2RDEA

Crystal structure of vca0042 complexed with c-di-gmp
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
224
structure length
224
Chain Sequence
VSTINSTDALAMVEHSSELTLSITTPVGTKFVCRTPFIGTHTDKFLLVEMPKISADDLQYFFQEGFWMNIRAISPRGEGALIHFRSQLMHILQEPVPMAFLSIPNTMQVSQLRKEPRFELNLAGKVLFDEHRGDCELRDLSRSGCRFITPPLGKTYQVGDLVALEIFSDLRGTKTFPPLTGKICNLQRSLHHARYGLEFNEEGRNNAKNLLAQLKFNGTKLTLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein VCA0042
publication title The structural basis of cyclic diguanylate signal transduction by PilZ domains.
pubmed doi rcsb
source organism Vibrio cholerae
total genus 42
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07238 PilZ PilZ domain
A PF12945 YcgR_2 Flagellar protein YcgR
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.110.10 Mainly Beta Roll Pnp Oxidase; Chain A Electron Transport, Fmn-binding Protein; Chain A 2rdeA01
2.40.10.220 Mainly Beta Beta Barrel Thrombin, subunit H predicted glycosyltransferase like domains 2rdeA02
4Z85A 4YWNA 1G78A 2X1JA 2X1KA 1AXJA 3AWHA 5KECA 4P02A 1W3QA 2ARZA 1T9MA 4N7RC 4HX6A 2I02A 2RE7A 3K87A 3U35A 2ECUA 5KGOA 5CHEC 3B5MA 2IG6A 3K88A 4I86A 3TGVA 1YLNA 1YOAA 5CHOA 1RFEA 3K86A 3DNHA 1W3PA 3DB0A 3R5YA 3ZODA 1W9AA 2A2JA 3A20A 1G76A 3KYFA 1DNLA 2I51A 1Y30A 3U0IA 4FOUC 3IN6A 2IABA 2FHQA 2FURA 2VPAA 4R82A 5JABA 2RDEA 3R5LA 2GJGA 1NRGA 1WGBA 2IMLA 3A6RA 3VYAA 3DSGA 1WLIA 2D5MA 5ESCA 3FGEA 4P00A 2FG9A 3ZOFA 3U34A 3U5WA 2D38A 2HTIA 4QVBA 2HQ9A 4ZKYA 4IRAA 1WLKA 3BNKA 3ZOGA 4F48B 1CI0A 3SWJA 2L74A 2R0XA 2QCKA 3AMFA 3NFWA 3CP3A 2E83A 4HMWA 2D37A 2HTDA 2ED4A 3DMBA 1RZ0A 3VY2A 4L82A 4HG6A 4XHYA 3ZOHA 5EIYA 4HMTA 5EJZA 1I0SA 3ZOEA 3VY5A 1RZ1A 3R5ZA 1USFA 2ASFA 3GASA 3BPKA 4RT0A 2NR4A 1XHNA 3F7EA 4HMSA 1JNWA 3HY8A 5EJ1A 2R6VA 3CB0A 4HMUA 1G77A 5KEDA 1W3OA 3BA3A 4XRNA 2OU5A 3R5WA 3A6QA 2PTFA 1WV4A 1TY9A 3PFTA 3R5RA 1I0RA 4YBNA 1W3RA 2Q9KA 3HMZA 3EC6A 2OL5A 1YWUA 2HQ7A 4XJ2A 5BNCA 3ZOCA 2HHZA 1VL7A 2AQ6A 2ECRA 3KYGA 1EJEA 4F07A 1G79A 1XXOA 1USCA 2QEAA 4HMVA 3RH7A 2D36A 3FKHA 4HMXA 4Y9IA 5EJLA 4RT1A 3H96A 1FLMA 3CNRA 3R5PA 3E4VA
chains in the Genus database with same CATH superfamily
1GMCF 4ISLA 4MVNA 3AWHA 1O37A 4J2YB 4ZKSU 2DE9A 1V2UT 3PTNA 1P2JA 2RE7A 1W13U 2F3CE 4BAQB 2B8OH 2JH0D 3SGQE 1C1SA 1YLDA 3MHWU 1A5IA 3PMAB 3A81A 3DD2H 1YLNA 4YOGA 1DDJA 1XXFA 1GJAB 1C5OH 3MO6A 3BIVH 4Q7XA 5DP4A 3HK3B 4CRFA 1G3EA 2FODA 1OS8A 4OS2A 1KXFA 1W9AA 1AD8H 4MQAA 2H2ZA 3KYFA 4DOQA 3IN6A 2FX4A 3GDSA 1HJ8A 1OP8A 1UJ1A 2OD3B 4Q7YA 2BDBA 1C2KA 2P8OB 2D1JA 3DA9B 3MU4A 1MTUA 1Y59T 2PTCE 2UUYA 3TH3H 1O5EH 1GBDA 1PJPA 5FHTA 1WLIA 1RS0A 3QTVH 1SSXA 3V13A 2C8YB 2KAIB 4BXSA 4NCYA 1MBMA 1Z71A 3I77A 4AX9H 1AN1E 4IRAA 2V3OH 3FANA 1W0JD 1EOLA 2FIRH 5A8XA 1CI0A 3SWJA 1LPZB 3MH4A 1C5WB 1S0RA 1T4VH 2ZTZA 1ZLRA 3C27B 3LDXH 2D37A 3PWBA 2A5KA 2RA0A 5LH8A 4X1NU 1AB9C 1JIMA 3M35A 1GG6B 1HJ9A 2D2DA 3GCTF 1J15A 2H9TH 2F9BH 3ENSB 1MKWK 1TPAE 2P3UB 3R5ZA 2ZECA 2QXIA 5F8ZA 1MD7A 2HNTF 2ANMH 2WUCA 1WQSA 1LDTT 1Y5BT 4NZQA 1MKXH 1ZPZA 2R6VA 1QQ4A 1ZPCA 2JJ2D 4HMUA 4RKJB 1DANH 4AYVB 1T4UH 1TBZH 1A7SA 1HAOH 1GDNA 2BDIA 2ZCLP 2PKSC 2ZC9H 1XUHA 2EQNA 4AC9A 3BG4B 1V6DA 2RCEA 2ANKH 3EC6A 1YWUA 2V3HH 3MOCA 2FOBA 1TNLA 3GS9A 1WQVH 2Y5FA 1SOTA 2YMSC 4NGAH 1TA6A 2ZDNA 3H96A 2ZGJA 1ZGIA 2FYRA 1DSUA 4JZFH 4IW4E 1SBWA 2G4TA 1O3HA 1GBJA 2HLDD 1ESTA 2AERH 4JYUH 4Z85A 2XBVA 1W10U 3NK8A 3RC4A 2WZQA 1AE5A 2FM2A 3NXPA 4J1YA 1CA0B 5TCAA 4GUXA 1F0UA 1ANEA 1K21H 2CJIA 1ZHMA 3H7OA 3OY6U 1C1QA 1NC6A 3PV5A 3QN7A 1EZQA 1C4Y2 1H1BA 1O3NA 2SNVA 2WPLS 1YM0A 4KKDA 3SU6A 3ZZ8A 4MNVA 2ZGHA 1C5PA 1ZMLA 1QQUA 4X2YA 5GDSH 4B2CA 3SHCH 2ZHDA 4M7GA 1DWBH 1GMHG 1JWTA 4OS4A 1C2EA 1WTHD 2WHXA 5FPSA 1BB0B 2R2WU 1NBME 1PQAA 8GCHG 2FOAA 2FG9A 4E7NA 4Q63A 2BTCE 2Y6TA 4XBBA 1KSNA 5GCHF 3BNKA 3V4HA 1GVKB 5FPTA 4AOQA 3PV2A 4MLFB 1J8AA 2A0QB 1QHRB 3KEEA 4H42U 1GBFA 1GI4A 1Y3XA 2W26A 5F8XA 3M5OA 1LHEH 1CHOF 3VXEH 3GCNA 1O3BA 1V2TT 3F9EA 3KQCA 2ASFA 1CGIE 2PV9B 5DG6A 1WYKA 1C5SA 3VGCC 3ZV9A 1D9IA 4TPIZ 1TPSA 1G2MA 1T8NA 4K69A 4ISHH 1FUJA 2ANYA 1O2NA 1ACBE 1F92A 3FN8A 4WJG2 4Z1MD 2BOHB 4X2VA 1FY8E 2Z9JA 2Z9GA 4UE7H 1AHTH 1SLXB 5EU8A 2ANWA 1DM4B 3HMZA 1KLTA 3GDVA 1PPZA 3PRBA 1YPHE 1QGFA 5C94A 3QO6A 3E6PH 4UD9H 3TGKE 2ECRA 1MKXK 1Q3XA 3UNQA 1EASA 4F07A 4DVAU 1G79A 3SNAA 1TYNA 3RH7A 2G51A 2AGIX 3LH3A 4ZMAH 3NUMA 1EFRD 1AVGH 4K3JA 2AYWA 1NFXA 1F5RA 1UVUH 3UQOA 3TK9A 1W12U 4O97A 4P02A 3ATKA 5EOKA 4BNRA 3PRDA 1D4PB 1SLWB 4Q4LA 1VITF 1KXAA 2IG6A 3ESTA 3ATLA 2RDLA 5EXLA 4CRCA 1J14A 5K7RA 2ODQA 1MTVA 3MH6A 1PPGE 2JJ1D 4HTCH 3SUFA 1QRWA 5AFZH 2A2JA 2NU3E 2Q6FA 3SZEA 1AVWA 1Y30A 3V3MA 3AW1A 1GMCG 3GY3A 1VCQA 3S9CA 1EB2A 1XKAC 3DSOA 3S7HB 1V2MT 5H4IB 2BD8A 5C1YA 3K6YA 3VYAA 1DY9A 4WY3A 3ZZDA 1QBOA 1BRBE 1ABJH 5SGAE 4Y0YE 1ZMJA 1NN6A 1FY5A 3W95A 1TX6A 2R0KA 3U5WA 2ZPRA 1GBHA 3A7ZA 3SU1A 3ZZ7A 1DY8A 3OYPA 2L74A 4ZAEA 2CGAA 3MNBA 2ILNA 4W64A 3BTDE 1GG6C 4WWYA 2ULLA 1G2LA 1L1NA 1GBBA 3P70B 1ANDA 2OQUA 3EA7A 4GSOA 3HKIB 1YPKH 4TWWA 2CN0H 4ZUHA 1I0SA 3LGVA 2CF8H 3DCLA 6CHAB 1Z7KA 2FOGA 4Z0KA 2W3IA 1WV7H 1GI3A 1Y3UA 3O8RA 4HMSA 3ZZ5A 3A88A 1QA7A 2AEIH 3CP7A 2FS8A 1O34A 3RMMH 1YPHC 1FQ3A 1C5ZB 2FTLE 3SBKA 1SFIA 2F83A 1FIZA 1FAKH 3TU7H 4CHAB 3GCTG 1FAXA 2F9OA 1E1RD 3NRLA 2HALA 3BG4C 3SUDA 4O3TA 4UHVA 2AIQA 4X6MA 3A7XA 2CF9H 4ABIA 1QNJA 3JZ2B 1QFKH 2PKAB 1GI0A 2VIQA 2VVVA 4BTUB 3ZZCA 2WV5A 3SU5A 1A3EH 2D8WA 1ORFA 1TMBH 2C3SA 2JETB 3MH7A 1D3QB 1O2YA 1BDAA 3CNRA 1E79D 2PP6A 5DP5A 1P04A 5BPEA 3R5PA 5AVDA 1F5LA 2Z3EA 4RI0A 2X1KA 2WYJA 2HOBA 3BTEE 2ZFFH 1WU1A 5EQSA 1SVPA 1QA0A 1S82A 1C1PA 3A8AA 3RXPA 3PB1E 2HGTH 2ZU2A 3U8RH 2OCVB 1O2LA 1UCYE 1SC8U 3RXOA 3HE1A 4K8BA 1TQ7B 3UWIA 1EPTB 3LC5A 1VITH 1VKYA 2IABA 1DOJA 5F03A 4Y8XA 1BTYA 4D9RA 5JABA 5CHAB 1AY6H 2BY5X 7LPRA 1H8IH 1CA8B 1PYTD 5EQRA 2IMLA 2WPDD 1GBAA 1HRTH 3BG8A 1Q31A 5DKMA 2QXGA 1LPGB 2WPHS 1GHYH 3A84A 4MPXA 1NRPH 7ESTE 4X8VH 1HFDA 4BAMB 2QCKA 2B7DH 1EZSC 1GI1A 1O3PB 3FP6E 1CT4E 3RMOH 1FPCH 1QR3E 2ALVA 4L82A 4X8SH 3ZYEA 2A45B 2BLOA 3W1EA 1ZZZA 2ZWLH 4Y10E 1LKBA 2A2QH 1WTGH 7GCHF 4CRGA 2QV1A 1Z1IA 4PROA 3ZOEA 4CRAA 2HRVA 1SHYA 1USFA 4CREA 5GCHG 1BZXE 2WINI 2Y7ZA 2FOMB 1BTHH 4INKA 3MWIU 5EJ1A 1O3IA 1C5TA 1D3PB 5HM9A 3BA3A 1UTMA 1CQQA 4YZUA 3GY8A 3M36A 5L2ZH 3SJOA 4MDSA 1QIXB 1UMAH 1CHOG 1I0RA 1SI5H 1NY22 3UQVA 3K6ZA 2AMQA 2GTBA 3SU4A 3SV8A 