2RDEA

Crystal structure of vca0042 complexed with c-di-gmp
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
224
structure length
224
Chain Sequence
VSTINSTDALAMVEHSSELTLSITTPVGTKFVCRTPFIGTHTDKFLLVEMPKISADDLQYFFQEGFWMNIRAISPRGEGALIHFRSQLMHILQEPVPMAFLSIPNTMQVSQLRKEPRFELNLAGKVLFDEHRGDCELRDLSRSGCRFITPPLGKTYQVGDLVALEIFSDLRGTKTFPPLTGKICNLQRSLHHARYGLEFNEEGRNNAKNLLAQLKFNGTKLTLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis of cyclic diguanylate signal transduction by PilZ domains.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein VCA0042
total genus 42
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07238 PilZ PilZ domain
A PF12945 YcgR_2 Flagellar protein YcgR
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.110.10 Mainly Beta Roll Pnp Oxidase; Chain A Electron Transport, Fmn-binding Protein; Chain A 2rdeA01
2.40.10.220 Mainly Beta Beta Barrel Thrombin, subunit H predicted glycosyltransferase like domains 2rdeA02
2D36A 2I51A 1W3RA 3PFTA 2D5MA 2ECUA 1W9AA 4R82A 3U34A 3ZOEA 2R6VA 3VY2A 1RFEA 2RE7A 2FHQA 1WLKA 5EIYA 2A2JA 1W3OA 4HMSA 4XRNA 3NFWA 2RDEA 1FLMA 1USCA 4FOUC 2OU5A 3EC6A 3AMFA 4YWNA 3VYAA 3R5PA 4QVBA 3K88A 3KYFA 3AWHA 3GASA 3K87A 1RZ0A 3ZOFA 1NRGA 5EJLA 4HMTA 3DSGA 3CB0A 5KECA 2IG6A 3B5MA 1XXOA 3DNHA 1G77A 3DMBA 4HG6A 2ECRA 5CHOA 1XHNA 4HMWA 5JABA 2D37A 1YLNA 1WV4A 5CHEC 3IN6A 2Q9KA 1G78A 1JNWA 3BPKA 1VL7A 2FG9A 4HMXA 2ASFA 2X1KA 3F7EA 1I0RA 1W3QA 1RZ1A 2HTDA 1WLIA 2IMLA 2FURA 3RH7A 3A6RA 4P02A 3HMZA 3ZOGA 4HX6A 4Z85A 3H96A 4ZKYA 4P00A 3ZOHA 2ED4A 3FKHA 3HY8A 3CNRA 2R0XA 4XHYA 4YBNA 2D38A 3ZOCA 2GJGA 5ESCA 1USFA 3BA3A 2QCKA 4RT0A 5KGOA 3CP3A 1W3PA 2NR4A 4IRAA 3A6QA 4F07A 4XJ2A 5EJZA 1G76A 3FGEA 5BNCA 1T9MA 2VPAA 1TY9A 2HTIA 3R5RA 2I02A 3KYGA 2E83A 3R5LA 4Y9IA 3VY5A 3BNKA 5EJ1A 2AQ6A 4F48B 4RT1A 2HQ7A 3U5WA 1EJEA 2IABA 2QEAA 2HQ9A 3K86A 3U0IA 3SWJA 2PTFA 4HMUA 4HMVA 2HHZA 2L74A 1WGBA 4L82A 1CI0A 2X1JA 3E4VA 3R5YA 1YWUA 1YOAA 4N7RC 4I86A 3A20A 5KEDA 3R5WA 3U35A 1Y30A 3TGVA 1DNLA 2ARZA 2OL5A 1G79A 3ZODA 3DB0A 1AXJA 3R5ZA 1I0SA
chains in the Genus database with same CATH superfamily
1ZMNA 1AZ8A 1GBJA 1UTOA 2FTLE 3PRDA 3B23B 1HUTH 1THSH 1YLDA 2WPJS 4BXSA 1CVWH 1TPOA 1O2JA 3GS9A 1HDTH 1GHVH 1FIZA 3MTYA 3A88A 2P16A 4QVBA 5A2MH 2BY7X 3TPIZ 2FP7B 4I8GA 1TNGA 3AWHA 3P8OA 2Z3DA 5FXLA 2ASUB 1RZ0A 2ZPRA 1HAVB 3RU4T 2K4QA 3C1KA 1GI6A 1G3BA 1CGJE 4B2AA 2FOCA 3B5MA 1F5RA 3FAOA 3W1EA 4MTKA 3KL6A 1WTGH 1YPEH 2AGEX 1ZZZA 2A5IA 2RG3A 3S7KB 4WWYA 3QDZB 1C5VA 1VGCB 3LC5A 4Y71A 2FURA 5HIYA 1O39A 5DP7A 1FONA 1V6DA 1C5PA 1EPTA 1QBVH 1LO6A 1TX7A 2UUFB 3M61U 4WH6A 1IHSH 2ZU4A 3QGNB 1SGFG 1HJAB 3RXVA 4YXWD 4X8SH 1CHGA 3HY8A 2PTCE 4X1PU 2HLCA 2BLWA 2GMTC 2W3IA 1PQ7A 2HNTF 4U32A 4ASHA 1EJNA 1TRNA 1ARBA 1E1QD 1H1BA 5HMAA 3BA3A 4ZKOU 3LIWA 1BBRK 3A82A 3TITA 2HNTE 3TNTA 4AB8A 5F8ZA 3RU4E 2ODYB 1BT7A 2ZTXA 1ZMJA 5L2ZH 1TNJA 2PLXA 2QF4A 3RXEA 1O3MA 2GCTC 1D3PB 2E83A 1TX8A 2FM2A 1WDIA 2XNIA 2H6MA 3VGCB 4RI0A 1D6RA 2GMTB 2HQ7A 1M9UA 1V2TT 3MI4A 3UNSA 2Q6FA 5GDSH 1J15A 4E05H 1G30B 1V3XA 1TPSA 3TGIE 1GVLA 3ZV9A 1HAPH 1TBZH 2V3HH 4AC9A 2ZHEH 4CREA 3BTME 1GJ6A 4Y7BA 4ISIH 1XUIA 1VITF 2G5VA 1B7XB 1CT0E 1NU7B 2BD5A 2TGPZ 2ARZA 2EI7A 1G3DA 1CT4E 4UFEH 1HLTH 2J98A 1AU8A 5AHGH 1NY22 1W3RA 1NU9A 2FS8A 1SGYE 1GHAF 1PJPA 1Y8TA 2PV9B 2KCOA 4HMSA 1BB0B 2ZHWH 3AAUA 3EC6A 8GCHF 4Q7XA 1S85A 2OQUA 1C1SA 4B76A 5DK1A 3ZOFA 1RJXB 3LJJA 1CT2E 5A0AE 4JYUH 4X2VA 5K0HA 2TGTA 2BVRH 4B2BA 2BTCE 1BRUP 2VU8E 3RUOA 5EOKA 3AW0A 5FPYA 4VGCB 2Z9JA 3QGJA 1WQSA 1UTNA 1MU8B 1TGCA 5CHBA 4KKDA 1D4PB 3PV4A 3F7EA 2VGCC 1EKBB 1O2SA 5JBBS 3TGJE 1WLIA 1S6FA 2ZQ1A 3S7HB 1O2PA 2BD7A 5F03A 3SYJA 1MTUA 1ANDA 1O2WA 1QBNA 2ZEBA 4HX6A 1UW7A 1A7SA 3I78A 4YZUA 1OWJA 1P2MA 2Q6DA 2GDDA 2QA9E 3QZRA 1O35A 2Z7FE 5L2YH 2ALPA 1GCDA 2OP9A 4AX9H 1LKBA 2A4OA 4ZAEA 4ABIA 1CA0B 2AH4X 1GJ4H 3GICB 3MU8A 4YBNA 1RFNA 2J2UA 2JETB 2OTVA 3FP6E 5E2PA 3CP3A 3U1JB 1NRRH 1T9MA 4RN6A 1DWEH 5EGMA 1P2OA 3SGBE 5C17A 1CQQA 1SQRA 4DIIH 2D1JA 1KXEA 1RS0A 3BSQA 2GZ9A 1HFDA 2ZF0H 4GCHG 3RMOH 1ID5H 3VB3A 3O8BA 1DWBH 1YYY1 3SWJA 2VWMA 1ANEA 3WW7A 4M7GA 3E6PH 1H9LB 2NU2E 2UWPA 4WY3A 3C27B 1EPTC 1AIXH 1ZTLA 2QY0B 3KN2A 3AVZA 3SU0A 2YNAA 5AFYH 4MDSA 1K1OA 2Y5FA 4FU9A 4YESB 2O8LA 3RP2A 3STIA 3D65E 2ANMH 3Q3YA 2ZI2H 2C90B 2SFAA 2ECUA 3UR9A 3EAJA 2PKAA 3K6ZA 4X8UH 3UNRA 3TLOA 4OS2A 4OGXA 1QTFA 2ZO3H 1JRSA 3PMBB 2XCFA 3SZNA 4CRBA 1EZSC 1GJDB 1DVAH 4XBBA 5DP6A 4I33A 2IPHA 2VVUA 1OWDA 3T26A 2ZC9H 4BAMB 3MO9A 1XXOA 1LHGH 1QL7A 2GP9B 3HKIB 2PP6A 3D23A 1CO7E 1FY3A 3GY8A 3GYLB 1IQGA 2OC8A 1GBHA 5EXLA 4AYYB 4FXGH 5A0BA 1P2IA 3VB6A 3SU4A 1GMDG 1HAIH 1N6XA 1UMAH 1WCZA 3HK6B 4MPWA 4P02A 4UONA 3HMZA 4JZ1A 4HZHA 5GNDA 5HKKD 1YGCH 2JETC 4YTAA 4FUDA 1BA8B 1V2VT 1FXYA 3V13A 1AQ7A 3LGVA 1CA0C 1HAZB 3PMAB 1S6HA 6LPRA 2ZHDA 7KMEH 3W95A 2PUQH 1MUEB 4AB9A 1TLDA 1F92A 2UWOA 5F8TA 1K1IA 2PKSB 1NT1A 1SR5C 5BPEA 4OS1A 1GJAB 2VGCB 1KYNA 4GHTA 2A2XH 3MH6A 2ZFSA 5H4IB 1UVSH 4U30A 1F0TA 1UVOA 3KEEA 1SLXB 1C5MD 4MLFB 1EJEA 1P8VC 2ZKSA 5E0JA 2AHME 1ZSKA 3SV6A 8LPRA 1S5SA 3QZQA 1OWIA 4A92A 4UFDH 2L74A 1WGBA 3HE1A 1NM6A 2HPQH 2W6ID 2VIVA 4IN2A 1GHBF 3FP8E 1RIWB 1NRPH 2R0LA 1EOJA 5FBEA 1TABE 4I86A 4AGJA 3RXMA 3PLKA 4KTCA 1THRH 3MH4A 4TYDA 3TGVA 4TV4A 1D3DB 2K0QA 4U01A 1ETTH 4ABFA 1TBQH 4OS6A 3SU3A 3UQOA 2I51A 1V2KT 4A1TA 4B71A 8GCHG 2ZGJA 1XXDA 1E34B 2WINI 1VITH 1YKTA 4AFZA 2ANWA 2GUJA 2WPIS 5DGJA 4NSVA 1HAOH 1XM1A 1OHHD 2PR3A 1J17T 1NRGA 1GJ8B 4FU8A 3OEED 3ESTA 4D8NA 1EAUA 3SNDA 1LVBA 1C1VH 3E16B 3DMBA 1W3CA 1GI5A 4JZDH 5LPFA 1LPGB 4OGYA 5DP3A 1Y3VA 1GBTA 4Z1MD 1HIAB 1UTLM 2BX3A 4WH8A 1CSOE 3UTUH 1PPBH 4ZHMU 2G00A 4IMZA 1F7ZA 2BQ7B 4TY6A 1COWD 2P59A 1S82A 4ZKYA 3SUGA 1IQIA 4B73A 1O3NA 1V2WT 3CNRA 1P09A 5CE1A 1ELAA 4FUHA 5JB9S 4GPGA 1H8ED 1ELGA 1H8DH 5LGOA 4NSYA 4DCDA 2QYIA 2DE9A 2WPDD 2C8YB 1W3PA 3LC3A 3SJIA 5J4SA 1MAXA 5CHAB 1BRBE 1MZAA 1CHOG 2PHBA 3V7TA 2FOEA 3OYPA 3SNCA 4NIVA 1SFIA 2CK3D 4OS4A 1ZPBA 1BJVA 1HRTH 4B2CA 1VGCC 3RU4D 1O5BB 1A1RA 3DT0H 2P3UB 4ABAA 2XBYA 2GDEH 5FCKA 1SGCA 2HVYB 1NPMA 3K86A 1NROH 2HQ9A 4UDWH 4J2YB 4UE7H 1UCYH 5E0HA 1C4V2 3M5MA 1N8OB 1W11U 1S0RA 4E7RG 1FV9A 3FVFB 4WJG2 2QXIA 3PWBA 2FPZA 4B1TA 2F9NA 2J92A 1P3CA 5A8YA 3MNCA 4FETA 2CHAC 3SUEA 1SMFE 1Z8RA 2FOHA 4NGAH 2D36A 2Z9IA 1QJ7B 3SJ9A 1FI8A 4AGKA 5E0GA 3PV5A 2ZGXH 1ZHRA 2CHAB 