2RDEA

Crystal structure of vca0042 complexed with c-di-gmp
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
224
structure length
224
Chain Sequence
VSTINSTDALAMVEHSSELTLSITTPVGTKFVCRTPFIGTHTDKFLLVEMPKISADDLQYFFQEGFWMNIRAISPRGEGALIHFRSQLMHILQEPVPMAFLSIPNTMQVSQLRKEPRFELNLAGKVLFDEHRGDCELRDLSRSGCRFITPPLGKTYQVGDLVALEIFSDLRGTKTFPPLTGKICNLQRSLHHARYGLEFNEEGRNNAKNLLAQLKFNGTKLTLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein VCA0042
publication title The structural basis of cyclic diguanylate signal transduction by PilZ domains.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Structural genomics, unknown function
total genus 42
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07238 PilZ PilZ domain
A PF12945 YcgR_2 Flagellar protein YcgR
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.110.10 Mainly Beta Roll Pnp Oxidase; Chain A Electron Transport, Fmn-binding Protein; Chain A 2rdeA01
2.40.10.220 Mainly Beta Beta Barrel Thrombin, subunit H predicted glycosyltransferase like domains 2rdeA02
2HTIA 2RE7A 1WV4A 3HY8A 1G76A 2ASFA 2X1JA 3PFTA 3R5RA 3K87A 2A2JA 2FG9A 5KEDA 5BNCA 3K86A 4FOUC 3CNRA 4Z85A 5EJZA 2QEAA 2HHZA 2PTFA 3KYFA 2ECRA 3A20A 3R5YA 1RZ0A 3R5WA 1YOAA 3ZOGA 2OL5A 4L82A 2ECUA 3BPKA 3GASA 1G77A 3FGEA 2E83A 3AMFA 1EJEA 1JNWA 1NRGA 1DNLA 3AWHA 4P02A 2FHQA 3NFWA 1USCA 3VYAA 4HMSA 1I0RA 4XJ2A 3U35A 3A6RA 3HMZA 2AQ6A 3EC6A 3U5WA 2VPAA 1CI0A 1WLIA 2IG6A 4XRNA 1VL7A 2OU5A 4Y9IA 1W3OA 3IN6A 3ZOEA 2D36A 3DSGA 4HMVA 3ZOFA 3B5MA 2X1KA 4P00A 1USFA 1G78A 4HMUA 4N7RC 5CHOA 1Y30A 1WLKA 2RDEA 3FKHA 2R0XA 4I86A 3BA3A 1YWUA 1W3QA 5ESCA 1YLNA 4HG6A 4F48B 1RFEA 3CB0A 2I51A 4RT1A 3DMBA 4YWNA 2HTDA 2NR4A 5EIYA 3F7EA 1W3PA 3KYGA 3ZODA 2I02A 2D5MA 2D38A 3TGVA 2Q9KA 2FURA 3ZOHA 4HMWA 1XXOA 3DB0A 3RH7A 4ZKYA 3ZOCA 4QVBA 4R82A 2HQ7A 2D37A 4IRAA 2IMLA 1W9AA 4F07A 2R6VA 3CP3A 4XHYA 4HX6A 3H96A 4HMXA 1T9MA 1G79A 1I0SA 3R5ZA 3DNHA 4YBNA 5EJ1A 3A6QA 3BNKA 1TY9A 3K88A 2L74A 5KECA 2IABA 3VY2A 3E4VA 4HMTA 4RT0A 5KGOA 2ARZA 5CHEC 3U0IA 1FLMA 5JABA 1RZ1A 3R5PA 1XHNA 2GJGA 1W3RA 2QCKA 5EJLA 2HQ9A 3U34A 1WGBA 1AXJA 3SWJA 3VY5A 3R5LA 2ED4A