1O30A 2AMPA 2XOKD 4INHA 3LGWA 1GI7B 1CT0E 5J4SA 3O8DA 2J38A 1W14U 2HVXA 1DWDH 3OEHD 4U30A 2JDID 1B0EA 3G01A 3P8OA 3TH4H 1A4WH 1UVPA 1XM1A 1O2TA 3CS0A 1EAIA 3F6UH 3NZIA 2G4UA 2ARZA 4ZHMU 2W7UA 3K87A 4X0WU 1C9PA 4X1SU 1BMFD 1DLKB 2M5TA 3A8CA 3TGVA 1IQFA 1E36B 2OUAA 1B5GH 2GX4A 3A80A 2K4QA 1SPJA 3ZVDA 4ESTE 2TIOA 3MU1A 3RU4E 1V2NT 1UK4A 3RM2H 3RXSA 1J16A 2ZEBA 3PO1C 2I51A 3T28A 3VB3A 4CH8B 1FN8A 3PTBA 1CGHA 1TPPA 3Q76A 4K60A 4MNWA 3ZVEA 2UUKB 4FUBA 1EB1H 5GPIB 1CGJE 1WUNH 1BUIA 1P02A 3A7YA 4U2WA 5C3NA 5HYOA 2NU4E 1VITG 1P0SH 1UTKA 3SOSA 2GCHF 2P93A 1OYTH 1ZSLA 2O8LA 3UB0A 1YP9A 1T8MA 1MTSA 1O2ZA 1W7GH 1O31A 3BIUH 2BLWA 4FUGA 2FOEA 3ZOFA 1HV7A 2J34A 1LVBA 2J9NA 2WV4A 4ZXXH 3FZDA 2PW8H 3IG6B 1K1MA 3F9FA 2SGEE 2W6JD 1S83A 4WMDA 3OAAD 2UWPA 3SV6A 4HMWA 1EP5A 3M5MA 3URDA 1FXYA 5CMXH 2IPHA 2W5EA 1GMDF 2P16A 1UTNA 1EXFA 1SB1H 4NIVA 3S9AA 4Y76A 3LJJA 1P06A 3RXAA 6CHAC 3SW2B 1MTNC 2F4LA 4U01A 5CDFE 2YNAA 1IQIA 3S0NA 2OC1A 1MD8A 2BXUH 1TWXB 3F7EA 3WW7A 1N6XA 5A09A 3ZZ6A 4CHAC 3U8OH 2ZDVH 1C5LH 1VCWA 2QXJA 2V0BA 3Q3XA 5B6OA 3VB5A 3A6QA 2RG3A 5E2OA 3ZVGA 2CHAB 1HJAB 3I29A 1O3CA 1ZRKA 4ABGA 1SGRE 4B71A 2HQ7A 3FP8E 1DFPA 3ZOCA 4HI3A 1BRUP 1P12E 2WV9A 3KN2A 2J4IA 4I7YH 2F9PA 1O2XA 1ETTH 3BF6H 2JETC 3RMNH 3M7UA 2Y5HA 1SLUB 4Y9IA 5DSFA 4X8UH 1MQ6A 1TX7A 1YPGH 4ABHA 2EI8A 3SGBE 1GHAG 4JZEH 1O3JA 3AW0A 2Y80A 1AXJA 4ZHLU 2ZIQH 1BJVA 3MNCA 3WWBA 3MTYA 4NIWA 1W3QA 2GMTC 2ZGCA 2WUBA 4UFDH 5CHEC 2V7QD 3LGTA 3HKJB 3N99A 1PPEE 1E37B 1S84A 1QRXA 1RD3B 2ZI2H 2F9VA 1NRSH 1TB6H 1O3LA 1W8BH 1SG8B 4B1TA 5CHAC 2JIZD 4DGJA 1HUTH 2R3YA 3KCGH 1KDQA 3QTOH 1LVYA 1UK3A 3N7OA 4XSKU 2VGCC 3TJVA 4VGCB 1HAGE 4AGKA 4AORA 1COWD 2VU8E 1AVXA 2EY4C 5ESTE 3DSGA 3FZZA 1TNIA 1QTFA 3FFGA 4AFSA 1Y3VA 3U34A 1H9IE 1BITA 3P8FA 1T8OA 2ALPA 1TOCB 2OXSA 1ETRH 2XCFA 1KYNA 1LHGH 3BV9B 3KQ5A 2LP6A 2O8UA 3MH5A 1GHBF 1XKBC 3BTME 1FJSA 1GBKA 3RLYH 2BD2A 1A5GH 4TYDA 1GJDB 1SGIB 1PFXC 4B2BA 4NWKA 3SI3H 1CVWH 2IPQX 4UFFH 2P5ZX 3RXDA 1HAVA 4GAWA 3RXBA 1QCPA 1C2DA 2XBYA 3BTWE 1SMFE 4Y71A 2EI7A 1Z8JB 5B6LA 3UUZA 3UFAA 1MU6B 2F91A 1C1TA 2ZCKP 2ESTE 1V2RT 2GV6A 4IC6A 2ZCHP 1UHBB 4YT6H 2QAAA 2XCNA 2BDAA 1ANCA 2OBQA 4AYYB 1BTZA 4NZLA 2CMYA 2ZDAH 3ZVBA 1KXCA 7GCHG 1Y12A 1DPOA 4A1XA 1NFYA 3LU9B 5JBCS 1WXRA 1BTUA 4R0IA 2AFQB 1VR1H 1NTPA 2L6OA 2OL5A 3SQHE 1SGFG 1TA2A 2ZNKH 4ZKOU 1DXPA 3NCLA 1FIWA 1VL7A 3UOUA 3E0PB 2H9EH 4FETA 4FU7A 2GT7A 1O39A 3T25A 1USCA 4MPVA 2QEAA 2XC0A 2VB0A 1O2IA 2AGEX 2C8WB 2WSSD 1EAXA 3T26A 4KTCA 3F1SB 3TJNA 3U9AH 2VWOA 4CRBA 1HXFH 3TLOA 3WWFA 1RJXB 4BOHA 3KNXA 1RGQA 4FU9A 1TMTH 4DY7B 1QB9A 1G78A 1W0ZU 4H6TA 3UR9A 1GI9B 3QLPH 2CXVA 1T9MA 1E0FD 4HX6A 4AZ2B 1EAUA 5FX6A 8ESTE 2AIPA 2ECUA 1BIOA 1D6RA 2YMSD 4H6SB 2STAE 1AMHA 1THSH 1GI5A 1IHSH 1RFEA 2BYAX 3ZODA 3BEUA 2P3FH 3DSPA 3P8NA 1AE8H 1NRRH 3RMLH 1GBCA 3U0IA 2OQ5A 1NU9A 3UNSA 3VG8A 1GJ9B 2FWWA 1NFUA 3H7TA 2FHQA 2VPAA 3LPRA 3NPSA 1OPHB 4CR9A 1GHXH 2AMDA 3CENA 1EUFA 3ZIAD 5FCRA 4RSPA 2G52A 1N8OC 1O2HA 3EA8A 3F3BA 1CT2E 1O3DA 1DWEH 3FGEA 3SORA 1YC0A 2V3MA 2A4OA 1PQ5A 2FMJA 1ZMNA 4ZKYA 3LJOA 3QX5H 3GY2A 1O3KA 3RXCA 3LH1A 1Z8RA 2PSXA 1SKYE 2BD4A 2GCHG 1TNHA 3F0OA 2G5VA 1W3CA 1BTXA 3A87A 5EIYA 4ISIH 5DPAA 1TFXA 5GXPA 3LGYA 1GJBB 3VY5A 1AKSB 1HPGA 1MBQA 1OWKA 2ODPA 2JH5D 5JBAS 1H8ED 1OKXA 2BY9X 5CE1A 2OC0A 4AGJA 3BTHE 3GISB 2HVYB 3N7DA 1BJUA 2OTVA 1IHTH 3ZV8A 3FOAA 1BMNH 5LGOA 1BTWA 4F4OC 3CB0A 1GHVH 1GMDG 2VH0A 1TGBA 4OS1A 4YT7H 2CHAC 1HJAC 5EXNA 4TT3D 3SV2H 3HK6B 3RUOA 1YCPH 4JK6A 5JPMH 1H8HD 3T2NA 1OHHD 1ELGA 1GDQA 2H6MA 2F9NA 2LPRA 1QB1A 2KAIA 1KTSB 1C2LA 1V3XA 1WAYB 2BY6X 3SUGA 4JZDH 1P2OA 1UHBA 3F0PA 4HMVA 1GL0E 1A0LA 4HMXA 1D3TB 3OSYA 3RXTA 1Z6JH 3U69H 1A3BH 1AU8A 4ABBA 8LPRA 4YWNA 1FY4A 2X1JA 5JB8S 2I6SA 2WPMS 2ZU5A 1IQHA 4INLA 4FVBA 3KGPA 2A7JA 1BRAA 4RKOB 1P09A 1TGCA 3EYDA 4BAKB 3K65B 3PROA 3KHVA 4NSVA 1F7ZA 3L33A 1C5MD 3DNHA 3U98H 2XXLA 3FVFB 4Q80A 5DO4H 2GDDA 3R3GB 1G37A 1FY3A 4MG3A 2BY7X 1O36A 2SGFE 3D23A 1FONA 5AFYH 1UTLM 1BA8B 5FX5A 1IQJA 1HBTH 1TABE 1MZAA 3E0NB 4VGCC 1G3DA 3R5LA 4DCDA 4DW2U 3RP2A 1UW7A 4IN1A 4K5ZA 4XDEA 4Y0ZE 3VEQB 2D5MA 2C8XB 2TBSA 2XYAA 2BXTH 3MMGA 3A83A 2R0LA 1PPFE 2FOFA 2FOHA 4KTSA 1AWFH 3M5LA 3A89A 1P2KA 3GYLB 4ACAA 3AMFA 4U32A 1ZSKA 2P8OC 2QF3A 3BN9A 3LOXA 1TMUH 1P2QA 2A5IA 3PM3A 2RFKC 1IQGA 1ARBA 3OY5U 1TAWA 3GCOA 1X7AC 3A8BA 4K1EA 4RT0A 5JBTA 2BZ6H 3SU2A 1H9HE 1SGEE 1ID5H 1O2GH 1TLDA 1GHBG 1HIAB 5C2ZA 3Q3KA 1C5YB 1RTLA 5KEDA 2A1DB 3DFLA 3PFTA 1KXBA 2VBCA 2VJ1A 1AKSA 4HZHA 3RXHA 1O35A 1T32A 3UTUH 1TNGA 2V6NA 5E0GA 1ELDE 3SUEA 4A6LA 1KIGH 1O3GA 2BB4A 4ZKNU 2NU1E 2FI5E 1LVMA 4B6FA 2QF5A 1YCPK 1P3EA 1AQ7A 4XBDA 2RA3A 2BMGB 1C2GA 1NZQH 1QL9A 1ANBA 4Q2KA 1O33A 1YPEH 1AGJA 1NFWA 1GPZA 2BM2A 2IOTA 4I8HA 4NIYA 4OGXA 5ESBA 3MO9A 4HGCA 1B7XB 2NU0E 1JOUB 1WDIA 3A85A 2KR7A 1A2CH 1GBIA 5CHOA 3F2FA 3TVJB 4GHTA 5AHGH 1DITH 4XD7D 3SV7A 3A20A 1BMAA 4TY6A 3RXEA 1HAYB 1O5DH 3DHKH 3T29A 2G8TA 1KLIH 3EE7A 1CBWB 4XOJA 4I8KA 1ZJKA 1CA0C 1TONA 1EP6A 1QBNA 2G00A 2TGTA 1WGBA 2BD5A 1QBVH 3A8DA 2Z3CA 4P00A 3GY4A 4FU8A 1O3EA 1A1RA 2ZGXH 2BLVA 2BHGA 2ZHFH 2R2MB 2VINA 4WVPE 1SGPE 2FI3E 4X1QU 3A86A 5GJ4B 3SYJA 2FOCA 2VH6A 1U6QA 4UFEH 3CP3A 3VFEA 3SJ8A 3S9BA 3OX7U 3V7TA 1HDTH 2UWOA 1TGNA 5EW2H 2QYIA 3GY6A 5HIZA 3FP7E 1C5NH 1XVOA 2F9UA 1Y3YA 3UY9A 3TGJE 1K1JA 2AHME 2HNTE 4LZ4B 1Y5UT 1MCVA 5C17A 2Y7XA 5DP9A 3BEFB 5C67A 1BBRH 3OTJE 4BTTB 4K8YA 3TITA 1RTKA 1EQ9A 1GCTB 3SGAE 1G77A 2A5AA 5E8EH 1W3OA 2OU5A 4FUDA 3R5WA 2PTFA 2BQ7B 3R5RA 5L6NH 2BDYA 1C2JA 1MQ5A 1TBRH 1WCZA 2B5TB 4Q7ZA 4TWYA 4FUIA 5DP6A 5I25A 1IOEA 5E2PA 2G5NA 1EZUC 4X6OA 1PYTC 2GD4B 3Q00A 1S85A 2FEQH 2PSYA 1O3OA 1XXOA 2SGQE 4O9VA 2QGRA 2D36A 1YYY1 4KP0A 2ZGBH 1C2HA 5EG4A 3RC6A 1GJ8B 2QCYA 3ZZ9A 3BTGE 1HXEH 1FPHH 3RXUA 3RXGA 1D6WA 3SJKA 5C5NA 3E8LA 3W94A 3RXFA 1NM6A 1C5RA 1OX1A 2HLCA 2THFB 3QZQA 5C20A 2A7HA 4A7IB 4DT4A 1GI2A 1C5UA 3O8CA 1T7CA 3UNRA 2K8IA 1GVZA 1ELFA 3K86A 2VNTA 4Y11E 3UPEA 1ZTLA 2C93B 2J95A 4ZCNA 1VJ9U 1EZXC 1N1LA 1G76A 4Y79A 2GZ8A 2XWBI 1DICA 1P01A 6LPRA 2G81E 5A8YA 1BCUH 1UVOA 3VPKA 1C1MA 1RFNA 2FESH 4AFQA 1ZJDA 2OC8A 3PLBA 3T62A 3SU3A 1AFQB 1E38B 2PKAA 2FS9A 1RRKA 1K1PA 5ESCA 4ASHA 1N6YA 1JMOH 1K2I1 2VVUA 1GGDB 1EJNA 2WYGA 4YESB 1LVOA 2SNWA 2BX4A 3GICB 1YPLH 4CBOA 1OWIA 2HNTC 2FLRH 4D9QA 1TGSZ 1C4V2 4FUFA 2FP7B 1L1GA 1KTTB 4UDWH 4GPGA 4NFEA 4SGBE 1ZSJA 1DXWA 