4CR9A 3PO1B 4FVDA 1OP8A 1O3JA 1UVPA 2FOBA 2KCYA 3FZDA 4FUJA 4ABDA 1P03A 1GBIA 2J5UA 3BTGE 3SOSA 2WUCA 5FPSA 1GJ7B 1W0JD 3P8FA 2FWWA 4ACAA 4MNWA 1CBWB 5EJLA 3NPSA 2P95A 1J8AA 2ZDLA 2VIDA 2R9PA 3LGTA 1C1PA 1DXPA 1SKYE 3SU2A 1FAKH 3S9CA 1J16A 1O3BA 2GCHF 2O9QA 2W5EA 1D9IA 1NZQH 1O5DH 3OEHD 3FANA 1FY4A 4UFGH 5HIZA 3GY4A 1OXGA 5CHAC 1KLIH 2Y6TA 3GY3A 2ODPA 5A09A 3QLPH 1IOEA 2VWOA 1H8HD 2WPLS 4NFEA 4X2XA 2ZDKA 3DUXH 1Z7KA 3IG6B 3NCLA 3ZOHA 1BIOA 4IBLH 4DGJA 1ABIH 2GKVE 1EASA 3F3BA 1AY6H 1BDAA 4ZXXH 3SI4H 4BXWA 1NFWA 4TWWA 2C8ZB 1WOFA 4LXBH 3A7YA 2XXLA 1ZGIA 1EAIA 3F68H 1C5SA 1AKSB 1GG6C 1DUAA 1WUNH 1OYQA 5DJ7A 2ZZUH 3A84A 3RXFA 3TH4H 1GI7B 3TVJB 1AGJA 1NFXA 1ZHPA 3BNKA 2GX4A 3PROA 1A3EH 1GJ9B 4XDEA 2FOMB 4MNXA 2IOTA 1ZJDA 1KXCA 2BOKA 1SOTA 2V35A 1MCTA 1O34A 2BOHB 2HOBA 3A81A 2OLGA 4Q63A 2BVXH 3U28C 4ABBA 4B75A 3TGKE 2YMSC 3E4VA 1DPOA 5JPMH 1YOAA 2QN5T 1TNHA 1A3BH 4FUIA 3MQKC 5EU8A 4CHAC 1SLUB 2FZZA 4UFFH 1ANBA 1BRCE 3AASA 2RA3A 4K1SA 3ZVDA 3PFTA 2FOFA 4AFUA 1PPHE 2A7HA 2VNTA 4D76A 3MHWU 7GCHG 7ESTE 2A2JA 1QURH 1TMUH 3BTEE 3BIVH 4B6FA 4AFSA 2XC0A 4DT4A 2QC2A 4WMEA 1YY3A 3K88A 1MU6B 2I6QA 4HGCA 1RIWC 1O3FA 1ESAA 1E35B 1YPKH 4JZFH 2H9TH 3A86A 4X2YA 1O36A 1OWEA 4AG1A 3KNXA 2NU1E 4M9FA 4GUXA 4WMDA 3URCA 2VIQA 1RD3B 1WV4A 1GI4A 2H1UA 2H9HA 1KMHB 1Z6EA 2NU4E 3F6UH 1VL7A 1C1QA 1P11E 2FMJA 2KZ4A 4ISOA 9ESTA 1WV7H 1BJUA 3V0XA 5DG6A 3MU1A 1GBEA 1K2I1 2AS9A 3UAIC 5DPAA 1AMHA 4R0IA 3UIRA 3A6RA 1JOUB 4DG4A 2VIOA 1QHRB 2C8XB 2AERH 2BD8A 1FLEE 1Z71A 3UUZA 1O2QA 2THFB 2VBCA 3LH3A 1NRSH 2ED4A 3QK1A 2SGQE 3SQHE 2B5TB 1K0HA 1C5ZB 2C4FH 2ANYA 2AMDA 3TK9A 1MAYA 3RXRA 4ISNA 5AVDA 5FX6A 3LGWA 1K28D 1C2DA 1USFA 1T4UH 2ZTYA 5G4BA 4IRAA 1MBMA 1MTNB 1YBWA 3P70B 1P9UA 1BMLA 9LPRA 3ZVBA 1KXBA 1AKSA 1G32B 2V3OH 3SZEA 1O32A 1SQOA 1EXFA 3BTDE 4F4OC 1OKXA 1DM4B 3BG8A 3O8DA 1P2JA 5DP5A 5FPTA 4GSOA 1L2EA 1C4U2 1PPZA 4JK6A 3OTJE 3E8LA 2QEAA 1GHYH 1SLWB 3TJVA 1TALA 2SNWA 1GL1A 5L30H 1TRMA 3T5FH 1HYLA 5HYOA 1NFYA 4K5ZA 1C5LH 4YLUA 2ZFRH 5KEDA 3R5WA 2FI5E 1T8LA 1WU1A 1XUGA 1J9CH 4MNVA 3LKWA 3R5ZA 1I0SA 1CGHA 1GCTB 1GPZA 1S81A 2R3YA 2WPHS 1IQNA 1YCPH 4F55A 2ZCHP 3SN8A 3U34A 3ZOEA 3MNXA 3GY5A 4JYVH 2XBWA 5EIYA 2G51A 1ZR0A 2OCVB 4K1TA 1ESBA 4FOUC 2OU5A 3MH5A 1OS8A 1HIAA 1EZQA 1W13U 4KTSA 2ZA5A 1RTKA 5B6LA 1EZUC 1GMHF 1O2VA 1GI9B 2Z9GA 2HPPH 3F0PA 4HI3A 1SBWA 3PMJA 3D62A 1GVKB 2LELA 4X6NA 3A8CA 3TJOA 4CRCA 4GCHF 3DSGA 1TQ7B 3PV2A 5KECA 1UTQA 1OP0A 4BTIB 4A5TS 3TH2H 2FYQA 2ZU5A 3PM3A 1XHNA 1QNJA 1LHCH 2BX4A 2D37A 2AGIX 3RMMH 3RXAA 4H42U 1VR1H 2GZ7A 4MPUA 4XBDA 1O30A 3P92A 2V3MA 3A7WA 2P5ZX 1DDJA 1QZ8A 1SGDE 1I0RA 4ZKNU 4H6SB 1W3QA 2TPIZ 1P12E 1NRQH 4MPXA 4XE4A 1NFUA 5LH8A 1IQKA 1C5QA 2OC0A 3BTWE 3HK3B 1C5UA 4MQAA 3SW2B 4X0WU 1GBBA 1VITG 1NTPA 2ZCKP 3Q3KA 3H96A 3SI3H 1C1NA 2EC9H 2UUKB 1Y12A 1YP9A 3QX5H 1EATA 2V7QD 1O5EH 2H2ZA 5E8EH 1XMNB 3H7OA 3BG4B 3OX7U 2A4RA 3VXFH 1SGRE 3KHVA 2SGAA 1W7GH 1K9OE 3GCOA 1W2KH 2Y7XA 5E2OA 2G52A 4F07A 4XJ2A 1NN6A 2WUBA 1DE7H 4X2WA 3LONA 4K8BA 1O3OA 3A8BA 3FGEA 4PROA 4BANB 2FI3E 2STAE 1VJ9U 3N7EA 5I46H 2KM0A 5K7RA 2CN0H 3RXLA 1TA2A 3ODDA 1G9IE 1TNLA 2KAIB 3H09A 3RXBA 1T8NA 2O8MA 3RXHA 3S69A 3SQEE 2XBXA 3DSPA 1ZRBA 3QTVH 2I6SA 1HAYB 1V2UT 3L3TA 5A8XA 2VIPA 3SNAA 1OX1A 3ODFA 1GJBB 2ZG0H 1C2KA 1TGSZ 1O2YA 4ZKSU 3V4HA 3RXGA 3ZODA 3SHAH 1MH0A 2WHXA 1PQAA 5A8ZA 1SB1H 2A32A 1EJMA 2ALVA 5GXPA 4R82A 1Z8GA 2ZFTA 4BAOB 3KF2A 2R2WU 1J14A 4NZLA 3GCTF 3OY5U 5EW2H 3A85A 2P8OB 3MYWA 1D3TB 3GCNA 1DWDH 3K6YA 4I8KA 3PB1E 2ZDMA 1P06A 3SUDA 2W7SA 4YOIA 4NCYA 2EY4C 1QA7A 2FX6A 2M5TA 2GZ8A 1SVPA 5JBCS 3M3SA 2OK5A 3BTQE 3QN7A 3SU1A 2BQWB 2CMYA 2VIWA 2F4LA 1BTPA 1G77A 1E38B 1HNEE 1XUJA 5C20A 1T32A 3PTBA 1H9HE 3A89A 2XWAA 3RXUA 3ZZ5A 3VGCC 1PYTD 1BHXB 1LKAA 3HGNA 1ZLRA 2ASFA 1ZTKA 1TX6A 1AI8H 2GCTB 2VVCA 3ZZDA 4CBOA 1HJ8A 2O8TA 1RXPA 2NU0E 3BV9B 4I31A 4MG3A 4B74A 1C1MA 1EB1H 1W8BH 2K8IA 1SGTA 5FAHA 1AVGH 3ZIAD 4K2YA 1O2UA 1TONA 1LQEA 1T31A 1MKWH 3RXCA 3QO6A 1Y5BT 1FN6A 2ESTE 1Z1JA 2ZDVH 1IQFA 1T8MA 2KR7A 4TSFD 4X6OA 1SHYA 5B6OA 3HKJB 1X7AC 2XBVA 1HJAC 2GJGA 3F2HA 1UVTH 3UB0A 1GWAA 4I8JA 3SJKA 5IDKA 1ESTA 2A5KA 4D9QA 1L0ZA 2BLOA 2OD3B 1XUHA 1OOKB 3ZVFA 2ZDNA 1HAGE 1KXDA 3MU5A 4RT1A 2KCPA 3FKSD 1C1TA 2VINA 3KIDU 3M37A 2WSSD 3BTTE 2Y81A 5J4QA 3SJOA 2ZU1A 4IN1A 1O37A 1EAWA 3T29A 1C2GA 1DT2A 5EXNA 2ZFPH 3VG8A 3RC6A 1C1OA 1JIMA 4UEHH 2CF9H 5EW1H 4ACBA 1ACBE 1AB9C 1E0FD 4KP0A 2D26C 2OXSA 1HXEH 4CH2B 1C1WH 2VWLA 1RTFB 1DOJA 1FIWA 2D5MA 1XUKA 2K1QA 2IPQX 4UHVA 4UD9H 3O8RA 1GHBG 3VY2A 4YOJA 3PRBA 2FHQA 1L1JA 1Q2WA 2FOGA 3BEIB 3EAAA 3NFWA 1WSSH 4JYTA 1O3EA 2P94A 3SV9A 1ZPCA 2GT8A 5I25A 3VYAA 1ETRH 5FBIA 5HM2A 2Z9LA 1F2SE 3KYFA 2BB4A 1KIGH 3TIUA 2CV3A 2F9PA 3Q00A 6ESTA 4NA7A 3FN8A 1FN8A 4GLYA 2J98B 1TWXB 1GJ5H 1FZZA 1FJSA 4HMWA 1O3IA 1P2KA 1IQHA 1OWHA 4SGAE 3LU9B 2YOLA 5ESBA 2TRMA 1P05A 3S9BA 2QXHA 2H5CA 1TOCB 4Y11E 4HMXA 5GJ4B 1GHWH 1O2OA 3A7TA 3E0PB 2AIQA 1V2LT 1ELCA 2BDIA 1O3PB 5EPNA 4D7GA 1EOLA 3S0NA 1NS3A 1O5FH 1MMJN 4CRAA 1QA0A 2SGDE 2Y5HA 3GYMA 1C5RA 4CRGA 1MCVA 2VH0A 2B8OH 3HPTB 3BN9A 1QRWA 1HPGA 3R3GB 2KCAA 1ELTA 2QF3A 2VVVA 3ZVGA 2F91A 3RXPA 6CHAC 4B6EA 3ATWA 1UHBA 1YCPM 2G55A 4FUBA 4FUGA 1BOQA 2F83A 3F1SB 4K1EA 3ZV8A 2HGTH 2FIRH 5EJZA 1O33A 1WTHD 2J34A 4YT6H 3ZZ9A 1GBFA 2Y82A 1F0SA 6GCHF 1YPHE 1O0DH 2HTIA 3KQCA 1BTWA 4LK4A 4XD7D 3SORA 2R0KA 3R5LA 2VJ1A 1EQ9A 3UOUA 6CHAB 1BMFD 2RA0A 2GTBA 2L1TA 1P0SH 5IK2D 1VJAU 4FU7A 1WBGB 5DKMA 3GY7A 1C9PA 2BXUH 3EYDA 4Q7YA 4CBNA 1YLCA 4HMVA 3E91A 1QQ4A 5C3NA 1UK4A 5FHTA 4HKHA 1IQEA 1VKYA 3BEFB 2O8UA 1HGTH 1FNIA 2ZDAH 1P57B 3VEQB 1K1JA 3RC4A 2V6NA 2PUXB 2J38A 1ELBA 2J9NA 4TWYA 4D7FA 1AFEH 3OSYA 1A2CH 3DB0A 5C2ZA 3F9GA 2HALA 1NBMD 1AFQB 2BLVA 2GCHG 1SHHB 2SNVA 3STJA 4DT7B 4X6PA 2Z6BD 4DOQA 1FLMA 2LP6A 3M7TA 1HB0B 3CS0A 4YT7H 3IITA 1YPGH 5JYIA 1DANH 4DY7B 4O9VA 2PSYA 3FP7E 1QR3E 3P17H 1TYNA 2BXTH 3ZZ7A 4HMTA 1YPHC 2BDBA 1FY8E 2OBQA 2RFKC 3SGAE 2SGEE 1C9TA 5DO4H 5JBAS 1O5CB 1JWTA 2BDHA 1Z8IB 4ABHA 2R3UA 1YLNA 4AZ2B 3UR6A 1K21H 2HVXA 2DE8A 2FG9A 1SGEE 2C93B 4RSPA 3GCTG 1FX0B 3SV7A 1F5KU 1T7CA 3EQ0H 5EQQA 4CR5A 3U1IB 1A5GH 1XXFA 3GY2A 1JIRA 1Z6JH 1AHTH 1TPPA 3CENA 2GT7A 4QT8C 1YPMH 4WF8A 1GBCA 3JZ2B 3ZZ3A 5SGAE 1F0UA 1P10A 1LQDB 3GDUA 1QBOA 2QCYA 2A31A 1GI2A 4JZEH 5KGOA 3SUFA 1DY8A 1L1NA 1N1LA 2JJ2D 3ATLA 1GDQA 5FX5A 5BNCA 2VPAA 1GMCF 1P02A 