chains in the Genus database with same CATH superfamily
1BUIA 1NTPA 1Z7KA 2QIQA 1A5HA 3A8CA 4RN6A 4YLQH 5GXPA 1NFWA 4THNH 4I8LA 2BY7X 5JBCS 3FVFB 3ZVEA 1B0FA 3DCLA 4AX9H 3D65E 1C5MD 3ZVDA 2PFEA 3PWCA 1ETTH 4BANB 1V2KT 1XUFA 1CA8B 1G3BA 2F3CE 1TGSZ 3I77A 1H9LB 1UHBA 6CHAC 2SGAA 2FYRA 3MO9A 3MH6A 1C2KA 1MMJN 3SU6A 4AG1A 4E7NA 2QXHA 2A45B 1DLEA 2SNWA 1C5ZB 3BV9B 1LPZB 1GHBF 1DLKB 1QB6A 2BLOA 1DNLA 4TYDA 2BTCE 4Y8XA 2ZQ2A 1TAWA 2WPHS 4MPVA 3VYAA 1GJBB 3GY8A 1GJ4H 4RSPA 2HVXA 2J4IA 4ISIH 5HIYA 4CRDA 1WLIA 2BD2A 2ZCLP 3E8LA 2ZHFH 5EXNA 2YNBA 3P95A 4JK5A 3RXBA 3PLPA 2X1KA 3FZZA 4XDEA 4AFZA 7GCHF 4ASHA 2WUBA 3VB4A 1EATA 1GBJA 1DXWA 2PUQH 1AUTC 1W8BH 2OBOA 1AU8A 3LDXH 4X1SU 1THPB 2F91A 3SI3H 3A8DA 1E1QD 2PSXA 1ELAA 4U2WA 3Q3KA 2K1QA 4U01A 5EODA 1GHVH 4DVAU 3STIA 2I02A 4NIVA 2LNCA 2Y82A 3GY3A 3VPKA 3TGVA 3S69A 1IQKA 1CHGA 1TNIA 5JDUB 3SNDA 1C5TA 3ATKA 2ILNA 1W9AA 2HPPH 1KYNA 4I32A 1LVBA 1S6LA 1TX6A 1BRCE 4HX6A 2BZAA 4IGDA 1GHYH 1W12U 1O5DH 5GPIB 1LCYA 1C9TA 2O8MA 2JETB 1S82A 4UFGH 4F55A 4HMTA 1SVPA 1NESE 3SNEA 3E16B 1GG6B 1GMCG 3T25A 1GBAA 2ALPA 4AFUA 1AN1E 1DOJA 1SOZA 1AWHB 4X2VA 1QB1A 4Q7ZA 1WGBA 1Z8JB 4ISHH 1C5RA 3R5LA 2XWAA 3C27B 1TPSA 2JH5D 3ODFA 4FVBA 2ZFSA 2AS9A 3A80A 1CT2E 2IN2A 2KR7A 1G37A 1QTFA 2ZO3H 2ASFA 1EAXA 2AMQA 2SNVA 5A0AE 2TGDA 2X1JA 1MTUA 2A2JA 4XBDA 3VXFH 1QHRB 1AZZA 1KXCA 1TQ0B 1W14U 1WTHD 1NRPH 3N7EA 1MKXH 1HV7A 3SI4H 3MH5A 1BBRH 3T26A 5K7RA 2BHGA 2P93A 3RXQA 1TMUH 3RLYH 3MU4A 2G81E 4HZHA 1DUAA 3OTPA 1BMNH 3GY4A 4KELA 1MQ5A 2VWLA 1GBTA 1IQNA 1TIOA 1QBNA 4IC6A 1W0ZU 1U6QA 2GZ9A 2WV5A 1EXFA 3TNSA 4D7GA 1OXGA 1UVOA 3SUFA 5I46H 3FP7E 