3FO8D 1ZYOA 1SL3A 1V2KT 1MCTA 1SQOA 3ATIA 3EDXB 4KTUA 4HMTA 1GBEA 1QRZA 3RXIA 2J5UA 1RZ1A 1F0SA 2VIPA 2AS9A 2XC5A 3LONA 3N7EA 4AFUA 1BHXB 4WXIA 4XE4A 1MH0A 1LTOA 1EPTA 4E05H 1XVMA 1GHZA 2SFAA 2BDGA 4DIHH 5LPRA 1SQTA 1YPMH 2UWLA 3RXQA 1C5QA 5T6GA 2A4GA 3NWUA 1Z1JA 2ZTYA 1RXPA 1TIOA 4HKHA 1S6HA 4ABJA 3HGPA 5DN6D 1XXDA 1BBRK 3P8GA 3P17H 3KQDA 3DFJA 2AQ6A 2ZU4A 1C4U2 1P10A 3SNDA 3M5NA 1ZRBA 2XBWA 3A82A 1DT2A 2ZDLA 2ZHWH 2VWLA 1UTQA 1NESE 2EI6A 4MNYA 1IQKA 5J4QA 4NSYA 2AGGX 1HAXB 1JIRA 1K1IA 3NKKA 4FUEA 1P05A 3PWCA 2UUJB 3E3TA 1TALA 3IWMA 4ASUD 4N7RC 6GCHF 4H4FA 9ESTA 2ZHEH 1Y8TA 3PMBB 5KGOA 2OK5A 1GBTA 1Z6EA 3U1IB 2A31A 3DB0A 1TPOA 1THPB 1SGYE 4B2AA 2PLXA 5C1XA 1G36A 1DNLA 2TRMA 4B74A 1ELEE 2GKVE 3DT0H 3SNEA 1V2QT 1HCGA 3BEIB 1FV9A 3B23B 4Y7AA 2FURA 1L1JA 1UK2A 2BDCA 2ZFPH 2DUCA 2GJGA 3E90B 1F0TA 4E7RG 4ABEA 2H5CA 3MNSA 4DIIH 5AF9H 2XNDD 1SFQB 1FY1A 3EAJA 1UVSH 1UVTH 1XUJA 2P95A 5C5OA 3GY5A 2D38A 1EPTC 3E1XB 3ZVCA 4QT8C 1BMLA 1OXGA 3VGCB 1CO7E 5T1VA 4TSFD 3ZZ4A 3Q77A 2Q6DA 1BRCE 2ZFRH 4BTIB 3ODDA 5PTPA 1HYLA 4AG1A 2XBXA 2E83A 3M7QA 4E06H 1GJ7B 5T3HA 2WPIS 4GCHF 2OP9A 2FLBH 2PHBA 3F2HA 4GHQA 1EOJA 3QK1A 1TNJA 5C1UA 4BAHB 1DUEA 1NS3A 3K2UA 4JK5A 1ELCA 1AWHB 2I6QA 3U8TH 3ZVFA 5L2YH 1S6FA 1GCTC 1V2WT 4IGDA 1DE7H 4ZROA 2LNCA 1W7XH 5F6MA 1DVAH 2JH6D 1WV4A 4X2XA 1TBQH 1EJAA 2PUQH 3TGIE 2BQWB 2L1TA 2WPKS 4A5TS 4JMYA 5K0HA 2HPPH 5E0HA 3UOPA 1O5GH 1S81A 4NA7A 1SGCA 3SV9A 3EAAA 2VIDA 3VB7A 5BNCA 5HIYA 3TPIZ 4D7FA 1EJEA 1TOMH 2J98B 1T31A 4X1PU 3GDUA 2GDEH 1FLMA 5C0TA 1THRH 1ZHRA 1P8VC 2B9LA 1C9TA 2ZKSA 3BTKE 3EE0B 1OWHA 1BMMH 1DS2E 1OP2A 1W2KH 4F55A 4SGAE 5CHBA 1CE5A 1V2JT 2AH4X 4ABAA 4FVDA 5EW1H 4I86A 5C0UA 5EGMA 3C1KA 1MAYA 2KZ4A 1FNIA 1YKTA 4UFGH 2FYQA 3SNBA 2EC9H 2ZZUH 4AB9A 1O5CB 1FDPA 2C4FH 1WBGB 3F9GA 1V2ST 4I33A 1HLTH 2WPJS 3B9FH 1L0ZA 3F68H 2W6ID 2Z7FE 2BVRH 1J17T 1NT1A 1WOFA 1H8DH 2XWAA 5HXFA 1O3AA 2GZ7A 1GJ6A 2ZQ1A 1XUKA 5FPYA 3IITA 1KXEA 4K2YA 1AFQC 1TRMA 3SU0A 1ZTKA 5LPEA 3QGNB 1V2LT 3A6RA 2YNBA 1GI8B 3LGUA 1FZZA 4ABFA 5LPFA 3SZNA 2IJOB 1P3CA 4DJZB 1TNKA 1GGDC 2A32A 3RLWH 3RXJA 1GI6A 1ZHPA 1QB6A 3ODFA 2O8TA 3HGNA 1O0DH 3ELAH 4F48B 2JKHA 5GIBA 4R8TB 1KY9A 1QURH 1K28D 3SQEE 1ETSH 2QA9E 2BY8X 1QJ7B 1UTJA 4IMQA 1L4ZA 2PR3A 1O2UA 1B0FA 3MQKC 4JCNA 3SN8A 5IYTA 2BVSH 3KL6A 2CV3A 2LELA 1J9CH 1BTPA 3F2GA 3TK5A 2BD7A 3KIDU 1XUFA 4BAOB 3GASA 1PPHE 3BPKA 1IQLA 1XUGA 2NR4A 1G3BA 1SGFA 6ESTA 1W11U 5IK2D 2QF4A 2QXHA 4AG2A 3AK5A 1DLEA 1HAHH 3MU8A 4IBLH 1YY3A 2R3UA 4FUJA 2A4RA 1TY9A 3V0XA 2IJD1 1O2QA 3RXVA 1XX9A 2H1UA 4THNH 4WMFA 4IS5A 8KME2 5FXLA 1A0JA 1ZTJA 3TIUA 2SGDE 1OP0A 4YTAA 1ESBA 5EJLA 1EATA 1DWCH 1EJMA 1UTOA 5I46H 1MAXA 2BLQA 4D7GA 1V2VT 1NRNH 1L2EA 5GNDA 2D26C 2ZPQA 1UO6A 4RN6A 2BVXH 1VZQH 1AUJA 3STJA 2G55A 2J98A 3MU0A 5EODA 1TX8A 5EPNA 1Y5AT 3RXMA 1V2PT 3PYHA 1XMNB 5A0BA 3ZZAA 1HGTH 1MMJN 2W3KA 3QGJA 2PGBB 1ELTA 2DE8A 1VGCB 6GCHG 3STIA 1MTWA 4X6PA 3L3TA 1UCYH 3FKSD 3L6PA 3RC5A 2PTNA 5A8ZA 4XFQA 2P59A 1S5SA 3ZZBA 1JRSA 2FXRA 1CSOE 1Y3WA 1XUIA 1YCPM 1G9IE 2PGQB 3MI4A 2Y5GA 4NIXA 2Q6GA 1LQDB 1P9UA 4YOJA 3ZOGA 5EQQA 4TY7A 2C90B 4X2WA 2R0XA 3GCHB 3PLKA 5ABWA 2KCPA 5GWZA 1QY6A 3KF2A 1K1NA 1M9UA 3HPTB 2ZF0H 1GJCB 5TCCA 1HNEE 1O2VA 2BQ6B 2KCAA 5FL7D 2ZFTA 1JRTA 3BTTE 2O8WA 1FX0B 4NFFA 4Y8YA 3ATMA 1DX5M 1YBWA 2FO9A 2OINA 4F49A 1QJ6B 2O8MA 1NBMD 2H5DA 1XHNA 1GBLA 1OOKB 2ZFSA 1JNWA 3SHAH 5HMAA 4AN7A 4GCHG 1IQMA 1NO9H 4NA8A 2FDAA 1OSSA 3RU4T 1HAZB 4YXWD 3AVZA 2GV7A 5JB9S 3I78A 1K0HA 2P94A 2Q9KA 4Z6AH 4Y7BA 4OGYA 3S7KB 3M7TA 3TJOA 1OWEA 1E35B 5E0JA 1RIWB 2QE7D 1LMWB 1W0YH 3M3VA 2BZAA 2GP9B 2TGPZ 5G4BA 1LKAA 2QF0A 1LHFH 1K1LA 1SLVB 3PO1B 4TV4A 3P6ZB 2Z3DA 1ZOMA 5DGJA 2KFWA 3E4VA 1HB0B 1ESAA 2KCYA 1O38A 5T6FA 3Q3YA 3MFJA 2ZU3A 4NA9H 3U35A 1INCA 1P2NA 4IMZA 4CR5A 3B5MA 4YM9A 3K88A 2PFEA 1WSSH 1YOAA 4XBCA 1O32A 4KELA 1W3PA 3ZZ3A 1F5KU 1LPKB 1SGQE 3CS7A 2BX3A 3TNTA 1AFEH 1FN6A 2OLGA 1TE0A 1O2OA 1AI8H 2HPQH 1KLJH 2VIVA 3QUMP 4K1TA 2C8ZB 2ZA5A 1P2MA 2PUXB 3GOVB 4UONA 4OS5A 2QY0B 1KMHB 2VVCA 1O2WA 1ELBA 1S6LA 3UIRA 2KX4A 3HATH 3K9XB 1W0KD 3E91A 1MTNB 1TRNA 2IN2A 1CU1A 4JYTA 3BTFE 4ABDA 3M3SA 4WMEA 2OBOA 1SGTA 4K1SA 1AZZA 2ZHQH 3MYWA 1C1OA 2PWXA 2ZTXA 4WXVA 4DURA 5A0CA 3T5FH 4LZ1H 1UCYK 5JDUB 1C2IA 1HAPH 2XRCA 1RZ0A 2FX6A 3A7VA 1A46H 3ATWA 1BHXF 4KGAA 5HGGA 3TNSA 1GHAF 4JYVH 5F53A 4MPWA 1O5FH 1C1WH 4D76A 3ZOHA 4I8GA 3SJIA 1FI8A 3MU5A 2GCTB 1Z8GA 1VCPA 3URCA 4MNXA 2Z94A 1SGDE 2GVFA 2CK3D 2ZU1A 1K1OA 2Y81A 1G32B 3HY8A 5F8TA 1IAUA 3VB4A 3A7WA 5FBIA 3TJUA 9LPRA 1YGCH 4MTKA 1JXPA 1O2JA 1BOQA 2ZDMA 1W3RA 4ISNA 1MZDA 1OYQA 2GMTB 1EX3A 3H09A 3M37A 4BXWA 2KM0A 4GVUA 3LGIA 2Z9KA 1AO5A 3AASA 3QWCH 4LK4A 1E1QD 1C1RA 3JZ1B 2UUFB 4IC5A 1RTFB 2GUJA 1F0RA 2K1QA 3UWJH 5DJ7A 1PQ7A 2TGDA 1P2IA 4LOYH 2A2XH 4FUHA 1AZ8A 4RT1A 4HFPB 1LCYA 4X6NA 1SHHB 2FTMA 1PQ8A 1IQEA 5EPYA 3U1JB 3SJ9A 4TPYA 2O9QA 3SI4H 3SO3A 1C5VA 2VGCB 1C2FA 1BT7A 3GY7A 1ZPBA 1GBMA 1FLEE 2FI4E 2J2UA 3P92A 2FPZA 4BANB 3O8BA 1O3FA 3R5YA 2XNIA 1HIAA 2ZDKA 2GGVB 2TGAA 4ISOA 3DUXH 1ELAA 1SOZA 2V35A 1GDUA 1GVLA 2TPIZ 1QZ8A 1VGCC 1IQNA 1O2PA 2BOKA 2QIQA 3EQ0H 1O2SA 1C5XB 1EAWA 1PPBH 2R9PA 5DK1A 4R82A 1MU8B 2RDEA 3V12A 3RDZA 1V2OT 4FUCA 4YLQH 5A0AE 3M3TA 4YO9A 3PMHB 4YOIA 1NRGA 1GHWH 4ZKRU 3RM0H 4JZIA 4X1RU 5IDKA 3TK6A 4JZ1A 4A92A 4I8JA 2XW9A 1FMGA 2KCOA 1TRYA 3E16B 4QVBA 3GCHC 1NU7B 3M61U 3RXRA 5L30H 2YOLA 2ZP0H 1ZGVA 3OFND 3NFWA 7KMEH 2HTDA 1HAIH 5T6DA 3DMBA 1JBUH 1UTPA 2F43B 4HG6A 1AB9B 3R0FA 2QN5T 2J97A 1SR5C 2XC4A 2VIOA 4Y6DA 1DUAA 5ETXA 5EJZA 2GZ9A 4X8TH 5FAHA 1C2MA 1ELVA 1YF4A 3D62A 4AFZA 2SGAA 2ZPSA 5EXMA 5DP8A 3OU0A 2STBE 3PV4A 2QC2A 3VB6A 4D8NA 5BRRE 3MNXA 2EEKA 4ZHAA 2K0QA 4NWLA 2A4QA 3RXKA 3D49H 5HKKD 3LC3A 5JBBS 2XTTB 4YBNA 1ZR0A 1PPCE 1KDQB 1OWDA 1GCDA 2PKSB 2ZO3H 3WY8A 2ASUB 4XJ2A 4OS7A 1RIWC 2HHZA 1MUEB 3MO3A 1LQEA 4CRDA 5FBEA 5JYIA 1G3CA 1A61H 1P57B 4O3UA 4I31A 2YMSB 2A7CA 1KXDA 3QZRA 3AAVA 5KECA 1P9SA 1LO6A 2EA3A 1O2KA 2W7SA 4OS6A 1C1NA 1O5BB 1D3DB 3LIWA 2I02A 3F9HA 3BSQA 4MPUA 4I8LA 4B73A 1N8OB 1GMHF 2B0FA 3FAOA 1HAVB 5A2MH 2P3TB 1YPJH 3ITIA 4LXBH 4ZH8A 4UEHH 3TH2H 4CBNA 1QJ1B 2FZZA 2SGPE 3P95A 8GCHF 3A7TA 1O2RA 2Q1JA 1TQ0B 3U28C 1S0QA 2GT8A 4FOUC 4OM9A 3OTPA 4DT7B 3UAIC 4WH8A 1SQAA 3UR6A 4MTBA 3VXFH 2M2AA 4CH2B 4B6EA 4B76A 1GWAA 3LT3A 2ZG0H 4IN2A 1QL7A 3OEED 2BD9A 2J94A 1E34B 1NROH 1O5AB 2HTIA 3ZYDA 1MABB 2HQ9A 1GJ4H 1OWJA 1Q2WA 1WLKA 1MKWH 3D65E 1F2SE 2NU2E 1AIXH 3RU4D 1C1UH 3SNCA 2ODYB 1DSTA 2OC7A 3BTQE 1H4WA 3KQBA 1AUTC 1CBWC 1LHDH 2Y82A 3QDZB 2ED4A 1BBRE 3VY2A 1GJ5H 4WH6A 1A5HA 4XHYA 1NPMA 1O2MA 4AB8A 4M9FA 2ZFQH 2GCTC 1YLCA 2BDHA 5TJXA 1SGNE 2VIWA 4ACBA 3PLPA 3ZVAA 5DP7A 1L4DA 1TGTA 1K22H 1LHCH 4FXGH 3PMJA 5DP3A 1ABIH 2Z6BD 2J92A 4ZXYH 1A0HB 1BQYA 1P11E 1K9OE 1GL1A 3LKWA 2VWMA 2H9HA 3B8JA 4DG4A 3EA9A 1ARCA 4GLYA 1T8LA 2NWNA 1NRQH 2ZQ2A 4WF8A 4XRNA 4YLUA 2Z9LA 3UREA 1G30B 4O03A 3OE7D 5FCKA 4B75A 4A1VA 2VWNA 4Y8ZA 1QL8A 3GYMA 1P03A 2BD3A 3KYGA 3KQEA 1Z8IB 1C1VH 4I32A 2Z9IA 1VJAU 1CHGA 2HWLB 5HM2A 1SQRA 4NG9H 3FKHA 3S69A 1H9LB 1O3MA 3EGKH 3RXLA 4A1TA 1EKBB 3H5CB 3T27A 3AAUA