2FO9A 1GDUA 2GD4B 2Q6GA 1NC6A 1PYTC 2LNCA 4OS5A 1MABB 2IABA 3MMGA 2OQ5A 2ZTZA 1C2MA 2PFEA 1UVUH 2QAAA 1C2HA 3SV8A 2C8WB 4E06H 2HHZA 3MO6A 2F9UA 4AFQA 1BMNH 4L82A 4YLQH 1P01A 2WV4A 3AK5A 3RDZA 1K1NA 1AO5A 3GCHC 1GHXH 1Y3YA 1LHDH 4MTBA 4INKA 3A83A 1KY9A 1S6LA 4O3TA 1ZJKA 3A7XA 3NKKA 5C94A 2CJIA 1GI8B 1IHTH 4TT3D 3G01A 3LGUA 2HNTC 1E79D 3RXJA 5T6GA 3ZZ6A 1PQ8A 1PPGE 5C5OA 2VH6A 2O8WA 1TFXA 1W9AA 1O38A 5HM9A 4X1RU 1Y5AT 1HBTH 1OWKA 4KTUA 4XRNA 3NUMA 1W14U 2A4QA 2M2AA 2IJD1 2WPMS 2ZPQA 4YWNA 4SGBE 2WZQA 3ZYEA 1TE0A 3GCHB 3GASA 1AN1E 1C1UH 1UTJA 1AD8H 1IQMA 2FDAA 1TRYA 1T4VH 3F9FA 5HGGA 4I7YH 1Q3XA 2FESH 1MKXH 4NWLA 2HWLB 1LHEH 1O2KA 2UUJB 5CHEC 1O2MA 1B5GH 2BY6X 1CU1A 2FI4E 3DHKH 3OU0A 1LTOA 1CHOF 3U8TH 3PWCA 5EQRA 2KFWA 2NWNA 4XBCA 2G5NA 3ZZBA 4HTCH 1GBDA 1SQAA 1XX9A 2HLDD 2IMLA 2F9OA 1BTXA 2ZWLH 1RGQA 4FVBA 1O31A 4Q4LA 3NRLA 1CA8B 3UOPA 4ISHH 3B9FH 4Z6AH 1V2RT 5T6DA 1SFQB 4Z85A 1AZZA 1GMHG 2NU3E 3DCLA 4O3UA 5C1UA 2F9VA 5LPRA 1GGDB 3UY9A 4XHYA 3URDA 5T6FA 3NZIA 1XVMA 1EFRD 2WV9A 3GDVA 2NR4A 1IQJA 2J94A 2PKSC 3AW1A 3LPRA 2Y5GA 1EB2A 1AVXA 1BTHH 1BQYA 2D8WA 5DP9A 1O3CA 3RMLH 3K9XB 1ZOMA 2VWNA 2ZPSA 1LPKB 3LJOA 3UFAA 2BY5X 3DD2H 2AQ6A 2EI8A 1BUIA 5C0TA 3WY8A 1UK2A 2PGBB 4TPYA 3EE0B 5JBTA 1FQ3A 1THPB 2PTFA 3M5OA 3LT3A 1P2QA 4TPIZ 1H4WA 1DS2E 1TIOA 4NFFA 1MD7A 3F2GA 3MOCA 2FXRA 1LCYA 1HV7A 2FTMA 4FUEA 3QWCH 1A0LA 4Y7AA 4Y8XA 5TCAA 1ZPZA 3R0FA 1DNLA 3Q76A 2FLRH 1A0HB 3KQBA 1EZXC 1ETSH 2YMSD 2ZP0H 1Q31A 4K69A 1AFQC 4X1NU 3UWIA 1GI3A 1RFEA 2RE7A 1O2NA 4Y79A 1RTLA 2G8TA 3P8NA 2HRVA 3SGQE 2JH6D 1O5AB 4ESTE 4MNYA 5FCRA 4LZ1H 2C3SA 4XSKU 1JXPA 3EDXB 2Y7ZA 1BTYA 1BTZA 1HCGA 3M3TA 1IQLA 3A7VA 5DSFA 2A5AA 1GMCG 4O03A 1O2TA 1ZSJA 4HG6A 1QL9A 4ZROA 1GCTC 2TIOA 1TNKA 2GV6A 1VCWA 4OS7A 4A1VA 2ZU2A 2Q9KA 1SGPE 1G78A 1HAHH 1TOMH 3TJNA 1TNIA 2G4TA 1AVWA 4Y10E 4AG2A 3OAAD 2Q1JA 2HTDA 3UQVA 3MNSA 1TA6A 4GAWA 3LGYA 2H9EH 1V2MT 3UPEA 2A0QB 2PKAB 4RKJB 1D3QB 2BZAA 1C2FA 2FODA 2QXGA 4Z0KA 1UO6A 1DY9A 3BTKE 1A5IA 1E37B 2XRCA 2FEQH 4E7NA 5C1XA 2D38A 1C2LA 4J1YA 1GMDF 3HATH 2RDLA 3H5CB 4RT0A 4MVNA 3I29A 3QTOH 3MO3A 1EUFA 1SLVB 3BF6H 1E1RD 3P95A 5F8XA 1MTNC 1SI5H 4JMYA 4IMQA 3E90B 4DVAU 1TBRH 3R5RA 1MBQA 4ASUD 1BMAA 3KYGA 3QUMP 1DSUA 2QF5A 1MQ5A 4O97A 4CRDA 3U5WA 4DJZB 2UUYA 4ZH8A 1V2QT 3O8CA 4Y76A 3PTNA 1P9SA 3ZZ8A 1KXFA 1UTPA 2QIQA 2ZECA 3MH7A 1E36B 2EQNA 2ZU3A 3V3MA 4F49A 3SNEA 2B0FA 3SV2H 1A46H 1CE5A 2QV1A 4AYVB 1F0RA 5C67A 1KLTA 3A20A 1TGNA 2A4GA 1C5OH 2JDID 5GIBA 5ABWA 2OL5A 5GWZA 1QCPA 3B8JA 1AXJA 2QXJA 2BQ6B 1JBUH 1A5HA 1B0FA 1GVZA 1KDQA 1QFKH 3KQDA 4NWKA 4U2WA 4ABEA 1O3LA 1W3OA 1YCPK 4NG9H 2XWBI 1DUEA 2PW8H 5FL7D 1DICA 1W7XH 1ZTJA 1USCA 3LH1A 4AOQA 1C5WB 4FUFA 1AB9B 1W10U 1OPHB 2ZGCA 2WYGA 1AE5A 1NRNH 2OINA 2P3TB 1GJCB 2AFQB 2BYAX 3NXPA 4X6MA 1TGBA 3SU6A 1SGNE 3GOVB 3LGIA 1A4WH 2Z3CA 4WVPE 3RLWH 6GCHG 2ECRA 1LPZB 1Y3XA 1L4ZA 3A80A 3ZZ4A 5JABA 5JB8S 1ZRKA 1EP5A 2JH0D 2FOAA 2TBSA 1MQ6A 3T2NA 1Y3UA 3F9EA 1O3GA 2SGPE 1C2IA 1S84A 2Z9KA 1ABJH 3GISB 2YMSB 3ZVCA 3NK8A 1A0JA 1FY1A 1KDQB 1G3CA 3PLPA 1ZYOA 5BRRE 2G81E 1C4Y2 2XYAA 2ZHQH 5EQSA 3WWFA 5HXFA 1DITH 3L6PA 3FKHA 4IS5A 3P8GA 2XOKD 4NIYA 1S0QA 2FS9A 3IWMA 3GDSA 1GI0A 4A1XA 1G2MA 5IYTA 1W0KD 3ZOCA 4WXIA 5ESCA 5AFZH 2QCKA 5GCHG 2QE7D 4ISLA 3ITIA 1GBKA 4BAQB 1G37A 2B7DH 1UK3A 2BDGA 3BEUA 4BOHA 1GL0E 2KX4A 7LPRA 5DP8A 2ZNKH 3BIUH 3RMNH 1D6WA 4THNH 2OC1A 1SG8B 3OFND 1TB6H 1BITA 1F5LA 5T3HA 4ZCNA 3RXTA 5GPIB 3ZVAA 3A7ZA 2IN2A 1ELEE 4IC6A 3U8OH 1P04A 1PPFE 4R8TB 2FLBH 2CXVA 2PSXA 3VB5A 1O5GH 1PFXC 2ZGHA 1PQ5A 1VCQA 2WV5A 3VB4A 2AEIH 2P8OC 2D2DA 2YNBA 3U9AH 3RXKA 2PGQB 3SO3A 5TCCA 1UTMA 1BRAA 2A2QH 4LZ4B 1O2ZA 2L6OA 3N7OA 3RXIA 3KQ5A 4GVUA 3U69H 2EI6A 1GBLA 1V2JT 3T62A 2Z94A 1UCYE 4Y8ZA 2F9BH 4AN7A 1ZMLA 2PWXA 2XC4A 4GHQA 5C1YA 3M3VA 1QB9A 1UTKA 1Z1IA 3K87A 3VXEH 1BTUA 2BM2A 2ZQ2A 3PO1C 3CB0A 3T25A 1NBME 2BD3A 3W94A 1ZHMA 3DNHA 1TAWA 4ABGA 3OY6U 2ZFQH 1YC0A 1XUFA 1INCA 2XC5A 4X1SU 5CDFE 4X8TH 2ULLA 3SJ8A 1GI1A 4H6TA 3A87A 2TGAA 2XW9A 1EJAA 3KQEA 4IC5A 3RH7A 4CH8B 2B9LA 5F53A 2DUCA 1AWHB 3ZOGA 1L4DA 1QB1A 1N8OC 1NO9H 4WXVA 1CGIE 4NA8A 1IAUA 4Q7ZA 4INHA 3BG4C 1TPAE 1U6QA 1YPLH 3F9HA 4BAHB 1GGDC 1VCPA 3V12A 4RKOB 4AORA 2SGFE 1KXAA 1V2ST 1BMMH 3MWIU 4DIHH 1FDPA 1QY6A 1YM0A 3EA9A 2GVFA 1MD8A 1RRKA 1TY9A 1LVYA 4W64A 1BBRH 4H4FA 5C0UA 3WWBA 2CF8H 1QL8A 2BY8X 1O2GH 3N99A 1DFPA 3VY5A 2W3KA 3EE7A 1V2NT 1BZXE 3NWUA 4X8VH 3TU7H 4CRFA 1O2HA 3FOAA 5C5NA 3U0IA 3RXSA 2BDAA 2FYRA 2OUAA 3SBKA 1K1MA 1WXRA 1MKXK 3M5NA 1CI0A 1V2PT 2ZGBH 2XCNA 2BDCA 1QQUA 1YWUA 1HAXB 2JH5D 2XNDD 1XKBC 4LOYH 2EA3A 3U35A 3TK6A 1UJ1A 1ELVA 1TMBH 1G79A 3CS7A 2BD2A 3BTFE 2W26A 3RXDA 3MU4A 1PPEE 3PLBA 1N6YA 1DWCH 1LVOA 5EXMA 2OBOA 2R6VA 1ELFA 1C2EA 1WLKA 1H8IH 2ZCLP 1O3KA 2IJOB 1AE8H 3ATIA 1JMOH 4TY7A 4I8HA 4ZHAA 1MTSA 1B0EA 3CP7A 2A45B 2A7JA 2GV7A 2V0BA 3R5PA 1O2RA 1QB6A 2BZ6H 2AMPA 3UNQA 1HXFH 1HAVA 1QJ6B 3AAVA 1DLKB 5L6NH 1K1PA 1P2NA 3ZZAA 1XKAC 1C5TA 1C5NH 3E3TA 3I77A 1S83A 3EGKH 1W0ZU 2QGRA 3DSOA 1LDTT 4ZHLU 4DURA 1LMWB 2AGGX 3IN6A 4NZQA 3UREA 5GCHF 3A8AA 1JNWA 3BPKA 3ZYDA 1UHBB 1YF4A 1QIXB 4ZXYH 1KSNA 2BY9X 4I8LA 1FPHH 3K2UA 2JKHA 1EX3A 5ETXA 5LPEA 4A7IB 2AYWA 4YOGA 1O3HA 3ZZCA 1YPJH 4YM9A 5TJXA 3Q77A 3D49H 4P00A 5F6MA 1FMGA 2R0XA 1FPCH 4BTUB 4FUCA 1DX5M 5CMXH 1AUJA 2STBE 1MZDA 1AWFH 3OE7D 1EAXA 1WYKA 4Y0YE 1FY5A 2PTNA 3BTHE 1G3EA 1Y3WA 1K1LA 1G76A 5A0CA 1O3DA 4A6LA 4BAKB 1OP2A 1GHZA 5EG4A 1SOZA 5DN6D 3FO8D 2I02A 1K22H 3ENSB 1MKWK 1ELDE 1O3AA 2P3FH 4WMFA 1W12U 3ATKA 3GY6A 4INLA 4ZUHA 4KELA 4D9RA 1Z8JB 4XFQA 2Y80A 3MFJA 3U98H 1T8OA 1SQTA 1XVOA 3FFGA 1A61H 5EODA 3VPKA 1OYTH 2BHGA 1ORFA 1WAYB 3A8DA 4K8YA 1KLJH 2X1JA 3RM0H 1EP6A 4BTTB 2BVSH 3M7UA 3T28A 4N7RC 1ARCA 3ZVEA 2ANKH 2BLQA 3EA8A 1Y30A 1FAXA 1SGFA 2WYJA 1SPJA 3UWJH 8ESTE 2A7CA 2ZHFH 1MTWA 3M5LA 3H7TA 4IGDA 1JRTA 1KTTB 1BCUH 1LHFH 1SGIB 2ZIQH 5JDUB 2R2MB 3VFEA 2RCEA 3TNSA 4OM9A 2RDEA 5ESTE 3PYHA 4CHAB 1DXWA 3AMFA 2OC7A 4Y6DA 3M36A 3RC5A 2ZFFH 1ZGVA 2JJ1D 2CGAA 2F3CE 3RLYH 4KGAA 3SU5A 1H9IE 3EA7A 4DW2U 3RXOA 3KCGH 1BBRE 2IG6A 3DFJA 1W0YH 3KGPA 1O2LA 3MNBA 5CHOA 3M7QA 3RM2H 4NIWA 1AUTC 5T1VA 2F43B 3N7DA 1PPCE 1DLEA 4Y8YA 4ZKRU 3E0NB 3DFLA 3P6ZB 1Y5UT 3FZZA 1SC8U 3RXQA 2P93A 3F2FA 1DSTA 2X1KA 1GHAG 3OTPA 2TGDA 4MPVA 3ATMA 1RZ1A 2BD4A 1GG6B 3PMHB 1C1RA 1Y59T 2W6JD 2J4IA 1EPTB 4XOJA 4BNRA 1UCYK 1O2IA 3DA9B 2AIPA 3SNBA 1FUJA 2FX4A 1ANCA 1P3EA 2W7UA 3F0OA 3L33A 1OSSA 3SHCH 4Q80A 1C5YB 4K3JA 8KME2 5PTPA 4ZMAH 3TH3H 5EPYA 4JZIA 1QGFA 5AF9H 2J95A 2KAIA 4I32A 2BD9A 2UWLA 2WPKS 3JZ1B 1LVMA 1MTVA 3S9AA 4YO9A 4HFPB 3A6QA 1HJ9A 1L1GA 2LPRA 2BDYA 3M35A 1SSXA 2GGVB 1NESE 3Q3XA 1TGTA 2BMGB 3ELAH 1VZQH 1O2XA 3LOXA 1SGQE 4X1QU 4Y9IA 4NA9H 5EJ1A 1C2JA 4JK5A 4F48B 4ABJA 3VB7A 1KTSB 2JIZD 4Q2KA 5DP4A 4JCNA 2AMQA 1TQ0B 1BHXF 1C5XB 4Y0ZE 1GBMA 1QRXA 2A1DB 4HMUA 1QRZA 1SL3A 4IW4E 1GDNA 3K65B 1GBAA 4K60A 2EEKA 2Z3EA 3E1XB 3U8RH 1CBWC 2H5DA 2XTTB 7GCHF 3LDXH 1TMTH 4NIXA 1G36A 2J97A 3R5YA 3TJUA 2G4UA 3TK5A 1V2OT 2QF0A 2ILNA 1G2LA 1WQVH 2VB0A 2ODQA 1QJ1B 3MU0A 1ZSLA 4VGCC 3T27A 3HGPA