1O3FA 1RD3B 1V2TT 2BDCA 3QDZB 2PUXB 4NG9H 1DUEA 1TPPA 5FAHA 4WMDA 1Q31A 1ABIH 1TPAE 1ANCA 4ZKOU 7GCHG 2PGBB 1E1RD 1T7CA 1O3LA 1JWTA 1BTXA 5EQQA 1J17T 1O0DH 3GDSA 1SQTA 3MHWU 4ACAA 5C1UA 1EZSC 2H1UA 1MUEB 1LHCH 2VVUA 1AGJA 3S9BA 5ETXA 2PKAA 1FNIA 1SI5H 1K9OE 2AIQA 4WMFA 1OWKA 3UQOA 5E0HA 4GCHF 4H4FA 1HIAB 4INLA 1O37A 3DSPA 1NY22 1Z1IA 2VIQA 2W3IA 4IRAA 1G2MA 1HB0B 2SGDE 1W2KH 3BG4C 2GVFA 2PSYA 1ELEE 1BCUH 4GSOA 2AYWA 1NU9A 1O31A 3K6ZA 1RXPA 2AGGX 1V2LT 3U69H 1CBWB 4FU8A 1S6FA 5GIBA 1P01A 1QA7A 4LK4A 4JZIA 1RZ1A 1IQJA 1P06A 4B6FA 3MMGA 1GI7B 3RXKA 1BOQA 4O3UA 3M61U 4AGJA 2AIPA 1O2VA 5EJLA 4U32A 4CBNA 3S9CA 3S7HB 5JYIA 2JJ1D 1EB1H 5FL7D 3FANA 3E6PH 2ZU2A 1QB9A 1A4WH 1UHBB 4ABJA 3TK9A 3PTNA 2FOHA 2W5EA 1O2JA 3P8OA 2FWWA 3ZV9A 1O3AA 1NROH 3H5CB 5T3HA 2YOLA 2F83A 1DWDH 3ENSB 4RKOB 2PTFA 4WWYA 3RXOA 4A1XA 1B0EA 3R5WA 1CU1A 1G36A 1S6HA 2WYGA 1C1QA 2ZHDA 3M37A 2KX4A 1GI5A 2FIRH 3E90B 1NRRH 1YY3A 1BDAA 2Z9LA 1ZTLA 3UNRA 2V0BA 1C5OH 1VJAU 1EJEA 1QIXB 2EEKA 1ELCA 1HJAC 2JKHA 1THRH 5L2ZH 1NZQH 2WYJA 3PLBA 4F49A 3RDZA 1GI4A 1O3KA 4WVPE 4YT6H 3QX5H 1AE8H 1Y3YA 3DA9B 3O8BA 4IS5A 8GCHF 1P2NA 2OU5A 2ZGJA 4HMVA 2Z6BD 3B5MA 2FOAA 4N7RC 2A1DB 3F6UH 3LIWA 1ZRBA 3RMNH 2VIWA 1BIOA 1V2OT 1P10A 3T28A 2FOEA 3ELAH 5ESCA 1PJPA 1F0SA 2W7UA 5C67A 1HGTH 1C1OA 4JYUH 1SLUB 2XYAA 2BD8A 1IQGA 4JZFH 4AZ2B 3TPIZ 1YCPM 4YWNA 1IHSH 2BQWB 1GI3A 3EGKH 5C1XA 1CT0E 1UTMA 1LO6A 2FM2A 3D23A 4GCHG 5DG6A 3EA9A 1UVSH 1O5EH 8ESTE 3GS9A 1B5GH 3KHVA 3RXFA 1P04A 1V2WT 1VR1H 3RMOH 2KM0A 2KCPA 1YP9A 2IMLA 2V6NA 5F53A 3M5LA 1LTOA 3SUDA 1OWDA 1C5YB 1IQEA 3FAOA 2FS8A 3Q3XA 1GCTC 1W7GH 3BTKE 2KCYA 4TY7A 1HXFH 3S7KB 1BMFD 1C2DA 3HGNA 3RU4E 1ELDE 1YCPK 1GWAA 3RXUA 3KQ5A 1O2RA 1QL8A 1AXJA 3STJA 3SQHE 3PWBA 1ZGIA 2ZKSA 1XKBC 3RXAA 3A89A 1AKSB 5A09A 3RXDA 4TPIZ 1E35B 1RIWB 3E1XB 3HY8A 1G76A 4E7RG 5A8YA 4HGCA 4TPYA 1O2KA 2ZFQH 1Y3UA 4CREA 1C9PA 