chains in the Genus database with same CATH topology
4Z85A 4YWNA 1G78A 2X1JA 2X1KA 1AXJA 3AWHA 5KECA 4P02A 1W3QA 2ARZA 1T9MA 4N7RC 4HX6A 2I02A 2RE7A 3K87A 3U35A 2ECUA 5KGOA 5CHEC 3B5MA 2IG6A 3K88A 4I86A 3TGVA 1YLNA 1YOAA 5CHOA 1RFEA 3K86A 3DNHA 1W3PA 3DB0A 3R5YA 3ZODA 1W9AA 2A2JA 3A20A 1G76A 3KYFA 1DNLA 2I51A 1Y30A 3U0IA 4FOUC 3IN6A 2IABA 2FHQA 2FURA 2VPAA 4R82A 5JABA 2RDEA 3R5LA 2GJGA 1NRGA 1WGBA 2IMLA 3A6RA 3VYAA 3DSGA 1WLIA 2D5MA 5ESCA 3FGEA 4P00A 2FG9A 3ZOFA 3U34A 3U5WA 2D38A 2HTIA 4QVBA 2HQ9A 4ZKYA 4IRAA 1WLKA 3BNKA 3ZOGA 4F48B 1CI0A 3SWJA 2L74A 2R0XA 2QCKA 3AMFA 3NFWA 3CP3A 2E83A 4HMWA 2D37A 2HTDA 2ED4A 3DMBA 1RZ0A 3VY2A 4L82A 4HG6A 4XHYA 3ZOHA 5EIYA 4HMTA 5EJZA 1I0SA 3ZOEA 3VY5A 1RZ1A 3R5ZA 1USFA 2ASFA 3GASA 3BPKA 4RT0A 2NR4A 1XHNA 3F7EA 4HMSA 1JNWA 3HY8A 5EJ1A 2R6VA 3CB0A 4HMUA 1G77A 5KEDA 1W3OA 3BA3A 4XRNA 2OU5A 3R5WA 3A6QA 2PTFA 1WV4A 1TY9A 3PFTA 3R5RA 1I0RA 4YBNA 1W3RA 2Q9KA 3HMZA 3EC6A 2OL5A 1YWUA 2HQ7A 4XJ2A 5BNCA 3ZOCA 2HHZA 1VL7A 2AQ6A 2ECRA 3KYGA 1EJEA 4F07A 1G79A 1XXOA 1USCA 2QEAA 4HMVA 3RH7A 2D36A 3FKHA 4HMXA 4Y9IA 5EJLA 4RT1A 3H96A 1FLMA 3CNRA 3R5PA 3E4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z85 A;  4YWN A;  1G78 A;  2X1J A;  2X1K A;  1AXJ A;  3AWH A;  5KEC A;  4P02 A;  1W3Q A;  2ARZ A;  1T9M A;  4N7R C;  4HX6 A;  2I02 A;  2RE7 A;  3K87 A;  3U35 A;  2ECU A;  5KGO A;  5CHE C;  3B5M A;  2IG6 A;  3K88 A;  4I86 A;  3TGV A;  1YLN A;  1YOA A;  5CHO A;  1RFE A;  3K86 A;  3DNH A;  1W3P A;  3DB0 A;  3R5Y A;  3ZOD A;  1W9A A;  2A2J A;  3A20 A;  1G76 A;  3KYF A;  1DNL A;  2I51 A;  1Y30 A;  3U0I A;  4FOU C;  3IN6 A;  2IAB A;  2FHQ A;  2FUR A;  2VPA A;  4R82 A;  5JAB A;  2RDE A;  3R5L A;  2GJG A;  1NRG A;  1WGB A;  2IML A;  3A6R A;  3VYA A;  3DSG A;  1WLI A;  2D5M A;  5ESC A;  3FGE A;  4P00 A;  2FG9 A;  3ZOF A;  3U34 A;  3U5W A;  2D38 A;  2HTI A;  4QVB A;  2HQ9 A;  4ZKY A;  4IRA A;  1WLK A;  3BNK A;  3ZOG A;  4F48 B;  1CI0 A;  3SWJ A;  2L74 A;  2R0X A;  2QCK A;  3AMF A;  3NFW A;  3CP3 A;  2E83 A;  4HMW A;  2D37 A;  2HTD A;  2ED4 A;  3DMB A;  1RZ0 A;  3VY2 A;  4L82 A;  4HG6 A;  4XHY A;  3ZOH A;  5EIY A;  4HMT A;  5EJZ A;  1I0S A;  3ZOE A;  3VY5 A;  1RZ1 A;  3R5Z A;  1USF A;  2ASF A;  3GAS A;  3BPK A;  4RT0 A;  2NR4 A;  1XHN A;  3F7E A;  4HMS A;  1JNW A;  3HY8 A;  5EJ1 A;  2R6V A;  3CB0 A;  4HMU A;  1G77 A;  5KED A;  1W3O A;  3BA3 A;  4XRN A;  2OU5 A;  3R5W A;  3A6Q A;  2PTF A;  1WV4 A;  1TY9 A;  3PFT A;  3R5R A;  1I0R A;  4YBN A;  1W3R A;  2Q9K A;  3HMZ A;  3EC6 A;  2OL5 A;  1YWU A;  2HQ7 A;  4XJ2 A;  5BNC A;  3ZOC A;  2HHZ A;  1VL7 A;  2AQ6 A;  2ECR A;  3KYG A;  1EJE A;  4F07 A;  1G79 A;  1XXO A;  1USC A;  2QEA A;  4HMV A;  3RH7 A;  2D36 A;  3FKH A;  4HMX A;  4Y9I A;  5EJL A;  4RT1 A;  3H96 A;  1FLM A;  3CNR A;  3R5P A;  3E4V A; 
#chains in the Genus database with same CATH topology
 1GMC F;  4ISL A;  4MVN A;  3AWH A;  1O37 A;  4J2Y B;  4ZKS U;  2DE9 A;  1V2U T;  3PTN A;  1P2J A;  2RE7 A;  1W13 U;  2F3C E;  4BAQ B;  2B8O H;  2JH0 D;  3SGQ E;  1C1S A;  1YLD A;  3MHW U;  1A5I A;  3PMA B;  3A81 A;  3DD2 H;  1YLN A;  4YOG A;  1DDJ A;  1XXF A;  1GJA B;  1C5O H;  3MO6 A;  3BIV H;  4Q7X A;  5DP4 A;  3HK3 B;  4CRF A;  1G3E A;  2FOD A;  1OS8 A;  4OS2 A;  1KXF A;  1W9A A;  1AD8 H;  4MQA A;  2H2Z A;  3KYF A;  4DOQ A;  3IN6 A;  2FX4 A;  3GDS A;  1HJ8 A;  1OP8 A;  1UJ1 A;  2OD3 B;  4Q7Y A;  2BDB A;  1C2K A;  2P8O B;  2D1J A;  3DA9 B;  3MU4 A;  1MTU A;  1Y59 T;  2PTC E;  2UUY A;  3TH3 H;  1O5E H;  1GBD A;  1PJP A;  5FHT A;  1WLI A;  1RS0 A;  3QTV H;  1SSX A;  3V13 A;  2C8Y B;  2KAI B;  4BXS A;  4NCY A;  1MBM A;  1Z71 A;  3I77 A;  4AX9 H;  1AN1 E;  4IRA A;  2V3O H;  3FAN A;  1W0J D;  1EOL A;  2FIR H;  5A8X A;  1CI0 A;  3SWJ A;  1LPZ B;  3MH4 A;  1C5W B;  1S0R A;  1T4V H;  2ZTZ A;  1ZLR A;  3C27 B;  3LDX H;  2D37 A;  3PWB A;  2A5K A;  2RA0 A;  5LH8 A;  4X1N U;  1AB9 C;  1JIM A;  3M35 A;  1GG6 B;  1HJ9 A;  2D2D A;  3GCT F;  1J15 A;  2H9T H;  2F9B H;  3ENS B;  1MKW K;  1TPA E;  2P3U B;  3R5Z A;  2ZEC A;  2QXI A;  5F8Z A;  1MD7 A;  2HNT F;  2ANM H;  2WUC A;  1WQS A;  1LDT T;  1Y5B T;  4NZQ A;  1MKX H;  1ZPZ A;  2R6V A;  1QQ4 A;  1ZPC A;  2JJ2 D;  4HMU A;  4RKJ B;  1DAN H;  4AYV B;  1T4U H;  1TBZ H;  1A7S A;  1HAO H;  1GDN A;  2BDI A;  2ZCL P;  2PKS C;  2ZC9 H;  1XUH A;  2EQN A;  4AC9 A;  3BG4 B;  1V6D A;  2RCE A;  2ANK H;  3EC6 A;  1YWU A;  2V3H H;  3MOC A;  2FOB A;  1TNL A;  3GS9 A;  1WQV H;  2Y5F A;  1SOT A;  2YMS C;  4NGA H;  1TA6 A;  2ZDN A;  3H96 A;  2ZGJ A;  1ZGI A;  2FYR A;  1DSU A;  4JZF H;  4IW4 E;  1SBW A;  2G4T A;  1O3H A;  1GBJ A;  2HLD D;  1EST A;  2AER H;  4JYU H;  4Z85 A;  2XBV A;  1W10 U;  3NK8 A;  3RC4 A;  2WZQ A;  1AE5 A;  2FM2 A;  3NXP A;  4J1Y A;  1CA0 B;  5TCA A;  4GUX A;  1F0U A;  1ANE A;  1K21 H;  2CJI A;  1ZHM A;  3H7O A;  3OY6 U;  1C1Q A;  1NC6 A;  3PV5 A;  3QN7 A;  1EZQ A;  1C4Y 2;  1H1B A;  1O3N A;  2SNV A;  2WPL S;  1YM0 A;  4KKD A;  3SU6 A;  3ZZ8 A;  4MNV A;  2ZGH A;  1C5P A;  1ZML A;  1QQU A;  4X2Y A;  5GDS H;  4B2C A;  3SHC H;  2ZHD A;  4M7G A;  1DWB H;  1GMH G;  1JWT A;  4OS4 A;  1C2E A;  1WTH D;  2WHX A;  5FPS A;  1BB0 B;  2R2W U;  1NBM E;  1PQA A;  8GCH G;  2FOA A;  2FG9 A;  4E7N A;  4Q63 A;  2BTC E;  2Y6T A;  4XBB A;  1KSN A;  5GCH F;  3BNK A;  3V4H A;  1GVK B;  5FPT A;  4AOQ A;  3PV2 A;  4MLF B;  1J8A A;  2A0Q B;  1QHR B;  3KEE A;  4H42 U;  1GBF A;  1GI4 A;  1Y3X A;  2W26 A;  5F8X A;  3M5O A;  1LHE H;  1CHO F;  3VXE H;  3GCN A;  1O3B A;  1V2T T;  3F9E A;  3KQC A;  2ASF A;  1CGI E;  2PV9 B;  5DG6 A;  1WYK A;  1C5S A;  