  4OS6 A;  3GY5 A;  1FY3 A;  2D5M A;  3KCG H;  1C2F A;  4FET A;  1HNE E;  2RDL A;  2NU3 E;  4KTU A;  4D7G A;  4JK5 A;  5ETX A;  2PWX A;  2G4T A;  5GPI B;  1MAX A;  4MG3 A;  1OYQ A;  2F83 A;  5EXM A;  2H5D A;  1Y3U A;  1NRP H;  4Q80 A;  1RTK A;  1SGP E;  4J1Y A;  2IPH A;  2W6J D;  1TNJ A;  4LZ1 H;  2XYA A;  2D26 C;  3BTG E;  1QGF A;  4AX9 H;  4M9F A;  1SFI A;  4LZ4 B;  2V3O H;  2GJG A;  1NU9 A;  4UD9 H;  2R0X A;  1QB6 A;  1ZLR A;  2WPM S;  4DCD A;  4MNW A;  4Q7Z A;  4IGD A;  4JZI A;  1H4W A;  5GIB A;  1T8M A;  1E37 B;  3RXB A;  5A8X A;  3ZZ9 A;  4X1N U;  6EST A;  1TX6 A;  1W0Z U;  3DA9 B;  1O5B B;  4JYU H; 
#chains in the Genus database with same CATH homology
 5KGO A;  4IRA A;  2L74 A;  1YOA A;  2D36 A;  2PTF A;  3ZOF A;  2FHQ A;  1AXJ A;  5ESC A;  3U5W A;  4RT0 A;  1WLI A;  4HG6 A;  3DB0 A;  2ASF A;  1G79 A;  3TGV A;  2IML A;  2I02 A;  3R5L A;  1W3O A;  2VPA A;  3EC6 A;  3GAS A;  3NFW A;  3H96 A;  2HQ9 A;  3DNH A;  2I51 A;  3FGE A;  4RT1 A;  3R5Y A;  4XJ2 A;  3ZOH A;  4HMU A;  1RZ0 A;  4F48 B;  3K87 A;  4Z85 A;  4P02 A;  4P00 A;  1DNL A;  3E4V A;  1Y30 A;  3U34 A;  1NRG A;  4QVB A;  3PFT A;  3DSG A;  2HHZ A;  1G77 A;  5EIY A;  1W3R A;  3R5Z A;  4HMS A;  3ZOE A;  3ZOD A;  1RFE A;  1VL7 A;  3BA3 A;  4XRN A;  4XHY A;  2OL5 A;  2HTI A;  3HMZ A;  2NR4 A;  3B5M A;  1G78 A;  2X1K A;  4Y9I A;  4FOU C;  3A6R A;  1YLN A;  5CHO A;  1YWU A;  1USF A;  2HQ7 A;  1G76 A;  2QEA A;  1WV4 A;  2D37 A;  4HMW A;  5EJ1 A;  2FUR A;  3U35 A;  4N7R C;  3A20 A;  2IAB A;  3ZOG A;  2X1J A;  3HY8 A;  4HMX A;  1W3P A;  1EJE A;  3BNK A;  3A6Q A;  3R5W A;  2ED4 A;  4HX6 A;  4YWN A;  3VY2 A;  2RE7 A;  3CP3 A;  3K86 A;  5EJZ A;  1CI0 A;  1RZ1 A;  4HMT A;  2ECR A;  3AWH A;  2D38 A;  3KYF A;  2R6V A;  2D5M A;  2Q9K A;  3F7E A;  3VY5 A;  2ECU A;  3VYA A;  1I0S A;  2E83 A;  2OU5 A;  1XXO A;  2ARZ A;  1USC A;  4L82 A;  4I86 A;  2HTD A;  3U0I A;  5KED A;  3IN6 A;  3AMF A;  3FKH A;  3BPK A;  3DMB A;  2FG9 A;  3CNR A;  1T9M A;  1JNW A;  2RDE A;  5JAB A;  3ZOC A;  2IG6 A;  3R5P A;  4R82 A;  4ZKY A;  5EJL A;  4HMV A;  1XHN A;  1FLM A;  5CHE C;  2QCK A;  3KYG A;  1WLK A;  4F07 A;  2AQ6 A;  3RH7 A;  2A2J A;  2GJG A;  1TY9 A;  3R5R A;  2R0X A;  3SWJ A;  1WGB A;  1W3Q A;  1W9A A;  1I0R A;  5BNC A;  3CB0 A;  4YBN A;  5KEC A;  3K88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...