chains in the Genus database with same CATH topology
2D36A 2I51A 1W3RA 3PFTA 2D5MA 2ECUA 1W9AA 4R82A 3U34A 3ZOEA 2R6VA 3VY2A 1RFEA 2RE7A 2FHQA 1WLKA 5EIYA 2A2JA 1W3OA 4HMSA 4XRNA 3NFWA 2RDEA 1FLMA 1USCA 4FOUC 2OU5A 3EC6A 3AMFA 4YWNA 3VYAA 3R5PA 4QVBA 3K88A 3KYFA 3AWHA 3GASA 3K87A 1RZ0A 3ZOFA 1NRGA 5EJLA 4HMTA 3DSGA 3CB0A 5KECA 2IG6A 3B5MA 1XXOA 3DNHA 1G77A 3DMBA 4HG6A 2ECRA 5CHOA 1XHNA 4HMWA 5JABA 2D37A 1YLNA 1WV4A 5CHEC 3IN6A 2Q9KA 1G78A 1JNWA 3BPKA 1VL7A 2FG9A 4HMXA 2ASFA 2X1KA 3F7EA 1I0RA 1W3QA 1RZ1A 2HTDA 1WLIA 2IMLA 2FURA 3RH7A 3A6RA 4P02A 3HMZA 3ZOGA 4HX6A 4Z85A 3H96A 4ZKYA 4P00A 3ZOHA 2ED4A 3FKHA 3HY8A 3CNRA 2R0XA 4XHYA 4YBNA 2D38A 3ZOCA 2GJGA 5ESCA 1USFA 3BA3A 2QCKA 4RT0A 5KGOA 3CP3A 1W3PA 2NR4A 4IRAA 3A6QA 4F07A 4XJ2A 5EJZA 1G76A 3FGEA 5BNCA 1T9MA 2VPAA 1TY9A 2HTIA 3R5RA 2I02A 3KYGA 2E83A 3R5LA 4Y9IA 3VY5A 3BNKA 5EJ1A 2AQ6A 4F48B 4RT1A 2HQ7A 3U5WA 1EJEA 2IABA 2QEAA 2HQ9A 3K86A 3U0IA 3SWJA 2PTFA 4HMUA 4HMVA 2HHZA 2L74A 1WGBA 4L82A 1CI0A 2X1JA 3E4VA 3R5YA 1YWUA 1YOAA 4N7RC 4I86A 3A20A 5KEDA 3R5WA 3U35A 1Y30A 3TGVA 1DNLA 2ARZA 2OL5A 1G79A 3ZODA 3DB0A 1AXJA 3R5ZA 1I0SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D36 A;  2I51 A;  1W3R A;  3PFT A;  2D5M A;  2ECU A;  1W9A A;  4R82 A;  3U34 A;  3ZOE A;  2R6V A;  3VY2 A;  1RFE A;  2RE7 A;  2FHQ A;  1WLK A;  5EIY A;  2A2J A;  1W3O A;  4HMS A;  4XRN A;  3NFW A;  2RDE A;  1FLM A;  1USC A;  4FOU C;  2OU5 A;  3EC6 A;  3AMF A;  4YWN A;  3VYA A;  3R5P A;  4QVB A;  3K88 A;  3KYF A;  3AWH A;  3GAS A;  3K87 A;  1RZ0 A;  3ZOF A;  1NRG A;  5EJL A;  4HMT A;  3DSG A;  3CB0 A;  5KEC A;  2IG6 A;  3B5M A;  1XXO A;  3DNH A;  1G77 A;  3DMB A;  4HG6 A;  2ECR A;  5CHO A;  1XHN A;  4HMW A;  5JAB A;  2D37 A;  1YLN A;  1WV4 A;  5CHE C;  3IN6 A;  2Q9K A;  1G78 A;  1JNW A;  3BPK A;  1VL7 A;  2FG9 A;  4HMX A;  2ASF A;  2X1K A;  3F7E A;  1I0R A;  1W3Q A;  1RZ1 A;  2HTD A;  1WLI A;  2IML A;  2FUR A;  3RH7 A;  3A6R A;  4P02 A;  3HMZ A;  3ZOG A;  4HX6 A;  4Z85 A;  3H96 A;  4ZKY A;  4P00 A;  3ZOH A;  2ED4 A;  3FKH A;  3HY8 A;  3CNR A;  2R0X A;  4XHY A;  4YBN A;  2D38 A;  3ZOC A;  2GJG A;  5ESC A;  1USF A;  3BA3 A;  2QCK A;  4RT0 A;  5KGO A;  3CP3 A;  1W3P A;  2NR4 A;  4IRA A;  3A6Q A;  4F07 A;  4XJ2 A;  5EJZ A;  1G76 A;  3FGE A;  5BNC A;  1T9M A;  2VPA A;  1TY9 A;  2HTI A;  3R5R A;  2I02 A;  3KYG A;  2E83 A;  3R5L A;  4Y9I A;  3VY5 A;  3BNK A;  5EJ1 A;  2AQ6 A;  4F48 B;  4RT1 A;  2HQ7 A;  3U5W A;  1EJE A;  2IAB A;  2QEA A;  2HQ9 A;  3K86 A;  3U0I A;  3SWJ A;  2PTF A;  4HMU A;  4HMV A;  2HHZ A;  2L74 A;  1WGB A;  4L82 A;  1CI0 A;  2X1J A;  3E4V A;  3R5Y A;  1YWU A;  1YOA A;  4N7R C;  4I86 A;  3A20 A;  5KED A;  3R5W A;  3U35 A;  1Y30 A;  3TGV A;  1DNL A;  2ARZ A;  2OL5 A;  1G79 A;  3ZOD A;  3DB0 A;  1AXJ A;  3R5Z A;  1I0S A; 
#chains in the Genus database with same CATH topology
 1ZMN A;  1AZ8 A;  1GBJ A;  1UTO A;  2FTL E;  3PRD A;  3B23 B;  1HUT H;  1THS H;  1YLD A;  2WPJ S;  4BXS A;  1CVW H;  1TPO A;  1O2J A;  3GS9 A;  1HDT H;  1GHV H;  1FIZ A;  3MTY A;  3A88 A;  2P16 A;  4QVB A;  5A2M H;  2BY7 X;  3TPI Z;  2FP7 B;  4I8G A;  1TNG A;  3AWH A;  3P8O A;  2Z3D A;  5FXL A;  2ASU B;  1RZ0 A;  2ZPR A;  1HAV B;  3RU4 T;  2K4Q A;  3C1K A;  1GI6 A;  1G3B A;  1CGJ E;  4B2A A;  2FOC A;  3B5M A;  1F5R A;  3FAO A;  3W1E A;  4MTK A;  3KL6 A;  1WTG H;  1YPE H;  2AGE X;  1ZZZ A;  2A5I A;  2RG3 A;  3S7K B;  4WWY A;  3QDZ B;  1C5V A;  1VGC B;  3LC5 A;  4Y71 A;  2FUR A;  5HIY A;  1O39 A;  5DP7 A;  1FON A;  1V6D A;  1C5P A;  1EPT A;  1QBV H;  1LO6 A;  1TX7 A;  2UUF B;  3M61 U;  4WH6 A;  1IHS H;  2ZU4 A;  3QGN B;  1SGF G;  1HJA B;  3RXV A;  4YXW D;  4X8S H;  1CHG A;  3HY8 A;  2PTC E;  4X1P U;  2HLC A;  2BLW A;  2GMT C;  2W3I A;  1PQ7 A;  2HNT F;  4U32 A;  4ASH A;  1EJN A;  1TRN A;  1ARB A;  1E1Q D;  1H1B A;  5HMA A;  3BA3 A;  4ZKO U;  3LIW A;  1BBR K;  3A82 A;  3TIT A;  2HNT E;  3TNT A;  4AB8 A;  5F8Z A;  3RU4 E;  2ODY B;  1BT7 A;  2ZTX A;  1ZMJ A;  5L2Z H;  1TNJ A;  2PLX A;  2QF4 A;  3RXE A;  1O3M A;  2GCT C;  1D3P B;  2E83 A;  1TX8 A;  2FM2 A;  1WDI A;  2XNI A;  2H6M A;  3VGC B;  4RI0 A;  1D6R A;  2GMT B;  2HQ7 A;  1M9U A;  1V2T T;  3MI4 A;  3UNS A;  2Q6F A;  5GDS H;  1J15 A;  4E05 H;  1G30 B;  1V3X A;  1TPS A;  3TGI E;  1GVL A;  3ZV9 A;  1HAP H;  1TBZ H;  2V3H H;  4AC9 A;  2ZHE H;  4CRE A;  3BTM E;  1GJ6 A;  4Y7B A;  4ISI H;  1XUI A;  1VIT F;  2G5V A;  1B7X B;  1CT0 E;  1NU7 B;  2BD5 A;  2TGP Z;  2ARZ A;  2EI7 A;  1G3D A;  1CT4 E;  4UFE H;  1HLT H;  2J98 A;  1AU8 A;  5AHG H;  1NY2 2;  1W3R A;  1NU9 A;  2FS8 A;  1SGY E;  1GHA F;  1PJP A;  1Y8T A;  2PV9 B;  2KCO A;  4HMS A;  1BB0 B;  2ZHW H;  3AAU A;  3EC6 A;  8GCH F;  4Q7X A;  1S85 A;  2OQU A;  1C1S A;  4B76 A;  5DK1 A;  3ZOF A;  1RJX B;  3LJJ A;  1CT2 E;  5A0A E;  4JYU H;  4X2V A;  5K0H A;  2TGT A;  2BVR H;  4B2B A;  2BTC E;  1BRU P;  2VU8 E;  3RUO A;  5EOK A;  3AW0 A;  5FPY A;  4VGC B;  2Z9J A;  3QGJ A;  1WQS A;  1UTN A;  1MU8 B;  1TGC A;  5CHB A;  4KKD A;  1D4P B;  3PV4 A;  3F7E A;  2VGC C;  1EKB B;  1O2S A;  5JBB S;  3TGJ E;  1WLI A;  1S6F A;  2ZQ1 A;  3S7H B;  1O2P A;  2BD7 A;  5F03 A;  3SYJ A;  1MTU A;  1AND A;  1O2W A;  1QBN A;  2ZEB A;  4HX6 A;  1UW7 A;  1A7S A;  3I78 A;  4YZU A;  1OWJ A;  1P2M A;  2Q6D A;  2GDD A;  2QA9 E;  3QZR A;  1O35 A;  2Z7F E;  5L2Y H;  2ALP A;  1GCD A;  2OP9 A;  4AX9 H;  1LKB A;  2A4O A;  4ZAE A;  4ABI A;  1CA0 B;  2AH4 X;  1GJ4 H;  3GIC B;  3MU8 A;  4YBN A;  1RFN A;  2J2U A;  2JET B;  2OTV A;  3FP6 E;  5E2P A;  3CP3 A;  3U1J B;  1NRR H;  1T9M A;  4RN6 A;  1DWE H;  5EGM A;  1P2O A;  