3VGC C;  3ZV9 A;  1D9I A;  4TPI Z;  1TPS A;  1G2M A;  1T8N A;  4K69 A;  4ISH H;  1FUJ A;  2ANY A;  1O2N A;  1ACB E;  1F92 A;  3FN8 A;  4WJG 2;  4Z1M D;  2BOH B;  4X2V A;  1FY8 E;  2Z9J A;  2Z9G A;  4UE7 H;  1AHT H;  1SLX B;  5EU8 A;  2ANW A;  1DM4 B;  3HMZ A;  1KLT A;  3GDV A;  1PPZ A;  3PRB A;  1YPH E;  1QGF A;  5C94 A;  3QO6 A;  3E6P H;  4UD9 H;  3TGK E;  2ECR A;  1MKX K;  1Q3X A;  3UNQ A;  1EAS A;  4F07 A;  4DVA U;  1G79 A;  3SNA A;  1TYN A;  3RH7 A;  2G51 A;  2AGI X;  3LH3 A;  4ZMA H;  3NUM A;  1EFR D;  1AVG H;  4K3J A;  2AYW A;  1NFX A;  1F5R A;  1UVU H;  3UQO A;  3TK9 A;  1W12 U;  4O97 A;  4P02 A;  3ATK A;  5EOK A;  4BNR A;  3PRD A;  1D4P B;  1SLW B;  4Q4L A;  1VIT F;  1KXA A;  2IG6 A;  3EST A;  3ATL A;  2RDL A;  5EXL A;  4CRC A;  1J14 A;  5K7R A;  2ODQ A;  1MTV A;  3MH6 A;  1PPG E;  2JJ1 D;  4HTC H;  3SUF A;  1QRW A;  5AFZ H;  2A2J A;  2NU3 E;  2Q6F A;  3SZE A;  1AVW A;  1Y30 A;  3V3M A;  3AW1 A;  1GMC G;  3GY3 A;  1VCQ A;  3S9C A;  1EB2 A;  1XKA C;  3DSO A;  3S7H B;  1V2M T;  5H4I B;  2BD8 A;  5C1Y A;  3K6Y A;  3VYA A;  1DY9 A;  4WY3 A;  3ZZD A;  1QBO A;  1BRB E;  1ABJ H;  5SGA E;  4Y0Y E;  1ZMJ A;  1NN6 A;  1FY5 A;  3W95 A;  1TX6 A;  2R0K A;  3U5W A;  2ZPR A;  1GBH A;  3A7Z A;  3SU1 A;  3ZZ7 A;  1DY8 A;  3OYP A;  2L74 A;  4ZAE A;  2CGA A;  3MNB A;  2ILN A;  4W64 A;  3BTD E;  1GG6 C;  4WWY A;  2ULL A;  1G2L A;  1L1N A;  1GBB A;  3P70 B;  1AND A;  2OQU A;  3EA7 A;  4GSO A;  3HKI B;  1YPK H;  4TWW A;  2CN0 H;  4ZUH A;  1I0S A;  3LGV A;  2CF8 H;  3DCL A;  6CHA B;  1Z7K A;  2FOG A;  4Z0K A;  2W3I A;  1WV7 H;  1GI3 A;  1Y3U A;  3O8R A;  4HMS A;  3ZZ5 A;  3A88 A;  1QA7 A;  2AEI H;  3CP7 A;  2FS8 A;  1O34 A;  3RMM H;  1YPH C;  1FQ3 A;  1C5Z B;  2FTL E;  3SBK A;  1SFI A;  2F83 A;  1FIZ A;  1FAK H;  3TU7 H;  4CHA B;  3GCT G;  1FAX A;  2F9O A;  1E1R D;  3NRL A;  2HAL A;  3BG4 C;  3SUD A;  4O3T A;  4UHV A;  2AIQ A;  4X6M A;  3A7X A;  2CF9 H;  4ABI A;  1QNJ A;  3JZ2 B;  1QFK H;  2PKA B;  1GI0 A;  2VIQ A;  2VVV A;  4BTU B;  3ZZC A;  2WV5 A;  3SU5 A;  1A3E H;  2D8W A;  1ORF A;  1TMB H;  2C3S A;  2JET B;  3MH7 A;  1D3Q B;  1O2Y A;  1BDA A;  3CNR A;  1E79 D;  2PP6 A;  5DP5 A;  1P04 A;  5BPE A;  3R5P A;  5AVD A;  1F5L A;  2Z3E A;  4RI0 A;  2X1K A;  2WYJ A;  2HOB A;  3BTE E;  2ZFF H;  1WU1 A;  5EQS A;  1SVP A;  1QA0 A;  1S82 A;  1C1P A;  3A8A A;  3RXP A;  3PB1 E;  2HGT H;  2ZU2 A;  3U8R H;  2OCV B;  1O2L A;  1UCY E;  1SC8 U;  3RXO A;  3HE1 A;  4K8B A;  1TQ7 B;  3UWI A;  1EPT B;  3LC5 A;  1VIT H;  1VKY A;  2IAB A;  1DOJ A;  5F03 A;  4Y8X A;  1BTY A;  4D9R A;  5JAB A;  5CHA B;  1AY6 H;  2BY5 X;  7LPR A;  1H8I H;  1CA8 B;  1PYT D;  5EQR A;  2IML A;  2WPD D;  1GBA A;  1HRT H;  3BG8 A;  1Q31 A;  5DKM A;  2QXG A;  1LPG B;  2WPH S;  1GHY H;  3A84 A;  4MPX A;  1NRP H;  7EST E;  4X8V H;  1HFD A;  4BAM B;  2QCK A;  2B7D H;  1EZS C;  1GI1 A;  1O3P B;  3FP6 E;  1CT4 E;  3RMO H;  1FPC H;  1QR3 E;  2ALV A;  4L82 A;  4X8S H;  3ZYE A;  2A45 B;  2BLO A;  3W1E A;  1ZZZ A;  2ZWL H;  4Y10 E;  1LKB A;  2A2Q H;  1WTG H;  7GCH F;  4CRG A;  2QV1 A;  1Z1I A;  4PRO A;  3ZOE A;  4CRA A;  2HRV A;  1SHY A;  1USF A;  4CRE A;  5GCH G;  1BZX E;  2WIN I;  2Y7Z A;  2FOM B;  1BTH H;  4INK A;  3MWI U;  5EJ1 A;  1O3I A;  1C5T A;  1D3P B;  5HM9 A;  3BA3 A;  1UTM A;  1CQQ A;  4YZU A;  3GY8 A;  3M36 A;  5L2Z H;  3SJO A;  4MDS A;  1QIX B;  1UMA H;  1CHO G;  1I0R A;  1SI5 H;  1NY2 2;  3UQV A;  3K6Z A;  2AMQ A;  2GTB A;  3SU4 A;  3SV8 A;  1O30 A;  2AMP A;  2XOK D;  4INH A;  3LGW A;  1GI7 B;  1CT0 E;  5J4S A;  3O8D A;  2J38 A;  1W14 U;  2HVX A;  1DWD H;  3OEH D;  4U30 A;  2JDI D;  1B0E A;  3G01 A;  3P8O A;  3TH4 H;  1A4W H;  1UVP A;  1XM1 A;  1O2T A;  3CS0 A;  1EAI A;  3F6U H;  3NZI A;  2G4U A;  2ARZ A;  4ZHM U;  2W7U A;  3K87 A;  4X0W U;  1C9P A;  4X1S U;  1BMF D;  1DLK B;  2M5T A;  3A8C A;  3TGV A;  1IQF A;  1E36 B;  2OUA A;  1B5G H;  2GX4 A;  3A80 A;  2K4Q A;  1SPJ A;  3ZVD A;  4EST E;  2TIO A;  3MU1 A;  3RU4 E;  1V2N T;  1UK4 A;  3RM2 H;  3RXS A;  1J16 A;  2ZEB A;  3PO1 C;  2I51 A;  3T28 A;  3VB3 A;  4CH8 B;  1FN8 A;  3PTB A;  1CGH A;  1TPP A;  3Q76 A;  4K60 A;  4MNW A;  3ZVE A;  2UUK B;  4FUB A;  1EB1 H;  5GPI B;  1CGJ E;  1WUN H;  1BUI A;  1P02 A;  3A7Y A;  4U2W A;  5C3N A;  5HYO A;  2NU4 E;  1VIT G;  1P0S H;  1UTK A;  3SOS A;  2GCH F;  2P93 A;  1OYT H;  1ZSL A;  2O8L A;  3UB0 A;  1YP9 A;  1T8M A;  1MTS A;  1O2Z A;  1W7G H;  1O31 A;  3BIU H;  2BLW A;  4FUG A;  2FOE A;  3ZOF A;  1HV7 A;  2J34 A;  1LVB A;  2J9N A;  2WV4 A;  4ZXX H;  3FZD A;  2PW8 H;  3IG6 B;  1K1M A;  3F9F A;  2SGE E;  2W6J D;  1S83 A;  4WMD A;  3OAA D;  2UWP A;  3SV6 A;  4HMW A;  1EP5 A;  3M5M A;  3URD A;  1FXY A;  5CMX H;  2IPH A;  2W5E A;  1GMD F;  2P16 A;  1UTN A;  1EXF A;  1SB1 H;  4NIV A;  3S9A A;  4Y76 A;  3LJJ A;  1P06 A;  3RXA A;  6CHA C;  3SW2 B;  1MTN C;  2F4L A;  4U01 A;  5CDF E;  2YNA A;  1IQI A;  3S0N A;  2OC1 A;  1MD8 A;  2BXU H;  1TWX B;  3F7E A;  3WW7 A;  1N6X A;  5A09 A;  3ZZ6 A;  4CHA C;  3U8O H;  2ZDV H;  1C5L H;  1VCW A;  2QXJ A;  2V0B A;  3Q3X A;  5B6O A;  3VB5 A;  3A6Q A;  2RG3 A;  5E2O A;  3ZVG A;  2CHA B;  1HJA B;  3I29 A;  1O3C A;  1ZRK A;  4ABG A;  1SGR E;  4B71 A;  2HQ7 A;  3FP8 E;  1DFP A;  3ZOC A;  4HI3 A;  1BRU P;  1P12 E;  2WV9 A;  3KN2 A;  2J4I A;  4I7Y H;  2F9P A;  1O2X A;  1ETT H;  3BF6 H;  2JET C;  3RMN H;  3M7U A;  2Y5H A;  1SLU B;  4Y9I A;  5DSF A;  4X8U H;  1MQ6 A;  1TX7 A;  1YPG H;  4ABH A;  2EI8 A;  3SGB E;  1GHA G;  4JZE H;  1O3J A;  3AW0 A;  2Y80 A;  1AXJ A;  4ZHL U;  2ZIQ H;  1BJV A;  3MNC A;  3WWB A;  3MTY A;  4NIW A;  1W3Q A;  2GMT C;  2ZGC A;  2WUB A;  4UFD H;  5CHE C;  2V7Q D;  3LGT A;  3HKJ B;  3N99 A;  1PPE E;  1E37 B;  1S84 A;  1QRX A;  1RD3 B;  2ZI2 H;  2F9V A;  1NRS H;  1TB6 H;  1O3L A;  1W8B H;  1SG8 B;  4B1T A;  5CHA C;  2JIZ D;  4DGJ A;  1HUT H;  2R3Y A;  3KCG H;  1KDQ A;  3QTO H;  1LVY A;  1UK3 A;  3N7O A;  4XSK U;  2VGC C;  3TJV A;  4VGC B;  1HAG E;  4AGK A;  4AOR A;  1COW D;  2VU8 E;  1AVX A;  2EY4 C;  5EST E;  3DSG A;  3FZZ A;  1TNI A;  1QTF A;  3FFG A;  4AFS A;  1Y3V A;  3U34 A;  1H9I E;  1BIT A;  3P8F A;  1T8O A;  2ALP A;  1TOC B;  2OXS A;  1ETR H;  2XCF A;  1KYN A;  1LHG H;  3BV9 B;  3KQ5 A;  2LP6 A;  2O8U A;  3MH5 A;  1GHB F;  1XKB C;  3BTM E;  1FJS