7LPRA 3P8NA 3ZVAA 1EAIA 2C8ZB 3CP7A 1O2HA 3N7DA 1WYKA 4UD9H 1D9IA 1COWD 5HXFA 3GICB 1YOAA 5K0HA 4K1TA 4XE4A 1IQLA 1YLCA 2UWOA 3AW0A 1VGCB 2G52A 4I7YH 4CR9A 4NZQA 1XUKA 4FETA 1NRGA 1OOKB 2J97A 4AG2A 3KNXA 1HAZB 2UWPA 3RC4A 1F0UA 3BTHE 1BRBE 2GCTC 3U1IB 1H8ED 1K1OA 2WHXA 4AGKA 3PTBA 8GCHG 2IG6A 3E91A 4TY6A 3ZOEA 2CV3A 1WQVH 1TONA 3UWIA 1TBRH 1SQRA 1N1LA 1TABE 4P00A 1GBKA 2ZDNA 2FP7B 2RDEA 2J5UA 3M5MA 4ZHLU 1EP5A 4HTCH 1KSNA 2VWOA 1LKAA 1GCDA 1K28D 1SB1H 2A5KA 2O8TA 2ZP0H 1VKYA 3AVZA 1DT2A 4ZMAH 3BTTE 1RRKA 1C1RA 1KXDA 2C3SA 4A6LA 3UUZA 4YOIA 4ABGA 1CGJE 1JRTA 5EQRA 2D5MA 4ISLA 1C2GA 4B2BA 4D7FA 1HDTH 2BXUH 2Q6FA 2VJ1A 5E2OA 2ZFTA 2XNIA 4Z0KA 2D37A 3LC3A 3GOVB 4X8VH 1BZXE 1A7SA 3E3TA 3M7UA 3VB3A 2FX6A 1OSSA 1ANBA 1ARBA 1SHYA 1O2NA 3URDA 3EDXB 1HAVB 6GCHF 1GDQA 3KN2A 1HLTH 3BNKA 1L1GA 1GHXH 4WY3A 2CGAA 1J8AA 2V7QD 5AHGH 2ARZA 1EZUC 4IN2A 4BTUB 4GHTA 4OS6A 2Z9JA 1Z71A 4UFDH 1A3EH 3R0FA 2AGIX 4B71A 4MG3A 3T27A 2A4RA 4LOYH 3VB5A 1O3BA 2A7HA 2V3MA 5FHTA 3U34A 1SGNE 1AO5A 2BDIA 2SGEE 3A86A 3ATMA 1AFQB 1BMMH 4FUCA 1QGFA 4NWKA 4FUEA 3E0NB 1LQEA 5FPTA 3QN7A 4D9QA 1HAPH 1O2SA 1UK2A 2XRCA 2YNAA 3PFTA 7KMEH 4UFFH 3K87A 1FONA 1HCGA 1QQUA 5KEDA 1AE5A 3H7TA 3OTJE 1EPTB 2ZTXA 5AFYH 3QTVH 3TH3H 2OP9A 1QR3E 1G30B 1TNJA 1YPKH 3TITA 1FIWA 5J4QA 4X6MA 2GMTC 1K1PA 1KTTB 4MPWA 1O2IA 2QXJA 4YOGA 1ELFA 3LH3A 3RXIA 5DP5A 1GI6A 1NBME 1GI9B 3GCHB 2VWMA 1UTKA 3N7OA 1NPMA 1ZHRA 1W11U 2A4QA 1YM0A 1CT4E 1SGYE 5H4IB 4VGCB 4Y9IA 1C1WH 2D36A 2J38A 1TLDA 1Z8RA 3ZOFA 1AI8H 1ID5H 2GP9B 4IW4E 1A0JA 1G78A 4HMUA 5CHOA 3A8AA 2WPMS 2EA3A 1ABJH 1IQHA 4GPGA 4BTIB 1TPOA 1VCQA 3ZV8A 1E79D 1UK4A 2IPHA 5FPYA 1PPHE 1ZR0A 2B8OH 2BM2A 3SUGA 3ESTA 3VG8A 5C0UA 5IYTA 4MNYA 1C1TA 1LDTT 1W3PA 1VZQH 2J2UA 2WPIS 4Y8YA 3DFJA 2VIDA 5F8ZA 2SGQE 3EQ0H 3UOPA 5F03A 3Q76A 3UIRA 2XTTB 4QVBA 2HQ7A 4E05H 3MNBA 4XHYA 4MNWA 2HNTE 2ZC9H 2C4FH 3MO3A 3PO1C 1I0SA 