3SGB E;  5C17 A;  1CQQ A;  1SQR A;  4DII H;  2D1J A;  1KXE A;  1RS0 A;  3BSQ A;  2GZ9 A;  1HFD A;  2ZF0 H;  4GCH G;  3RMO H;  1ID5 H;  3VB3 A;  3O8B A;  1DWB H;  1YYY 1;  3SWJ A;  2VWM A;  1ANE A;  3WW7 A;  4M7G A;  3E6P H;  1H9L B;  2NU2 E;  2UWP A;  4WY3 A;  3C27 B;  1EPT C;  1AIX H;  1ZTL A;  2QY0 B;  3KN2 A;  3AVZ A;  3SU0 A;  2YNA A;  5AFY H;  4MDS A;  1K1O A;  2Y5F A;  4FU9 A;  4YES B;  2O8L A;  3RP2 A;  3STI A;  3D65 E;  2ANM H;  3Q3Y A;  2ZI2 H;  2C90 B;  2SFA A;  2ECU A;  3UR9 A;  3EAJ A;  2PKA A;  3K6Z A;  4X8U H;  3UNR A;  3TLO A;  4OS2 A;  4OGX A;  1QTF A;  2ZO3 H;  1JRS A;  3PMB B;  2XCF A;  3SZN A;  4CRB A;  1EZS C;  1GJD B;  1DVA H;  4XBB A;  5DP6 A;  4I33 A;  2IPH A;  2VVU A;  1OWD A;  3T26 A;  2ZC9 H;  4BAM B;  3MO9 A;  1XXO A;  1LHG H;  1QL7 A;  2GP9 B;  3HKI B;  2PP6 A;  3D23 A;  1CO7 E;  1FY3 A;  3GY8 A;  3GYL B;  1IQG A;  2OC8 A;  1GBH A;  5EXL A;  4AYY B;  4FXG H;  5A0B A;  1P2I A;  3VB6 A;  3SU4 A;  1GMD G;  1HAI H;  1N6X A;  1UMA H;  1WCZ A;  3HK6 B;  4MPW A;  4P02 A;  4UON A;  3HMZ A;  4JZ1 A;  4HZH A;  5GND A;  5HKK D;  1YGC H;  2JET C;  4YTA A;  4FUD A;  1BA8 B;  1V2V T;  1FXY A;  3V13 A;  1AQ7 A;  3LGV A;  1CA0 C;  1HAZ B;  3PMA B;  1S6H A;  6LPR A;  2ZHD A;  7KME H;  3W95 A;  2PUQ H;  1MUE B;  4AB9 A;  1TLD A;  1F92 A;  2UWO A;  5F8T A;  1K1I A;  2PKS B;  1NT1 A;  1SR5 C;  5BPE A;  4OS1 A;  1GJA B;  2VGC B;  1KYN A;  4GHT A;  2A2X H;  3MH6 A;  2ZFS A;  5H4I B;  1UVS H;  4U30 A;  1F0T A;  1UVO A;  3KEE A;  1SLX B;  1C5M D;  4MLF B;  1EJE A;  1P8V C;  2ZKS A;  5E0J A;  2AHM E;  1ZSK A;  3SV6 A;  8LPR A;  1S5S A;  3QZQ A;  1OWI A;  4A92 A;  4UFD H;  2L74 A;  1WGB A;  3HE1 A;  1NM6 A;  2HPQ H;  2W6I D;  2VIV A;  4IN2 A;  1GHB F;  3FP8 E;  1RIW B;  1NRP H;  2R0L A;  1EOJ A;  5FBE A;  1TAB E;  4I86 A;  4AGJ A;  3RXM A;  3PLK A;  4KTC A;  1THR H;  3MH4 A;  4TYD A;  3TGV A;  4TV4 A;  1D3D B;  2K0Q A;  4U01 A;  1ETT H;  4ABF A;  1TBQ H;  4OS6 A;  3SU3 A;  3UQO A;  2I51 A;  1V2K T;  4A1T A;  4B71 A;  8GCH G;  2ZGJ A;  1XXD A;  1E34 B;  2WIN I;  1VIT H;  1YKT A;  4AFZ A;  2ANW A;  2GUJ A;  2WPI S;  5DGJ A;  4NSV A;  1HAO H;  1XM1 A;  1OHH D;  2PR3 A;  1J17 T;  1NRG A;  1GJ8 B;  4FU8 A;  3OEE D;  3EST A;  4D8N A;  1EAU A;  3SND A;  1LVB A;  1C1V H;  3E16 B;  3DMB A;  1W3C A;  1GI5 A;  4JZD H;  5LPF A;  1LPG B;  4OGY A;  5DP3 A;  1Y3V A;  1GBT A;  4Z1M D;  1HIA B;  1UTL M;  2BX3 A;  4WH8 A;  1CSO E;  3UTU H;  1PPB H;  4ZHM U;  2G00 A;  4IMZ A;  1F7Z A;  2BQ7 B;  4TY6 A;  1COW D;  2P59 A;  1S82 A;  4ZKY A;  3SUG A;  1IQI A;  4B73 A;  1O3N A;  1V2W T;  3CNR A;  1P09 A;  5CE1 A;  1ELA A;  4FUH A;  5JB9 S;  4GPG A;  1H8E D;  1ELG A;  1H8D H;  5LGO A;  4NSY A;  4DCD A;  2QYI A;  2DE9 A;  2WPD D;  2C8Y B;  1W3P A;  3LC3 A;  3SJI A;  5J4S A;  1MAX A;  5CHA B;  1BRB E;  1MZA A;  1CHO G;  2PHB A;  3V7T A;  2FOE A;  3OYP A;  3SNC A;  4NIV A;  1SFI A;  2CK3 D;  4OS4 A;  1ZPB A;  1BJV A;  1HRT H;  4B2C A;  1VGC C;  3RU4 D;  1O5B B;  1A1R A;  3DT0 H;  2P3U B;  4ABA A;  2XBY A;  2GDE H;  5FCK A;  1SGC A;  2HVY B;  1NPM A;  3K86 A;  1NRO H;  2HQ9 A;  4UDW H;  4J2Y B;  4UE7 H;  1UCY H;  5E0H A;  1C4V 2;  3M5M A;  1N8O B;  1W11 U;  1S0R A;  4E7R G;  1FV9 A;  3FVF B;  4WJG 2;  2QXI A;  3PWB A;  2FPZ A;  4B1T A;  2F9N A;  2J92 A;  1P3C A;  5A8Y A;  3MNC A;  4FET A;  2CHA C;  3SUE A;  1SMF E;  1Z8R A;  2FOH A;  4NGA H;  2D36 A;  2Z9I A;  1QJ7 B;  3SJ9 A;  1FI8 A;  4AGK A;  5E0G A;  3PV5 A;  2ZGX H;  1ZHR A;  2CHA B;  4CR9 A;  3PO1 B;  4FVD A;  1OP8 A;  1O3J A;  1UVP A;  2FOB A;  2KCY A;  3FZD A;  4FUJ A;  4ABD A;  1P03 A;  1GBI A;  2J5U A;  3BTG E;  3SOS A;  2WUC A;  5FPS A;  1GJ7 B;  1W0J D;  3P8F A;  2FWW A;  4ACA A;  4MNW A;  1CBW B;  5EJL A;  3NPS A;  2P95 A;  1J8A A;  2ZDL A;  2VID A;  2R9P A;  3LGT A;  1C1P A;  1DXP A;  1SKY E;  3SU2 A;  1FAK H;  3S9C A;  1J16 A;  1O3B A;  2GCH F;  2O9Q A;  2W5E A;  1D9I A;  1NZQ H;  1O5D H;  3OEH D;  3FAN A;  1FY4 A;  4UFG H;  5HIZ A;  3GY4 A;  1OXG A;  5CHA C;  1KLI H;  2Y6T A;  3GY3 A;  2ODP A;  5A09 A;  3QLP H;  1IOE A;  2VWO A;  1H8H D;  2WPL S;  4NFE A;  4X2X A;  2ZDK A;  3DUX H;  1Z7K A;  3IG6 B;  3NCL A;  3ZOH A;  1BIO A;  4IBL H;  4DGJ A;  1ABI H;  2GKV E;  1EAS A;  3F3B A;  1AY6 H;  1BDA A;  4ZXX H;  3SI4 H;  4BXW A;  1NFW A;  4TWW A;  2C8Z B;  1WOF A;  4LXB H;  3A7Y A;  2XXL A;  1ZGI A;  1EAI A;  3F68 H;  1C5S A;  1AKS B;  1GG6 C;  1DUA A;  1WUN H;  1OYQ A;  5DJ7 A;  2ZZU H;  3A84 A;  3RXF A;  3TH4 H;  1GI7 B;  3TVJ B;  1AGJ A;  1NFX A;  1ZHP A;  3BNK A;  2GX4 A;  3PRO A;  1A3E H;  1GJ9 B;  4XDE A;  2FOM B;  4MNX A;  2IOT A;  1ZJD A;  1KXC A;  2BOK A;  1SOT A;  2V35 A;  1MCT A;  1O34 A;  2BOH B;  2HOB A;  3A81 A;  2OLG A;  4Q63 A;  2BVX H;  3U28 C;  4ABB A;  4B75 A;  3TGK E;  2YMS C;  3E4V A;  1DPO A;  5JPM H;  1YOA A;  2QN5 T;  1TNH A;  1A3B H;  4FUI A;  3MQK C;  5EU8 A;  4CHA C;  1SLU B;  2FZZ A;  4UFF H;  1ANB A;  1BRC E;  3AAS A;  2RA3 A;  4K1S A;  3ZVD A;  3PFT A;  2FOF A;  4AFU A;  1PPH E;  2A7H A;  2VNT A;  4D76 A;  3MHW U;  7GCH G;  7EST E;  2A2J A;  1QUR H;  1TMU H;  3BTE E;  3BIV H;  4B6F A;  4AFS A;  2XC0 A;  4DT4 A;  2QC2 A;  4WME A;  1YY3 A;  3K88 A;  1MU6 B;  2I6Q A;  4HGC A;  1RIW C;  1O3F A;  1ESA A;  1E35 B;  1YPK H;  4JZF H;  2H9T H;  3A86 A;  4X2Y A;  1O36 A;  1OWE A;  4AG1 A;  3KNX A;  2NU1 E;  4M9F A;  4GUX A;  4WMD A;  3URC A;  2VIQ A;  1RD3 B;  1WV4 A;  1GI4 A;  2H1U A;  2H9H A;  1KMH B;  1Z6E A;  2NU4 E;  3F6U H;  1VL7 A;  1C1Q A;  1P11 E;  2FMJ A;  2KZ4 A;  4ISO A;  9EST A;  1WV7 H;  1BJU A;  3V0X A;  5DG6 A;  3MU1 A;  1GBE A;  1K2I 1;  2AS9 A;  3UAI C;  5DPA A;  1AMH A;  4R0I A;  3UIR A;  3A6R A;  1JOU B;  4DG4 A;  2VIO A;  1QHR B;  2C8X B;  2AER H;  2BD8 A;  1FLE E;  1Z71 A;  3UUZ A;  1O2Q A;  2THF B;  2VBC A;  3LH3 A;  1NRS H;  2ED4 A;  3QK1 A;  2SGQ E;  3SQH E;  2B5T B;  1K0H A;  1C5Z B;  2C4F H;  2ANY A;  2AMD A;  3TK9 A;  1MAY A;  3RXR A;  4ISN A;  5AVD A;  5FX6 A;  3LGW A;  1K28 D;  1C2D A;  1USF A;  1T4U H;  2ZTY A;  5G4B A;  4IRA A;  1MBM A;  1MTN B;  1YBW A;  3P70 B;  1P9U A;  1BML A;  9LPR A;  3ZVB A;  1KXB A;  1AKS A;  1G32 B;  2V3O H;  3SZE A;  1O32 A;  1SQO A;  1EXF A;  3BTD E;  4F4O C;  1OKX A;  1DM4 B;  3BG8 A;  3O8D A;  1P2J A;  5DP5 A;  