A;  1GBK A;  3RLY H;  2BD2 A;  1A5G H;  4TYD A;  1GJD B;  1SGI B;  1PFX C;  4B2B A;  4NWK A;  3SI3 H;  1CVW H;  2IPQ X;  4UFF H;  2P5Z X;  3RXD A;  1HAV A;  4GAW A;  3RXB A;  1QCP A;  1C2D A;  2XBY A;  3BTW E;  1SMF E;  4Y71 A;  2EI7 A;  1Z8J B;  5B6L A;  3UUZ A;  3UFA A;  1MU6 B;  2F91 A;  1C1T A;  2ZCK P;  2EST E;  1V2R T;  2GV6 A;  4IC6 A;  2ZCH P;  1UHB B;  4YT6 H;  2QAA A;  2XCN A;  2BDA A;  1ANC A;  2OBQ A;  4AYY B;  1BTZ A;  4NZL A;  2CMY A;  2ZDA H;  3ZVB A;  1KXC A;  7GCH G;  1Y12 A;  1DPO A;  4A1X A;  1NFY A;  3LU9 B;  5JBC S;  1WXR A;  1BTU A;  4R0I A;  2AFQ B;  1VR1 H;  1NTP A;  2L6O A;  2OL5 A;  3SQH E;  1SGF G;  1TA2 A;  2ZNK H;  4ZKO U;  1DXP A;  3NCL A;  1FIW A;  1VL7 A;  3UOU A;  3E0P B;  2H9E H;  4FET A;  4FU7 A;  2GT7 A;  1O39 A;  3T25 A;  1USC A;  4MPV A;  2QEA A;  2XC0 A;  2VB0 A;  1O2I A;  2AGE X;  2C8W B;  2WSS D;  1EAX A;  3T26 A;  4KTC A;  3F1S B;  3TJN A;  3U9A H;  2VWO A;  4CRB A;  1HXF H;  3TLO A;  3WWF A;  1RJX B;  4BOH A;  3KNX A;  1RGQ A;  4FU9 A;  1TMT H;  4DY7 B;  1QB9 A;  1G78 A;  1W0Z U;  4H6T A;  3UR9 A;  1GI9 B;  3QLP H;  2CXV A;  1T9M A;  1E0F D;  4HX6 A;  4AZ2 B;  1EAU A;  5FX6 A;  8EST E;  2AIP A;  2ECU A;  1BIO A;  1D6R A;  2YMS D;  4H6S B;  2STA E;  1AMH A;  1THS H;  1GI5 A;  1IHS H;  1RFE A;  2BYA X;  3ZOD A;  3BEU A;  2P3F H;  3DSP A;  3P8N A;  1AE8 H;  1NRR H;  3RML H;  1GBC A;  3U0I A;  2OQ5 A;  1NU9 A;  3UNS A;  3VG8 A;  1GJ9 B;  2FWW A;  1NFU A;  3H7T A;  2FHQ A;  2VPA A;  3LPR A;  3NPS A;  1OPH B;  4CR9 A;  1GHX H;  2AMD A;  3CEN A;  1EUF A;  3ZIA D;  5FCR A;  4RSP A;  2G52 A;  1N8O C;  1O2H A;  3EA8 A;  3F3B A;  1CT2 E;  1O3D A;  1DWE H;  3FGE A;  3SOR A;  1YC0 A;  2V3M A;  2A4O A;  1PQ5 A;  2FMJ A;  1ZMN A;  4ZKY A;  3LJO A;  3QX5 H;  3GY2 A;  1O3K A;  3RXC A;  3LH1 A;  1Z8R A;  2PSX A;  1SKY E;  2BD4 A;  2GCH G;  1TNH A;  3F0O A;  2G5V A;  1W3C A;  1BTX A;  3A87 A;  5EIY A;  4ISI H;  5DPA A;  1TFX A;  5GXP A;  3LGY A;  1GJB B;  3VY5 A;  1AKS B;  1HPG A;  1MBQ A;  1OWK A;  2ODP A;  2JH5 D;  5JBA S;  1H8E D;  1OKX A;  2BY9 X;  5CE1 A;  2OC0 A;  4AGJ A;  3BTH E;  3GIS B;  2HVY B;  3N7D A;  1BJU A;  2OTV A;  1IHT H;  3ZV8 A;  3FOA A;  1BMN H;  5LGO A;  1BTW A;  4F4O C;  3CB0 A;  1GHV H;  1GMD G;  2VH0 A;  1TGB A;  4OS1 A;  4YT7 H;  2CHA C;  1HJA C;  5EXN A;  4TT3 D;  3SV2 H;  3HK6 B;  3RUO A;  1YCP H;  4JK6 A;  5JPM H;  1H8H D;  3T2N A;  1OHH D;  1ELG A;  1GDQ A;  2H6M A;  2F9N A;  2LPR A;  1QB1 A;  2KAI A;  1KTS B;  1C2L A;  1V3X A;  1WAY B;  2BY6 X;  3SUG A;  4JZD H;  1P2O A;  1UHB A;  3F0P A;  4HMV A;  1GL0 E;  1A0L A;  4HMX A;  1D3T B;  3OSY A;  3RXT A;  1Z6J H;  3U69 H;  1A3B H;  1AU8 A;  4ABB A;  8LPR A;  4YWN A;  1FY4 A;  2X1J A;  5JB8 S;  2I6S A;  2WPM S;  2ZU5 A;  1IQH A;  4INL A;  4FVB A;  3KGP A;  2A7J A;  1BRA A;  4RKO B;  1P09 A;  1TGC A;  3EYD A;  4BAK B;  3K65 B;  3PRO A;  3KHV A;  4NSV A;  1F7Z A;  3L33 A;  1C5M D;  3DNH A;  3U98 H;  2XXL A;  3FVF B;  4Q80 A;  5DO4 H;  2GDD A;  3R3G B;  1G37 A;  1FY3 A;  4MG3 A;  2BY7 X;  1O36 A;  2SGF E;  3D23 A;  1FON A;  5AFY H;  1UTL M;  1BA8 B;  5FX5 A;  1IQJ A;  1HBT H;  1TAB E;  1MZA A;  3E0N B;  4VGC C;  1G3D A;  3R5L A;  4DCD A;  4DW2 U;  3RP2 A;  1UW7 A;  4IN1 A;  4K5Z A;  4XDE A;  4Y0Z E;  3VEQ B;  2D5M A;  2C8X B;  2TBS A;  2XYA A;  2BXT H;  3MMG A;  3A83 A;  2R0L A;  1PPF E;  2FOF A;  2FOH A;  4KTS A;  1AWF H;  3M5L A;  3A89 A;  1P2K A;  3GYL B;  4ACA A;  3AMF A;  4U32 A;  1ZSK A;  2P8O C;  2QF3 A;  3BN9 A;  3LOX A;  1TMU H;  1P2Q A;  2A5I A;  3PM3 A;  2RFK C;  1IQG A;  1ARB A;  3OY5 U;  1TAW A;  3GCO A;  1X7A C;  3A8B A;  4K1E A;  4RT0 A;  5JBT A;  2BZ6 H;  3SU2 A;  1H9H E;  1SGE E;  1ID5 H;  1O2G H;  1TLD A;  1GHB G;  1HIA B;  5C2Z A;  3Q3K A;  1C5Y B;  1RTL A;  5KED A;  2A1D B;  3DFL A;  3PFT A;  1KXB A;  2VBC A;  2VJ1 A;  1AKS A;  4HZH A;  3RXH A;  1O35 A;  1T32 A;  3UTU H;  1TNG A;  2V6N A;  5E0G A;  1ELD E;  3SUE A;  4A6L A;  1KIG H;  1O3G A;  2BB4 A;  4ZKN U;  2NU1 E;  2FI5 E;  1LVM A;  4B6F A;  2QF5 A;  1YCP K;  1P3E A;  1AQ7 A;  4XBD A;  2RA3 A;  2BMG B;  1C2G A;  1NZQ H;  1QL9 A;  1ANB A;  4Q2K A;  1O33 A;  1YPE H;  1AGJ A;  1NFW A;  1GPZ A;  2BM2 A;  2IOT A;  4I8H A;  4NIY A;  4OGX A;  5ESB A;  3MO9 A;  4HGC A;  1B7X B;  2NU0 E;  1JOU B;  1WDI A;  3A85 A;  2KR7 A;  1A2C H;  1GBI A;  5CHO A;  3F2F A;  3TVJ B;  4GHT A;  5AHG H;  1DIT H;  4XD7 D;  3SV7 A;  3A20 A;  1BMA A;  4TY6 A;  3RXE A;  1HAY B;  1O5D H;  3DHK H;  3T29 A;  2G8T A;  1KLI H;  3EE7 A;  1CBW B;  4XOJ A;  4I8K A;  1ZJK A;  1CA0 C;  1TON A;  1EP6 A;  1QBN A;  2G00 A;  2TGT A;  1WGB A;  2BD5 A;  1QBV H;  3A8D A;  2Z3C A;  4P00 A;  3GY4 A;  4FU8 A;  1O3E A;  1A1R A;  2ZGX H;  2BLV A;  2BHG A;  2ZHF H;  2R2M B;  2VIN A;  4WVP E;  1SGP E;  2FI3 E;  4X1Q U;  3A86 A;  5GJ4 B;  3SYJ A;  2FOC A;  2VH6 A;  1U6Q A;  4UFE H;  3CP3 A;  3VFE A;  3SJ8 A;  3S9B A;  3OX7 U;  3V7T A;  1HDT H;  2UWO A;  1TGN A;  5EW2 H;  2QYI A;  3GY6 A;  5HIZ A;  3FP7 E;  1C5N H;  1XVO A;  2F9U A;  1Y3Y A;  3UY9 A;  3TGJ E;  1K1J A;  2AHM E;  2HNT E;  4LZ4 B;  1Y5U T;  1MCV A;  5C17 A;  2Y7X A;  5DP9 A;  3BEF B;  5C67 A;  1BBR H;  3OTJ E;  4BTT B;  4K8Y A;  3TIT A;  1RTK A;  1EQ9 A;  1GCT B;  3SGA E;  1G77 A;  2A5A A;  5E8E H;  1W3O A;  2OU5 A;  4FUD A;  3R5W A;  2PTF A;  2BQ7 B;  3R5R A;  5L6N H;  2BDY A;  1C2J A;  1MQ5 A;  1TBR H;  1WCZ A;  2B5T B;  4Q7Z A;  4TWY A;  4FUI A;  5DP6 A;  5I25 A;  1IOE A;  5E2P A;  2G5N A;  1EZU C;  4X6O A;  1PYT C;  2GD4 B;  3Q00 A;  1S85 A;  2FEQ H;  2PSY A;  1O3O A;  1XXO A;  2SGQ E;  4O9V A;  2QGR A;  2D36 A;  1YYY 1;  4KP0 A;  2ZGB H;  1C2H A;  5EG4 A;  3RC6 A;  1GJ8 B;  2QCY A;  3ZZ9 A;  3BTG E;  1HXE H;  1FPH H;  3RXU A;  3RXG A;  1D6W A;  3SJK A;  5C5N A;  3E8L A;  3W94 A;  3RXF A;  1NM6 A;  1C5R A;  1OX1 A;  2HLC A;  2THF B;  3QZQ A;  5C20 A;  2A7H A;  4A7I B;  4DT4 A;  1GI2 A;  1C5U A;  3O8C A;  1T7C A;  3UNR A;  2K8I A;  1GVZ A;  1ELF A;  3K86 A;  2VNT A;  4Y11 E;  3UPE A;  1ZTL A;  2C93 B;  2J95 A;  4ZCN A;  1VJ9 U;  1EZX C;  1N1L A;  1G76 A;  4Y79 A;  2GZ8 A;  2XWB I;  1DIC A;  1P01 A;  6LPR A;  2G81 E;  5A8Y A;  1BCU H;  1UVO A;  3VPK A;  1C1M A;  1RFN A;  2FES H;  4AFQ A;  1ZJD A;  2OC8 A;  3PLB A;  3T62 A;  3SU3 A;  1AFQ B;  1E38 B;  2PKA A;  2FS9 A;  1RRK A;  1K1P A;  5ESC A;  4ASH A;  1N6Y A;  1JMO H;  1K2I 1;  2VVU A;  1GGD B;  1EJN A;  2WYG A;  4YES B;  1LVO A;  2SNW A;  2BX4 A;  3GIC B;  1YPL H;  4CBO A;  1OWI A;  2HNT C;  2FLR H;  4D9Q A;  1TGS Z;  1C4V 2;  4FUF A;  2FP7 B;  1L1G A;  1KTT B;  4UDW H;  4GPG A;  4NFE A;  4SGB E;  1ZSJ A;  1DXW A;  3FO8 D;  1ZYO A;  1SL3 A;  1V2K T;  1MCT A;  1SQO A;  3ATI A;  3EDX B;  4KTU A;  4HMT A;  1GBE A;  1QRZ A;  3RXI A;  2J5U A;  1RZ1 A;  1F0S A;  2VIP A;  2AS9 A;  2XC5 A;  3LON A;  3N7E A;  4AFU A;  1BHX B;  4WXI A;  4XE4 A;  1MH0 A;  1LTO A;  1EPT A;  4E05 H;  1XVM A;  1GHZ A;  2SFA A;  2BDG A;  4DIH H;  5LPR A;  1SQT A;  1YPM H;  2UWL A;  3RXQ A;  1C5Q A;  5T6G A;  2A4G A;  3NWU A;  1Z1J A;  2ZTY A;  1RXP A;  1TIO A;  4HKH A;  1S6H A;  4ABJ A;  3HGP A;  5DN6 D;  1XXD A;  1BBR K;  3P8G A;  3P17 H;  3KQD A;  3DFJ A;  2AQ6 A;  2ZU4 A;  1C4U 2;  1P10 A;  3SND A;  3M5N A;  1ZRB A;  2XBW A;  3A82 A;  1DT2 A;  2ZDL A;  2ZHW H;  2VWL A;  1UTQ A;  1NES E;  2EI6 A;  4MNY A;  1IQK A;  5J4Q A;  4NSY A;  2AGG X;  1HAX B;  1JIR A;  1K1I A;  3NKK A;  4FUE A;  1P05 A;  3PWC A;  2UUJ B;  3E3T A;  1TAL A;  3IWM A;  4ASU D;  4N7R C;  6GCH F;  4H4F A;  9EST A;  2ZHE H;  1Y8T A;  3PMB B;  5KGO A;  2OK5 A;  1GBT A;  1Z6E A;  3U1I B;  2A31 A;  3DB0 A;  1TPO A;  1THP B;  1SGY E;  4B2A A;  2PLX A;  5C1X A;  1G36 A;  1DNL A;  2TRM A;  4B74 A;  1ELE E;  2GKV E;  3DT0 H;  3SNE A;  1V2Q T;  1HCG A;  3BEI B;  1FV9 A;  3B23 B;  4Y7A A;  2FUR A;  1L1J A;  1UK2 A;  2BDC A;  2ZFP H;  2DUC A;  2GJG A;  3E90 B;  1F0T A;  4E7R G;  4ABE A;  2H5C A;  3MNS A;  4DII H;  5AF9 H;  2XND D;  1SFQ B;  1FY1 A;  3EAJ A;  1UVS H;  1UVT H;  1XUJ A;  2P95 A;  5C5O A;  3GY5 A;  2D38 A;  1EPT C;  3E1X B;  3ZVC A;  4QT8 C;  1BML A;  1OXG A;  3VGC B;  1CO7 E;  5T1V A;  4TSF D;  3ZZ4 A;  3Q77 A;  2Q6D A;  1BRC E;  2ZFR H;  4BTI B;  3ODD A;  5PTP A;  1HYL A;  4AG1 A;  2XBX A;  2E83 A;  3M7Q A;  4E06 H;  1GJ7 B;  5T3H A;  2WPI S;  4GCH F;  2OP9 A;  2FLB H;  2PHB A;  3F2H A;  4GHQ A;  1EOJ A;  3QK1 A;  1TNJ A;  5C1U A;  4BAH B;  1DUE A;  1NS3 A;  3K2U A;  4JK5 A;  1ELC A;  1AWH B;  2I6Q A;  3U8T H;  3ZVF A;  5L2Y H;  1S6F A;  1GCT C;  1V2W T;  4IGD A;  1DE7 H;  4ZRO A;  2LNC A;  1W7X H;  5F6M A;  1DVA H;  2JH6 D;  1WV4 A;  4X2X A;  1TBQ H;  1EJA A;  2PUQ H;  3TGI E;  2BQW B;  2L1T A;  2WPK S;  4A5T S;  4JMY A;  5K0H A;  2HPP H;  5E0H A;  3UOP A;  1O5G H;  1S81 A;  4NA7 A;  1SGC A;  3SV9 A;  3EAA A;  2VID A;  3VB7 A;  5BNC A;  5HIY A;  3TPI Z;  4D7F A;  1EJE A;  1TOM H;  2J98 B;  1T31 A;  4X1P U;  3GDU A;  2GDE H;  1FLM A;  5C0T A;  1THR H;  1ZHR A;  1P8V C;  2B9L A;  1C9T A;  2ZKS A;  3BTK E;  3EE0 B;  1OWH A;  1BMM H;  1DS2 E;  1OP2 A;  1W2K H;  4F55 A;  4SGA E;  5CHB A;  1CE5 A;  1V2J T;  2AH4 X;  4ABA A;  4FVD A;  5EW1 H;  4I86 A;  5C0U A;  5EGM A;  3C1K A;  1MAY A;  2KZ4 A;  1FNI A;  1YKT A;  4UFG H;  2FYQ A;  3SNB A;  2EC9 H;  2ZZU H;  4AB9 A;  1O5C B;  1FDP A;  2C4F H;  1WBG B;  3F9G A;  1V2S T;  4I33 A;  1HLT H;  2WPJ S;  3B9F H;  1L0Z A;  3F68 H;  2W6I D;  2Z7F E;  2BVR H;  1J17 T;  1NT1 A;  1WOF A;  1H8D H;  2XWA A;  5HXF A;  1O3A A;  2GZ7 A;  1GJ6 A;  2ZQ1 A;  1XUK A;  5FPY A;  3IIT A;  1KXE A;  4K2Y A;  1AFQ C;  1TRM A;  3SU0 A;  1ZTK A;  5LPE A;  3QGN B;  1V2L T;  3A6R A;  2YNB A;  1GI8 B;  3LGU A;  1FZZ A;  4ABF A;  5LPF A;  3SZN A;  2IJO B;  1P3C A;  4DJZ B;  1TNK A;  1GGD C;  2A32 A;  3RLW H;  3RXJ A;  1GI6 A;  1ZHP A;  1QB6 A;  3ODF A;  2O8T A;  3HGN A;  1O0D H;  3ELA H;  4F48 B;  2JKH A;  5GIB A;  4R8T B;  1KY9 A;  1QUR H;  1K28 D;  3SQE E;  1ETS H;  2QA9 E;  2BY8 X;  1QJ7 B;  1UTJ A;  4IMQ A;  1L4Z A;  2PR3 A;  1O2U A;  1B0F A;  3MQK C;  4JCN A;  3SN8 A;  5IYT A;  2BVS H;  3KL6 A;  2CV3 A;  2LEL A;  1J9C H;  1BTP A;  3F2G A;  3TK5 A;  2BD7 A;  3KID U;  1XUF A;  4BAO B;  3GAS A;  1PPH E;  3BPK A;  1IQL A;  1XUG A;  2NR4 A;  1G3B A;  1SGF A;  6EST A;  1W11 U;  5IK2 D;  2QF4 A;  2QXH A;  4AG2 A;  3AK5 A;  1DLE A;  1HAH H;  3MU8 A;  4IBL H;  1YY3 A;  2R3U A;  4FUJ A;  2A4R A;  1TY9 A;  3V0X A;  2IJD 1;  1O2Q A;  3RXV A;  1XX9 A;  2H1U A;  4THN H;  4WMF A;  4IS5 A;  8KME 2;  5FXL A;  1A0J A;  1ZTJ A;  3TIU A;  2SGD E;  1OP0 A;  4YTA A;  1ESB A;  5EJL A;  1EAT A;  1DWC H;  1EJM A;  1UTO A;  5I46 H;  1MAX A;  2BLQ A;  4D7G A;  1V2V T;  1NRN H;  1L2E A;  5GND A;  2D26 C;  2ZPQ A;  1UO6 A;  4RN6 A;  2BVX H;  1VZQ H;  1AUJ A;  3STJ A;  2G55 A;  2J98 A;  3MU0 A;  5EOD A;  1TX8 A;  5EPN A;  1Y5A T;  3RXM A;  1V2P T;  3PYH A;  1XMN B;  5A0B A;  3ZZA A;  1HGT H;  1MMJ N;  2W3K A;  3QGJ A;  2PGB B;  1ELT A;  2DE8 A;  1VGC B;  6GCH G;  3STI A;  1MTW A;  4X6P A;  3L3T A;  1UCY H;  3FKS D;  3L6P A;  3RC5 A;  2PTN A;  5A8Z A;  4XFQ A;  2P59 A;  1S5S A;  3ZZB A;  1JRS A;  2FXR A;  1CSO E;  1Y3W A;  1XUI A;  1YCP M;  1G9I E;  2PGQ B;  3MI4 A;  2Y5G A;  4NIX A;  2Q6G A;  1LQD B;  1P9U A;  4YOJ A;  3ZOG A;  5EQQ A;  4TY7 A;  2C90 B;  4X2W A;  2R0X A;  3GCH B;  3PLK A;  5ABW A;  2KCP A;  5GWZ A;  1QY6 A;  3KF2 A;  1K1N A;  1M9U A;  3HPT B;  2ZF0 H;  1GJC B;  5TCC A;  1HNE E;  1O2V A;  2BQ6 B;  2KCA A;  5FL7 D;  2ZFT A;  1JRT A;  3BTT E;  2O8W A;  1FX0 B;  4NFF A;  4Y8Y A;  3ATM A;  1DX5 M;  1YBW A;  2FO9 A;  2OIN A;  4F49 A;  1QJ6 B;  2O8M A;  1NBM D;  2H5D A;  1XHN A;  1GBL A;  1OOK B;  2ZFS A;  1JNW A;  3SHA H;  5HMA A;  4AN7 A;  4GCH G;  1IQM A;  1NO9 H;  4NA8 A;  2FDA A;  1OSS A;  3RU4 T;  1HAZ B;  4YXW D;  3AVZ A;  2GV7 A;  5JB9 S;  3I78 A;  1K0H A;  2P94 A;  2Q9K A;  4Z6A H;  4Y7B A;  4OGY A;  3S7K B;  3M7T A;  3TJO A;  1OWE A;  1E35 B;  5E0J A;  1RIW B;  2QE7 D;  1LMW B;  1W0Y H;  3M3V A;  2BZA A;  2GP9 B;  2TGP Z;  5G4B A;  1LKA A;  2QF0 A;  1LHF H;  1K1L A;  1SLV B;  3PO1 B;  4TV4 A;  3P6Z B;  2Z3D A;  1ZOM A;  5DGJ A;  2KFW A;  3E4V A;  1HB0 B;  1ESA A;  2KCY A;  1O38 A;  5T6F A;  3Q3Y A;  3MFJ A;  2ZU3 A;  4NA9 H;  3U35 A;  1INC A;  1P2N A;  4IMZ A;  4CR5 A;  3B5M A;  4YM9 A;  3K88 A;  2PFE A;  1WSS H;  1YOA A;  4XBC A;  1O32 A;  4KEL A;  1W3P A;  3ZZ3 A;  1F5K U;  1LPK B;  1SGQ E;  3CS7 A;  2BX3 A;  3TNT A;  1AFE H;  1FN6 A;  2OLG A;  1TE0 A;  1O2O A;  1AI8 H;  2HPQ H;  1KLJ H;  2VIV A;  3QUM P;  4K1T A;  2C8Z B;  2ZA5 A;  1P2M A;  2PUX B;  3GOV B;  4UON A;  