5FPT A;  4GSO A;  1L2E A;  1C4U 2;  1PPZ A;  4JK6 A;  3OTJ E;  3E8L A;  2QEA A;  1GHY H;  1SLW B;  3TJV A;  1TAL A;  2SNW A;  1GL1 A;  5L30 H;  1TRM A;  3T5F H;  1HYL A;  5HYO A;  1NFY A;  4K5Z A;  1C5L H;  4YLU A;  2ZFR H;  5KED A;  3R5W A;  2FI5 E;  1T8L A;  1WU1 A;  1XUG A;  1J9C H;  4MNV A;  3LKW A;  3R5Z A;  1I0S A;  1CGH A;  1GCT B;  1GPZ A;  1S81 A;  2R3Y A;  2WPH S;  1IQN A;  1YCP H;  4F55 A;  2ZCH P;  3SN8 A;  3U34 A;  3ZOE A;  3MNX A;  3GY5 A;  4JYV H;  2XBW A;  5EIY A;  2G51 A;  1ZR0 A;  2OCV B;  4K1T A;  1ESB A;  4FOU C;  2OU5 A;  3MH5 A;  1OS8 A;  1HIA A;  1EZQ A;  1W13 U;  4KTS A;  2ZA5 A;  1RTK A;  5B6L A;  1EZU C;  1GMH F;  1O2V A;  1GI9 B;  2Z9G A;  2HPP H;  3F0P A;  4HI3 A;  1SBW A;  3PMJ A;  3D62 A;  1GVK B;  2LEL A;  4X6N A;  3A8C A;  3TJO A;  4CRC A;  4GCH F;  3DSG A;  1TQ7 B;  3PV2 A;  5KEC A;  1UTQ A;  1OP0 A;  4BTI B;  4A5T S;  3TH2 H;  2FYQ A;  2ZU5 A;  3PM3 A;  1XHN A;  1QNJ A;  1LHC H;  2BX4 A;  2D37 A;  2AGI X;  3RMM H;  3RXA A;  4H42 U;  1VR1 H;  2GZ7 A;  4MPU A;  4XBD A;  1O30 A;  3P92 A;  2V3M A;  3A7W A;  2P5Z X;  1DDJ A;  1QZ8 A;  1SGD E;  1I0R A;  4ZKN U;  4H6S B;  1W3Q A;  2TPI Z;  1P12 E;  1NRQ H;  4MPX A;  4XE4 A;  1NFU A;  5LH8 A;  1IQK A;  1C5Q A;  2OC0 A;  3BTW E;  3HK3 B;  1C5U A;  4MQA A;  3SW2 B;  4X0W U;  1GBB A;  1VIT G;  1NTP A;  2ZCK P;  3Q3K A;  3H96 A;  3SI3 H;  1C1N A;  2EC9 H;  2UUK B;  1Y12 A;  1YP9 A;  3QX5 H;  1EAT A;  2V7Q D;  1O5E H;  2H2Z A;  5E8E H;  1XMN B;  3H7O A;  3BG4 B;  3OX7 U;  2A4R A;  3VXF H;  1SGR E;  3KHV A;  2SGA A;  1W7G H;  1K9O E;  3GCO A;  1W2K H;  2Y7X A;  5E2O A;  2G52 A;  4F07 A;  4XJ2 A;  1NN6 A;  2WUB A;  1DE7 H;  4X2W A;  3LON A;  4K8B A;  1O3O A;  3A8B A;  3FGE A;  4PRO A;  4BAN B;  2FI3 E;  2STA E;  1VJ9 U;  3N7E A;  5I46 H;  2KM0 A;  5K7R A;  2CN0 H;  3RXL A;  1TA2 A;  3ODD A;  1G9I E;  1TNL A;  2KAI B;  3H09 A;  3RXB A;  1T8N A;  2O8M A;  3RXH A;  3S69 A;  3SQE E;  2XBX A;  3DSP A;  1ZRB A;  3QTV H;  2I6S A;  1HAY B;  1V2U T;  3L3T A;  5A8X A;  2VIP A;  3SNA A;  1OX1 A;  3ODF A;  1GJB B;  2ZG0 H;  1C2K A;  1TGS Z;  1O2Y A;  4ZKS U;  3V4H A;  3RXG A;  3ZOD A;  3SHA H;  1MH0 A;  2WHX A;  1PQA A;  5A8Z A;  1SB1 H;  2A32 A;  1EJM A;  2ALV A;  5GXP A;  4R82 A;  1Z8G A;  2ZFT A;  4BAO B;  3KF2 A;  2R2W U;  1J14 A;  4NZL A;  3GCT F;  3OY5 U;  5EW2 H;  3A85 A;  2P8O B;  3MYW A;  1D3T B;  3GCN A;  1DWD H;  3K6Y A;  4I8K A;  3PB1 E;  2ZDM A;  1P06 A;  3SUD A;  2W7S A;  4YOI A;  4NCY A;  2EY4 C;  1QA7 A;  2FX6 A;  2M5T A;  2GZ8 A;  1SVP A;  5JBC S;  3M3S A;  2OK5 A;  3BTQ E;  3QN7 A;  3SU1 A;  2BQW B;  2CMY A;  2VIW A;  2F4L A;  1BTP A;  1G77 A;  1E38 B;  1HNE E;  1XUJ A;  5C20 A;  1T32 A;  3PTB A;  1H9H E;  3A89 A;  2XWA A;  3RXU A;  3ZZ5 A;  3VGC C;  1PYT D;  1BHX B;  1LKA A;  3HGN A;  1ZLR A;  2ASF A;  1ZTK A;  1TX6 A;  1AI8 H;  2GCT B;  2VVC A;  3ZZD A;  4CBO A;  1HJ8 A;  2O8T A;  1RXP A;  2NU0 E;  3BV9 B;  4I31 A;  4MG3 A;  4B74 A;  1C1M A;  1EB1 H;  1W8B H;  2K8I A;  1SGT A;  5FAH A;  1AVG H;  3ZIA D;  4K2Y A;  1O2U A;  1TON A;  1LQE A;  1T31 A;  1MKW H;  3RXC A;  3QO6 A;  1Y5B T;  1FN6 A;  2EST E;  1Z1J A;  2ZDV H;  1IQF A;  1T8M A;  2KR7 A;  4TSF D;  4X6O A;  1SHY A;  5B6O A;  3HKJ B;  1X7A C;  2XBV A;  1HJA C;  2GJG A;  3F2H A;  1UVT H;  3UB0 A;  1GWA A;  4I8J A;  3SJK A;  5IDK A;  1EST A;  2A5K A;  4D9Q A;  1L0Z A;  2BLO A;  2OD3 B;  1XUH A;  1OOK B;  3ZVF A;  2ZDN A;  1HAG E;  1KXD A;  3MU5 A;  4RT1 A;  2KCP A;  3FKS D;  1C1T A;  2VIN A;  3KID U;  3M37 A;  2WSS D;  3BTT E;  2Y81 A;  5J4Q A;  3SJO A;  2ZU1 A;  4IN1 A;  1O37 A;  1EAW A;  3T29 A;  1C2G A;  1DT2 A;  5EXN A;  2ZFP H;  3VG8 A;  3RC6 A;  1C1O A;  1JIM A;  4UEH H;  2CF9 H;  5EW1 H;  4ACB A;  1ACB E;  1AB9 C;  1E0F D;  4KP0 A;  2D26 C;  2OXS A;  1HXE H;  4CH2 B;  1C1W H;  2VWL A;  1RTF B;  1DOJ A;  1FIW A;  2D5M A;  1XUK A;  2K1Q A;  2IPQ X;  4UHV A;  4UD9 H;  3O8R A;  1GHB G;  3VY2 A;  4YOJ A;  3PRB A;  2FHQ A;  1L1J A;  1Q2W A;  2FOG A;  3BEI B;  3EAA A;  3NFW A;  1WSS H;  4JYT A;  1O3E A;  2P94 A;  3SV9 A;  1ZPC A;  2GT8 A;  5I25 A;  3VYA A;  1ETR H;  5FBI A;  5HM2 A;  2Z9L A;  1F2S E;  3KYF A;  2BB4 A;  1KIG H;  3TIU A;  2CV3 A;  2F9P A;  3Q00 A;  6EST A;  4NA7 A;  3FN8 A;  1FN8 A;  4GLY A;  2J98 B;  1TWX B;  1GJ5 H;  1FZZ A;  1FJS A;  4HMW A;  1O3I A;  1P2K A;  1IQH A;  1OWH A;  4SGA E;  3LU9 B;  2YOL A;  5ESB A;  2TRM A;  1P05 A;  3S9B A;  2QXH A;  2H5C A;  1TOC B;  4Y11 E;  4HMX A;  5GJ4 B;  1GHW H;  1O2O A;  3A7T A;  3E0P B;  2AIQ A;  1V2L T;  1ELC A;  2BDI A;  1O3P B;  5EPN A;  4D7G A;  1EOL A;  3S0N A;  1NS3 A;  1O5F H;  1MMJ N;  4CRA A;  1QA0 A;  2SGD E;  2Y5H A;  3GYM A;  1C5R A;  4CRG A;  1MCV A;  2VH0 A;  2B8O H;  3HPT B;  3BN9 A;  1QRW A;  1HPG A;  3R3G B;  2KCA A;  1ELT A;  2QF3 A;  2VVV A;  3ZVG A;  2F91 A;  3RXP A;  6CHA C;  4B6E A;  3ATW A;  1UHB A;  1YCP M;  2G55 A;  4FUB A;  4FUG A;  1BOQ A;  2F83 A;  3F1S B;  4K1E A;  3ZV8 A;  2HGT H;  2FIR H;  5EJZ A;  1O33 A;  1WTH D;  2J34 A;  4YT6 H;  3ZZ9 A;  1GBF A;  2Y82 A;  1F0S A;  6GCH F;  1YPH E;  1O0D H;  2HTI A;  3KQC A;  1BTW A;  4LK4 A;  4XD7 D;  3SOR A;  2R0K A;  3R5L A;  2VJ1 A;  1EQ9 A;  3UOU A;  6CHA B;  1BMF D;  2RA0 A;  2GTB A;  2L1T A;  1P0S H;  5IK2 D;  1VJA U;  4FU7 A;  1WBG B;  5DKM A;  3GY7 A;  1C9P A;  2BXU H;  3EYD A;  4Q7Y A;  4CBN A;  1YLC A;  4HMV A;  3E91 A;  1QQ4 A;  5C3N A;  1UK4 A;  5FHT A;  4HKH A;  1IQE A;  1VKY A;  3BEF B;  2O8U A;  1HGT H;  1FNI A;  2ZDA H;  1P57 B;  3VEQ B;  1K1J A;  3RC4 A;  2V6N A;  2PUX B;  2J38 A;  1ELB A;  2J9N A;  4TWY A;  4D7F A;  1AFE H;  3OSY A;  1A2C H;  3DB0 A;  5C2Z A;  3F9G A;  2HAL A;  1NBM D;  1AFQ B;  2BLV A;  2GCH G;  1SHH B;  2SNV A;  3STJ A;  4DT7 B;  4X6P A;  2Z6B D;  4DOQ A;  1FLM A;  2LP6 A;  3M7T A;  1HB0 B;  3CS0 A;  4YT7 H;  3IIT A;  1YPG H;  5JYI A;  1DAN H;  4DY7 B;  4O9V A;  2PSY A;  3FP7 E;  1QR3 E;  3P17 H;  1TYN A;  2BXT H;  3ZZ7 A;  4HMT A;  1YPH C;  2BDB A;  1FY8 E;  2OBQ A;  2RFK C;  3SGA E;  2SGE E;  1C9T A;  5DO4 H;  5JBA S;  1O5C B;  1JWT A;  2BDH A;  1Z8I B;  4ABH A;  2R3U A;  1YLN A;  4AZ2 B;  3UR6 A;  1K21 H;  2HVX A;  2DE8 A;  2FG9 A;  1SGE E;  2C93 B;  4RSP A;  3GCT G;  1FX0 B;  3SV7 A;  1F5K U;  1T7C A;  3EQ0 H;  5EQQ A;  4CR5 A;  3U1I B;  1A5G H;  1XXF A;  3GY2 A;  1JIR A;  1Z6J H;  1AHT H;  1TPP A;  3CEN A;  2GT7 A;  4QT8 C;  1YPM H;  4WF8 A;  1GBC A;  3JZ2 B;  3ZZ3 A;  5SGA E;  1F0U A;  1P10 A;  1LQD B;  3GDU A;  1QBO A;  2QCY A;  2A31 A;  1GI2 A;  4JZE H;  5KGO A;  3SUF A;  1DY8 A;  1L1N A;  1N1L A;  2JJ2 D;  3ATL A;  1GDQ A;  5FX5 A;  5BNC A;  2VPA A;  1GMC F;  1P02 A;  2FO9 A;  1GDU A;  2GD4 B;  2Q6G A;  1NC6 A;  1PYT C;  2LNC A;  4OS5 A;  1MAB B;  2IAB A;  3MMG A;  2OQ5 A;  2ZTZ A;  1C2M A;  2PFE A;  1UVU H;  2QAA A;  1C2H A;  3SV8 A;  2C8W B;  4E06 H;  2HHZ A;  3MO6 A;  2F9U A;  4AFQ A;  1BMN H;  4L82 A;  4YLQ H;  1P01 A;  2WV4 A;  3AK5 A;  3RDZ A;  1K1N A;  1AO5 A;  3GCH C;  1GHX H;  1Y3Y A;  1LHD H;  4MTB A;  4INK A;  3A83 A;  1KY9 A;  1S6L A;  4O3T A;  1ZJK A;  3A7X A;  3NKK A;  5C94 A;  2CJI A;  1GI8 B;  1IHT H;  4TT3 D;  3G01 A;  3LGU A;  2HNT C;  1E79 D;  3RXJ A;  5T6G A;  3ZZ6 A;  1PQ8 A;  1PPG E;  5C5O A;  2VH6 A;  2O8W A;  1TFX A;  1W9A A;  1O38 A;  5HM9 A;  4X1R U;  1Y5A T;  1HBT H;  1OWK A;  4KTU A;  4XRN A;  3NUM A;  1W14 U;  2A4Q A;  2M2A A;  2IJD 1;  2WPM S;  2ZPQ A;  4YWN A;  4SGB E;  2WZQ A;  3ZYE A;  1TE0 A;  3GCH B;  3GAS A;  1AN1 E;  1C1U H;  1UTJ A;  1AD8 H;  1IQM A;  2FDA A;  1TRY A;  1T4V H;  3F9F A;  5HGG A;  4I7Y H;  1Q3X A;  2FES H;  1MKX H;  4NWL A;  2HWL B;  1LHE H;  1O2K A;  2UUJ B;  5CHE C;  1O2M A;  1B5G H;  2BY6 X;  1CU1 A;  2FI4 E;  3DHK H;  3OU0 A;  1LTO A;  1CHO F;  3U8T H;  3PWC A;  5EQR A;  2KFW A;  2NWN A;  4XBC A;  2G5N A;  3ZZB A;  4HTC H;  1GBD A;  1SQA A;  1XX9 A;  2HLD D;  2IML A;  2F9O A;  1BTX A;  2ZWL H;  1RGQ A;  4FVB A;  1O31 A;  4Q4L A;  3NRL A;  1CA8 B;  3UOP A;  4ISH H;  3B9F H;  4Z6A H;  1V2R T;  5T6D A;  1SFQ B;  4Z85 A;  1AZZ A;  1GMH G;  2NU3 E;  3DCL A;  4O3U A;  5C1U A;  2F9V A;  5LPR A;  1GGD B;  3UY9 A;  4XHY A;  3URD A;  5T6F A;  3NZI A;  1XVM A;  1EFR D;  2WV9 A;  3GDV A;  2NR4 A;  1IQJ A;  2J94 A;  2PKS C;  3AW1 A;  3LPR A;  2Y5G A;  1EB2 A;  1AVX A;  1BTH H;  1BQY A;  2D8W A;  5DP9 A;  1O3C A;  3RML H;  3K9X B;  1ZOM A;  2VWN A;  2ZPS A;  1LPK B;  3LJO A;  3UFA A;  2BY5 X;  3DD2 H;  2AQ6 A;  2EI8 A;  1BUI A;  5C0T A;  3WY8 A;  1UK2 A;  2PGB B;  4TPY A;  3EE0 B;  5JBT A;  1FQ3 A;  1THP B;  2PTF A;  3M5O A;  3LT3 A;  1P2Q A;  4TPI Z;  1H4W A;  1DS2 E;  1TIO A;  4NFF A;  1MD7 A;  3F2G A;  3MOC A;  2FXR A;  1LCY A;  1HV7 A;  2FTM A;  4FUE A;  3QWC H;  1A0L A;  4Y7A A;  4Y8X A;  5TCA A;  1ZPZ A;  3R0F A;  1DNL A;  3Q76 A;  2FLR H;  1A0H B;  3KQB A;  1EZX C;  1ETS H;  2YMS D;  2ZP0 H;  1Q31 A;  4K69 A;  1AFQ C;  4X1N U;  3UWI A;  1GI3 A;  1RFE A;  2RE7 A;  1O2N A;  4Y79 A;  1RTL A;  2G8T A;  3P8N A;  2HRV A;  3SGQ E;  2JH6 D;  1O5A B;  4EST E;  4MNY A;  5FCR A;  4LZ1 H;  2C3S A;  4XSK U;  1JXP A;  3EDX B;  2Y7Z A;  1BTY A;  1BTZ A;  1HCG A;  3M3T A;  1IQL A;  3A7V A;  5DSF A;  2A5A A;  1GMC G;  4O03 A;  1O2T A;  1ZSJ A;  4HG6 A;  1QL9 A;  4ZRO A;  1GCT C;  2TIO A;  1TNK A;  2GV6 A;  1VCW A;  4OS7 A;  4A1V A;  2ZU2 A;  2Q9K A;  1SGP E;  1G78 A;  1HAH H;  1TOM H;  3TJN A;  1TNI A;  2G4T A;  1AVW A;  4Y10 E;  4AG2 A;  3OAA D;  2Q1J A;  2HTD A;  3UQV A;  3MNS A;  1TA6 A;  4GAW A;  3LGY A;  2H9E H;  1V2M T;  3UPE A;  2A0Q B;  2PKA B;  4RKJ B;  1D3Q B;  2BZA A;  1C2F A;  2FOD A;  2QXG A;  4Z0K A;  1UO6 A;  1DY9 A;  3BTK E;  1A5I A;  1E37 B;  2XRC A;  2FEQ H;  4E7N A;  5C1X A;  2D38 A;  1C2L A;  4J1Y A;  1GMD F;  3HAT H;  2RDL A;  3H5C B;  4RT0 A;  4MVN A;  3I29 A;  3QTO H;  3MO3 A;  1EUF A;  1SLV B;  3BF6 H;  1E1R D;  3P95 A;  5F8X A;  1MTN C;  1SI5 H;  4JMY A;  4IMQ A;  3E90 B;  4DVA U;  1TBR H;  3R5R A;  1MBQ A;  4ASU D;  1BMA A;  3KYG A;  3QUM P;  1DSU A;  2QF5 A;  1MQ5 A;  4O97 A;  4CRD A;  3U5W A;  4DJZ B;  2UUY A;  4ZH8 A;  1V2Q T;  3O8C A;  4Y76 A;  3PTN A;  1P9S A;  3ZZ8 A;  1KXF A;  1UTP A;  2QIQ A;  2ZEC A;  3MH7 A;  1E36 B;  2EQN A;  2ZU3 A;  3V3M A;  4F49 A;  3SNE A;  2B0F A;  3SV2 H;  1A46 H;  1CE5 A;  2QV1 A;  4AYV B;  1F0R A;  5C67 A;  1KLT A;  3A20 A;  1TGN A;  2A4G A;  1C5O H;  2JDI D;  5GIB A;  5ABW A;  2OL5 A;  5GWZ A;  1QCP A;  3B8J A;  1AXJ A;  2QXJ A;  2BQ6 B;  1JBU H;  1A5H A;  1B0F A;  1GVZ A;  1KDQ A;  1QFK H;  3KQD A;  4NWK A;  4U2W A;  4ABE A;  1O3L A;  1W3O A;  1YCP K;  4NG9 H;  2XWB I;  1DUE A;  2PW8 H;  5FL7 D;  1DIC A;  1W7X H;  1ZTJ A;  1USC A;  3LH1 A;  4AOQ A;  1C5W B;  4FUF A;  1AB9 B;  1W10 U;  1OPH B;  2ZGC A;  2WYG A;  1AE5 A;  1NRN H;  2OIN A;  2P3T B;  1GJC B;  2AFQ B;  2BYA X;  3NXP A;  4X6M A;  1TGB A;  3SU6 A;  1SGN E;  3GOV B;  3LGI A;  1A4W H;  2Z3C A;  4WVP E;  3RLW H;  6GCH G;  2ECR A;  1LPZ B;  1Y3X A;  1L4Z A;  3A80 A;  3ZZ4 A;  5JAB A;  5JB8 S;  1ZRK A;  1EP5 A;  2JH0 D;  2FOA A;  2TBS A;  1MQ6 A;  3T2N A;  1Y3U A;  3F9E A;  1O3G A;  2SGP E;  1C2I A;  1S84 A;  2Z9K A;  1ABJ H;  3GIS B;  2YMS B;  3ZVC A;  3NK8 A;  1A0J A;  1FY1 A;  1KDQ B;  1G3C A;  3PLP A;  1ZYO A;  5BRR E;  2G81 E;  1C4Y 2;  2XYA A;  2ZHQ H;  5EQS A;  3WWF A;  5HXF A;  1DIT H;  3L6P A;  3FKH A;  4IS5 A;  3P8G A;  2XOK D;  4NIY A;  1S0Q A;  2FS9 A;  3IWM A;  3GDS A;  1GI0 A;  4A1X A;  1G2M A;  5IYT A;  1W0K D;  3ZOC A;  4WXI A;  5ESC A;  5AFZ H;  2QCK A;  5GCH G;  2QE7 D;  4ISL A;  3ITI A;  1GBK A;  4BAQ B;  1G37 A;  2B7D H;  1UK3 A;  2BDG A;  3BEU A;  4BOH A;  1GL0 E;  2KX4 A;  7LPR A;  5DP8 A;  2ZNK H;  3BIU H;  3RMN H;  1D6W A;  4THN H;  2OC1 A;  1SG8 B;  3OFN D;  1TB6 H;  1BIT A;  1F5L A;  5T3H A;  4ZCN A;  3RXT A;  5GPI B;  3ZVA A;  3A7Z A;  2IN2 A;  1ELE E;  4IC6 A;  3U8O H;  1P04 A;  1PPF E;  4R8T B;  2FLB H;  2CXV A;  2PSX A;  3VB5 A;  1O5G H;  1PFX C;  2ZGH A;  1PQ5 A;  1VCQ A;  2WV5 A;  3VB4 A;  2AEI H;  2P8O C;  2D2D A;  2YNB A;  3U9A H;  3RXK A;  2PGQ B;  3SO3 A;  5TCC A;  1UTM A;  1BRA A;  2A2Q H;  4LZ4 B;  1O2Z A;  2L6O A;  3N7O A;  3RXI A;  3KQ5 A;  4GVU A;  3U69 H;  2EI6 A;  1GBL A;  1V2J T;  3T62 A;  2Z94 A;  1UCY E;  4Y8Z A;  2F9B H;  4AN7 A;  1ZML A;  2PWX A;  2XC4 A;  4GHQ A;  5C1Y A;  3M3V A;  1QB9 A;  1UTK A;  1Z1I A;  3K87 A;  3VXE H;  1BTU A;  2BM2 A;  2ZQ2 A;  3PO1 C;  3CB0 A;  3T25 A;  1NBM E;  2BD3 A;  3W94 A;  1ZHM A;  3DNH A;  1TAW A;  4ABG A;  3OY6 U;  2ZFQ H;  1YC0 A;  1XUF A;  1INC A;  2XC5 A;  4X1S U;  5CDF E;  4X8T H;  2ULL A;  3SJ8 A;  1GI1 A;  