4OS5 A;  2QY0 B;  1KMH B;  2VVC A;  1O2W A;  1ELB A;  1S6L A;  3UIR A;  2KX4 A;  3HAT H;  3K9X B;  1W0K D;  3E91 A;  1MTN B;  1TRN A;  2IN2 A;  1CU1 A;  4JYT A;  3BTF E;  4ABD A;  3M3S A;  4WME A;  2OBO A;  1SGT A;  4K1S A;  1AZZ A;  2ZHQ H;  3MYW A;  1C1O A;  2PWX A;  2ZTX A;  4WXV A;  4DUR A;  5A0C A;  3T5F H;  4LZ1 H;  1UCY K;  5JDU B;  1C2I A;  1HAP H;  2XRC A;  1RZ0 A;  2FX6 A;  3A7V A;  1A46 H;  3ATW A;  1BHX F;  4KGA A;  5HGG A;  3TNS A;  1GHA F;  4JYV H;  5F53 A;  4MPW A;  1O5F H;  1C1W H;  4D76 A;  3ZOH A;  4I8G A;  3SJI A;  1FI8 A;  3MU5 A;  2GCT B;  1Z8G A;  1VCP A;  3URC A;  4MNX A;  2Z94 A;  1SGD E;  2GVF A;  2CK3 D;  2ZU1 A;  1K1O A;  2Y81 A;  1G32 B;  3HY8 A;  5F8T A;  1IAU A;  3VB4 A;  3A7W A;  5FBI A;  3TJU A;  9LPR A;  1YGC H;  4MTK A;  1JXP A;  1O2J A;  1BOQ A;  2ZDM A;  1W3R A;  4ISN A;  1MZD A;  1OYQ A;  2GMT B;  1EX3 A;  3H09 A;  3M37 A;  4BXW A;  2KM0 A;  4GVU A;  3LGI A;  2Z9K A;  1AO5 A;  3AAS A;  3QWC H;  4LK4 A;  1E1Q D;  1C1R A;  3JZ1 B;  2UUF B;  4IC5 A;  1RTF B;  2GUJ A;  1F0R A;  2K1Q A;  3UWJ H;  5DJ7 A;  1PQ7 A;  2TGD A;  1P2I A;  4LOY H;  2A2X H;  4FUH A;  1AZ8 A;  4RT1 A;  4HFP B;  1LCY A;  4X6N A;  1SHH B;  2FTM A;  1PQ8 A;  1IQE A;  5EPY A;  3U1J B;  3SJ9 A;  4TPY A;  2O9Q A;  3SI4 H;  3SO3 A;  1C5V A;  2VGC B;  1C2F A;  1BT7 A;  3GY7 A;  1ZPB A;  1GBM A;  1FLE E;  2FI4 E;  2J2U A;  3P92 A;  2FPZ A;  4BAN B;  3O8B A;  1O3F A;  3R5Y A;  2XNI A;  1HIA A;  2ZDK A;  2GGV B;  2TGA A;  4ISO A;  3DUX H;  1ELA A;  1SOZ A;  2V35 A;  1GDU A;  1GVL A;  2TPI Z;  1QZ8 A;  1VGC C;  1IQN A;  1O2P A;  2BOK A;  2QIQ A;  3EQ0 H;  1O2S A;  1C5X B;  1EAW A;  1PPB H;  2R9P A;  5DK1 A;  4R82 A;  1MU8 B;  2RDE A;  3V12 A;  3RDZ A;  1V2O T;  4FUC A;  4YLQ H;  5A0A E;  3M3T A;  4YO9 A;  3PMH B;  4YOI A;  1NRG A;  1GHW H;  4ZKR U;  3RM0 H;  4JZI A;  4X1R U;  5IDK A;  3TK6 A;  4JZ1 A;  4A92 A;  4I8J A;  2XW9 A;  1FMG A;  2KCO A;  1TRY A;  3E16 B;  4QVB A;  3GCH C;  1NU7 B;  3M61 U;  3RXR A;  5L30 H;  2YOL A;  2ZP0 H;  1ZGV A;  3OFN D;  3NFW A;  7KME H;  2HTD A;  1HAI H;  5T6D A;  3DMB A;  1JBU H;  1UTP A;  2F43 B;  4HG6 A;  1AB9 B;  3R0F A;  2QN5 T;  2J97 A;  1SR5 C;  2XC4 A;  2VIO A;  4Y6D A;  1DUA A;  5ETX A;  5EJZ A;  2GZ9 A;  4X8T H;  5FAH A;  1C2M A;  1ELV A;  1YF4 A;  3D62 A;  4AFZ A;  2SGA A;  2ZPS A;  5EXM A;  5DP8 A;  3OU0 A;  2STB E;  3PV4 A;  2QC2 A;  3VB6 A;  4D8N A;  5BRR E;  3MNX A;  2EEK A;  4ZHA A;  2K0Q A;  4NWL A;  2A4Q A;  3RXK A;  3D49 H;  5HKK D;  3LC3 A;  5JBB S;  2XTT B;  4YBN A;  1ZR0 A;  1PPC E;  1KDQ B;  1OWD A;  1GCD A;  2PKS B;  2ZO3 H;  3WY8 A;  2ASU B;  4XJ2 A;  4OS7 A;  1RIW C;  2HHZ A;  1MUE B;  3MO3 A;  1LQE A;  4CRD A;  5FBE A;  5JYI A;  1G3C A;  1A61 H;  1P57 B;  4O3U A;  4I31 A;  2YMS B;  2A7C A;  1KXD A;  3QZR A;  3AAV A;  5KEC A;  1P9S A;  1LO6 A;  2EA3 A;  1O2K A;  2W7S A;  4OS6 A;  1C1N A;  1O5B B;  1D3D B;  3LIW A;  2I02 A;  3F9H A;  3BSQ A;  4MPU A;  4I8L A;  4B73 A;  1N8O B;  1GMH F;  2B0F A;  3FAO A;  1HAV B;  5A2M H;  2P3T B;  1YPJ H;  3ITI A;  4LXB H;  4ZH8 A;  4UEH H;  3TH2 H;  4CBN A;  1QJ1 B;  2FZZ A;  2SGP E;  3P95 A;  8GCH F;  3A7T A;  1O2R A;  2Q1J A;  1TQ0 B;  3U28 C;  1S0Q A;  2GT8 A;  4FOU C;  4OM9 A;  3OTP A;  4DT7 B;  3UAI C;  4WH8 A;  1SQA A;  3UR6 A;  4MTB A;  3VXF H;  2M2A A;  4CH2 B;  4B6E A;  4B76 A;  1GWA A;  3LT3 A;  2ZG0 H;  4IN2 A;  1QL7 A;  3OEE D;  2BD9 A;  2J94 A;  1E34 B;  1NRO H;  1O5A B;  2HTI A;  3ZYD A;  1MAB B;  2HQ9 A;  1GJ4 H;  1OWJ A;  1Q2W A;  1WLK A;  1MKW H;  3D65 E;  1F2S E;  2NU2 E;  1AIX H;  3RU4 D;  1C1U H;  3SNC A;  2ODY B;  1DST A;  2OC7 A;  3BTQ E;  1H4W A;  3KQB A;  1AUT C;  1CBW C;  1LHD H;  2Y82 A;  3QDZ B;  2ED4 A;  1BBR E;  3VY2 A;  1GJ5 H;  4WH6 A;  1A5H A;  4XHY A;  1NPM A;  1O2M A;  4AB8 A;  4M9F A;  2ZFQ H;  2GCT C;  1YLC A;  2BDH A;  5TJX A;  1SGN E;  2VIW A;  4ACB A;  3PLP A;  3ZVA A;  5DP7 A;  1L4D A;  1TGT A;  1K22 H;  1LHC H;  4FXG H;  3PMJ A;  5DP3 A;  1ABI H;  2Z6B D;  2J92 A;  4ZXY H;  1A0H B;  1BQY A;  1P11 E;  1K9O E;  1GL1 A;  3LKW A;  2VWM A;  2H9H A;  3B8J A;  4DG4 A;  3EA9 A;  1ARC A;  4GLY A;  1T8L A;  2NWN A;  1NRQ H;  2ZQ2 A;  4WF8 A;  4XRN A;  4YLU A;  2Z9L A;  3URE A;  1G30 B;  4O03 A;  3OE7 D;  5FCK A;  4B75 A;  4A1V A;  2VWN A;  4Y8Z A;  1QL8 A;  3GYM A;  1P03 A;  2BD3 A;  3KYG A;  3KQE A;  1Z8I B;  1C1V H;  4I32 A;  2Z9I A;  1VJA U;  1CHG A;  2HWL B;  5HM2 A;  1SQR A;  4NG9 H;  3FKH A;  3S69 A;  1H9L B;  1O3M A;  3EGK H;  3RXL A;  4A1T A;  1EKB B;  3H5C B;  3T27 A;  3AAU A; 
#chains in the Genus database with same CATH homology
 4Z85 A;  4YWN A;  1G78 A;  2X1J A;  2X1K A;  1AXJ A;  3AWH A;  5KEC A;  4P02 A;  1W3Q A;  2ARZ A;  1T9M A;  4N7R C;  4HX6 A;  2I02 A;  2RE7 A;  3K87 A;  3U35 A;  2ECU A;  5KGO A;  5CHE C;  3B5M A;  2IG6 A;  3K88 A;  4I86 A;  3TGV A;  1YLN A;  1YOA A;  5CHO A;  1RFE A;  3K86 A;  3DNH A;  1W3P A;  3DB0 A;  3R5Y A;  3ZOD A;  1W9A A;  2A2J A;  3A20 A;  1G76 A;  3KYF A;  1DNL A;  2I51 A;  1Y30 A;  3U0I A;  4FOU C;  3IN6 A;  2IAB A;  2FHQ A;  2FUR A;  2VPA A;  4R82 A;  5JAB A;  2RDE A;  3R5L A;  2GJG A;  1NRG A;  1WGB A;  2IML A;  3A6R A;  3VYA A;  3DSG A;  1WLI A;  2D5M A;  5ESC A;  3FGE A;  4P00 A;  2FG9 A;  3ZOF A;  3U34 A;  3U5W A;  2D38 A;  2HTI A;  4QVB A;  2HQ9 A;  4ZKY A;  4IRA A;  1WLK A;  3BNK A;  3ZOG A;  4F48 B;  1CI0 A;  3SWJ A;  2L74 A;  2R0X A;  2QCK A;  3AMF A;  3NFW A;  3CP3 A;  2E83 A;  4HMW A;  2D37 A;  2HTD A;  2ED4 A;  3DMB A;  1RZ0 A;  3VY2 A;  4L82 A;  4HG6 A;  4XHY A;  3ZOH A;  5EIY A;  4HMT A;  5EJZ A;  1I0S A;  3ZOE A;  3VY5 A;  1RZ1 A;  3R5Z A;  1USF A;  2ASF A;  3GAS A;  3BPK A;  4RT0 A;  2NR4 A;  1XHN A;  3F7E A;  4HMS A;  1JNW A;  3HY8 A;  5EJ1 A;  2R6V A;  3CB0 A;  4HMU A;  1G77 A;  5KED A;  1W3O A;  3BA3 A;  4XRN A;  2OU5 A;  3R5W A;  3A6Q A;  2PTF A;  1WV4 A;  1TY9 A;  3PFT A;  3R5R A;  1I0R A;  4YBN A;  1W3R A;  2Q9K A;  3HMZ A;  3EC6 A;  2OL5 A;  1YWU A;  2HQ7 A;  4XJ2 A;  5BNC A;  3ZOC A;  2HHZ A;  1VL7 A;  2AQ6 A;  2ECR A;  3KYG A;  1EJE A;  4F07 A;  1G79 A;  1XXO A;  1USC A;  2QEA A;  4HMV A;  3RH7 A;  2D36 A;  3FKH A;  4HMX A;  4Y9I A;  5EJL A;  4RT1 A;  3H96 A;  1FLM A;  3CNR A;  3R5P A;  3E4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...