4H6T A;  3A87 A;  2TGA A;  2XW9 A;  1EJA A;  3KQE A;  4IC5 A;  3RH7 A;  4CH8 B;  2B9L A;  5F53 A;  2DUC A;  1AWH B;  3ZOG A;  1L4D A;  1QB1 A;  1N8O C;  1NO9 H;  4WXV A;  1CGI E;  4NA8 A;  1IAU A;  4Q7Z A;  4INH A;  3BG4 C;  1TPA E;  1U6Q A;  1YPL H;  3F9H A;  4BAH B;  1GGD C;  1VCP A;  3V12 A;  4RKO B;  4AOR A;  2SGF E;  1KXA A;  1V2S T;  1BMM H;  3MWI U;  4DIH H;  1FDP A;  1QY6 A;  1YM0 A;  3EA9 A;  2GVF A;  1MD8 A;  1RRK A;  1TY9 A;  1LVY A;  4W64 A;  1BBR H;  4H4F A;  5C0U A;  3WWB A;  2CF8 H;  1QL8 A;  2BY8 X;  1O2G H;  3N99 A;  1DFP A;  3VY5 A;  2W3K A;  3EE7 A;  1V2N T;  1BZX E;  3NWU A;  4X8V H;  3TU7 H;  4CRF A;  1O2H A;  3FOA A;  5C5N A;  3U0I A;  3RXS A;  2BDA A;  2FYR A;  2OUA A;  3SBK A;  1K1M A;  1WXR A;  1MKX K;  3M5N A;  1CI0 A;  1V2P T;  2ZGB H;  2XCN A;  2BDC A;  1QQU A;  1YWU A;  1HAX B;  2JH5 D;  2XND D;  1XKB C;  4LOY H;  2EA3 A;  3U35 A;  3TK6 A;  1UJ1 A;  1ELV A;  1TMB H;  1G79 A;  3CS7 A;  2BD2 A;  3BTF E;  2W26 A;  3RXD A;  3MU4 A;  1PPE E;  3PLB A;  1N6Y A;  1DWC H;  1LVO A;  5EXM A;  2OBO A;  2R6V A;  1ELF A;  1C2E A;  1WLK A;  1H8I H;  2ZCL P;  1O3K A;  2IJO B;  1AE8 H;  3ATI A;  1JMO H;  4TY7 A;  4I8H A;  4ZHA A;  1MTS A;  1B0E A;  3CP7 A;  2A45 B;  2A7J A;  2GV7 A;  2V0B A;  3R5P A;  1O2R A;  1QB6 A;  2BZ6 H;  2AMP A;  3UNQ A;  1HXF H;  1HAV A;  1QJ6 B;  3AAV A;  1DLK B;  5L6N H;  1K1P A;  1P2N A;  3ZZA A;  1XKA C;  1C5T A;  1C5N H;  3E3T A;  3I77 A;  1S83 A;  3EGK H;  1W0Z U;  2QGR A;  3DSO A;  1LDT T;  4ZHL U;  4DUR A;  1LMW B;  2AGG X;  3IN6 A;  4NZQ A;  3URE A;  5GCH F;  3A8A A;  1JNW A;  3BPK A;  3ZYD A;  1UHB B;  1YF4 A;  1QIX B;  4ZXY H;  1KSN A;  2BY9 X;  4I8L A;  1FPH H;  3K2U A;  2JKH A;  1EX3 A;  5ETX A;  5LPE A;  4A7I B;  2AYW A;  4YOG A;  1O3H A;  3ZZC A;  1YPJ H;  4YM9 A;  5TJX A;  3Q77 A;  3D49 H;  4P00 A;  5F6M A;  1FMG A;  2R0X A;  1FPC H;  4BTU B;  4FUC A;  1DX5 M;  5CMX H;  1AUJ A;  2STB E;  1MZD A;  1AWF H;  3OE7 D;  1EAX A;  1WYK A;  4Y0Y E;  1FY5 A;  2PTN A;  3BTH E;  1G3E A;  1Y3W A;  1K1L A;  1G76 A;  5A0C A;  1O3D A;  4A6L A;  4BAK B;  1OP2 A;  1GHZ A;  5EG4 A;  1SOZ A;  5DN6 D;  3FO8 D;  2I02 A;  1K22 H;  3ENS B;  1MKW K;  1ELD E;  1O3A A;  2P3F H;  4WMF A;  1W12 U;  3ATK A;  3GY6 A;  4INL A;  4ZUH A;  4KEL A;  4D9R A;  1Z8J B;  4XFQ A;  2Y80 A;  3MFJ A;  3U98 H;  1T8O A;  1SQT A;  1XVO A;  3FFG A;  1A61 H;  5EOD A;  3VPK A;  1OYT H;  2BHG A;  1ORF A;  1WAY B;  3A8D A;  4K8Y A;  1KLJ H;  2X1J A;  3RM0 H;  1EP6 A;  4BTT B;  2BVS H;  3M7U A;  3T28 A;  4N7R C;  1ARC A;  3ZVE A;  2ANK H;  2BLQ A;  3EA8 A;  1Y30 A;  1FAX A;  1SGF A;  2WYJ A;  1SPJ A;  3UWJ H;  8EST E;  2A7C A;  2ZHF H;  1MTW A;  3M5L A;  3H7T A;  4IGD A;  1JRT A;  1KTT B;  1BCU H;  1LHF H;  1SGI B;  2ZIQ H;  5JDU B;  2R2M B;  3VFE A;  2RCE A;  3TNS A;  4OM9 A;  2RDE A;  5EST E;  3PYH A;  4CHA B;  1DXW A;  3AMF A;  2OC7 A;  4Y6D A;  3M36 A;  3RC5 A;  2ZFF H;  1ZGV A;  2JJ1 D;  2CGA A;  2F3C E;  3RLY H;  4KGA A;  3SU5 A;  1H9I E;  3EA7 A;  4DW2 U;  3RXO A;  3KCG H;  1BBR E;  2IG6 A;  3DFJ A;  1W0Y H;  3KGP A;  1O2L A;  3MNB A;  5CHO A;  3M7Q A;  3RM2 H;  4NIW A;  1AUT C;  5T1V A;  2F43 B;  3N7D A;  1PPC E;  1DLE A;  4Y8Y A;  4ZKR U;  3E0N B;  3DFL A;  3P6Z B;  1Y5U T;  3FZZ A;  1SC8 U;  3RXQ A;  2P93 A;  3F2F A;  1DST A;  2X1K A;  1GHA G;  3OTP A;  2TGD A;  4MPV A;  3ATM A;  1RZ1 A;  2BD4 A;  1GG6 B;  3PMH B;  1C1R A;  1Y59 T;  2W6J D;  2J4I A;  1EPT B;  4XOJ A;  4BNR A;  1UCY K;  1O2I A;  3DA9 B;  2AIP A;  3SNB A;  1FUJ A;  2FX4 A;  1ANC A;  1P3E A;  2W7U A;  3F0O A;  3L33 A;  1OSS A;  3SHC H;  4Q80 A;  1C5Y B;  4K3J A;  8KME 2;  5PTP A;  4ZMA H;  3TH3 H;  5EPY A;  4JZI A;  1QGF A;  5AF9 H;  2J95 A;  2KAI A;  4I32 A;  2BD9 A;  2UWL A;  2WPK S;  3JZ1 B;  1LVM A;  1MTV A;  3S9A A;  4YO9 A;  4HFP B;  3A6Q A;  1HJ9 A;  1L1G A;  2LPR A;  2BDY A;  3M35 A;  1SSX A;  2GGV B;  1NES E;  3Q3X A;  1TGT A;  2BMG B;  3ELA H;  1VZQ H;  1O2X A;  3LOX A;  1SGQ E;  4X1Q U;  4Y9I A;  4NA9 H;  5EJ1 A;  1C2J A;  4JK5 A;  4F48 B;  4ABJ A;  3VB7 A;  1KTS B;  2JIZ D;  4Q2K A;  5DP4 A;  4JCN A;  2AMQ A;  1TQ0 B;  1BHX F;  1C5X B;  4Y0Z E;  1GBM A;  1QRX A;  2A1D B;  4HMU A;  1QRZ A;  1SL3 A;  4IW4 E;  1GDN A;  3K65 B;  1GBA A;  4K60 A;  2EEK A;  2Z3E A;  3E1X B;  3U8R H;  1CBW C;  2H5D A;  2XTT B;  7GCH F;  3LDX H;  1TMT H;  4NIX A;  1G36 A;  2J97 A;  3R5Y A;  3TJU A;  2G4U A;  3TK5 A;  1V2O T;  2QF0 A;  2ILN A;  1G2L A;  1WQV H;  2VB0 A;  2ODQ A;  1QJ1 B;  3MU0 A;  1ZSL A;  4VGC C;  3T27 A;  3HGP A; 
#chains in the Genus database with same CATH homology
 2D36 A;  2I51 A;  1W3R A;  3PFT A;  2D5M A;  2ECU A;  1W9A A;  4R82 A;  3U34 A;  3ZOE A;  2R6V A;  3VY2 A;  1RFE A;  2RE7 A;  2FHQ A;  1WLK A;  5EIY A;  2A2J A;  1W3O A;  4HMS A;  4XRN A;  3NFW A;  2RDE A;  1FLM A;  1USC A;  4FOU C;  2OU5 A;  3EC6 A;  3AMF A;  4YWN A;  3VYA A;  3R5P A;  4QVB A;  3K88 A;  3KYF A;  3AWH A;  3GAS A;  3K87 A;  1RZ0 A;  3ZOF A;  1NRG A;  5EJL A;  4HMT A;  3DSG A;  3CB0 A;  5KEC A;  2IG6 A;  3B5M A;  1XXO A;  3DNH A;  1G77 A;  3DMB A;  4HG6 A;  2ECR A;  5CHO A;  1XHN A;  4HMW A;  5JAB A;  2D37 A;  1YLN A;  1WV4 A;  5CHE C;  3IN6 A;  2Q9K A;  1G78 A;  1JNW A;  3BPK A;  1VL7 A;  2FG9 A;  4HMX A;  2ASF A;  2X1K A;  3F7E A;  1I0R A;  1W3Q A;  1RZ1 A;  2HTD A;  1WLI A;  2IML A;  2FUR A;  3RH7 A;  3A6R A;  4P02 A;  3HMZ A;  3ZOG A;  4HX6 A;  4Z85 A;  3H96 A;  4ZKY A;  4P00 A;  3ZOH A;  2ED4 A;  3FKH A;  3HY8 A;  3CNR A;  2R0X A;  4XHY A;  4YBN A;  2D38 A;  3ZOC A;  2GJG A;  5ESC A;  1USF A;  3BA3 A;  2QCK A;  4RT0 A;  5KGO A;  3CP3 A;  1W3P A;  2NR4 A;  4IRA A;  3A6Q A;  4F07 A;  4XJ2 A;  5EJZ A;  1G76 A;  3FGE A;  5BNC A;  1T9M A;  2VPA A;  1TY9 A;  2HTI A;  3R5R A;  2I02 A;  3KYG A;  2E83 A;  3R5L A;  4Y9I A;  3VY5 A;  3BNK A;  5EJ1 A;  2AQ6 A;  4F48 B;  4RT1 A;  2HQ7 A;  3U5W A;  1EJE A;  2IAB A;  2QEA A;  2HQ9 A;  3K86 A;  3U0I A;  3SWJ A;  2PTF A;  4HMU A;  4HMV A;  2HHZ A;  2L74 A;  1WGB A;  4L82 A;  1CI0 A;  2X1J A;  3E4V A;  3R5Y A;  1YWU A;  1YOA A;  4N7R C;  4I86 A;  3A20 A;  5KED A;  3R5W A;  3U35 A;  1Y30 A;  3TGV A;  1DNL A;  2ARZ A;  2OL5 A;  1G79 A;  3ZOD A;  3DB0 A;  1AXJ A;  3R5Z A;  1I0S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...