2R2MB 1GBIA 1C1VH 2VBCA 1HXEH 3U8RH 3SJ8A 3K88A 2UUFB 3D49H 1NO9H 1GDNA 4D9RA 1FXYA 1CQQA 2O9QA 1OHHD 3U1JB 1QY6A 1LVYA 2ZCKP 3MOCA 4K8YA 1NT1A 5GCHF 3BG8A 1KDQA 1O2ZA 1LHEH 5AVDA 3QUMP 1F5LA 2NU3E 2ZGXH 1SGEE 1XUGA 4CRBA 4ABAA 5F6MA 1JIMA 3ATIA 3C1KA 3PYHA 1SFIA 7ESTE 2TIOA 3LGYA 4Q2KA 1AIXH 1W13U 2XBXA 2AEIH 3BSQA 3P17H 2GTBA 5HM9A 1C1NA 2Y80A 1LHFH 3ZVBA 5EJZA 1G9IE 2EQNA 1N8OB 1O3EA 1Y3XA 3BEFB 1GJ8B 2H9HA 2PR3A 3MH4A 3ZOGA 1E0FD 2ZNKH 2L6OA 1QJ6B 4DG4A 4I8GA 2C93B 3LOXA 5AFZH 1MZAA 3AMFA 3NRLA 1FN8A 2AMPA 3GDUA 3MWIU 3ITIA 5T6FA 1ZPCA 2FHQA 1UCYE 3F9HA 3M35A 1USCA 1DS2E 1TGTA 2PW8H 2SGPE 3U35A 5HMAA 1MTNB 2KCOA 1YPMH 1DXPA 2SGFE 3DSGA 1YPEH 1P57B 2AFQB 1THSH 5HGGA 3BTQE 4AB8A 1L4ZA 4CH8B 5HKKD 1UTLM 2NWNA 1JOUB 1W3CA 2R3YA 5B6OA 3ZVCA 2JH6D 1ELGA 3CB0A 1BT7A 2DE9A 2NU1E 2QE7D 1GJAB 3M7QA 1C2LA 2HOBA 2WV4A 5C1YA 1WQSA 1SFQB 2CF9H 4DGJA 2Y81A 5FX6A 2R2WU 1MTVA 1LPKB 3ZOHA 1V2VT 2A5AA 4HMWA 1MKWK 1ZSJA 5PTPA 1DVAH 1P2JA 2YMSD 4NA9H 2BDAA 2P8OC 3UQVA 2ODYB 1D4PB 1J14A 3M3TA 4FUDA 4R0IA 3E0PB 2BY9X 3FFGA 1UTPA 1HAHH 5CHAB 3SU3A 3KL6A 3K2UA 1A61H 1CGHA 1DM4B 5KGOA 1T32A 3UY9A 5JBBS 4U30A 1GJ6A 1Z1JA 2ULLA 2GJGA 3PLKA 4I8KA 3TIUA 3V13A 2J9NA 2ZA5A 5GCHG 2J34A 3TH4H 1DE7H 5L6NH 2Z9KA 3KIDU 4OGYA 2JETC 2BX4A 2P3TB 2BD9A 2WV9A 1C1SA 1DFPA 3SJKA 1ELVA 4ZUHA 1O2MA 2HLDD 3PV4A 1SQOA 1K1NA 3TK5A 1G3CA 5DP8A 2W7SA 1TMTH 1QZ8A 5DP9A 3MO6A 2A4OA 3T2NA 3KGPA 4XBBA 3FP6E 3GY7A 1BHXB 1EZXC 1QL7A 1EFRD 3OAAD 1MAXA 4DJZB 5ESBA 3RXSA 1QBOA 1SQAA 1W0YH 1ZZZA 1G3EA 3R3GB 4X8SH 2E83A 3O8RA 1GBMA 1CE5A 1TA2A 3AWHA 6LPRA 3GCTF 1ZJDA 2QF5A 2OCVB 2ZZUH 3HATH 2AQ6A 1QJ7B 1AWFH 1O30A 4Z1MD 3UR6A 4X0WU 2BZ6H 2UWLA 1AMHA 4F4OC 1AKSA 3LU9B 1SOTA 3NCLA 2AH4X 3LH1A 1F92A 2R0XA 1BBRE 3PM3A 3VGCB 4ASUD 1C2JA 3BA3A 1A3BH 1S83A 1BMLA 3A7ZA 5DKMA 1C2IA 5EU8A 2CK3D 2FOFA 1O2GH 4FXGH 3RMMH 2Q6GA 1Y5BT 1P09A 1T8MA 2Y7XA 2QC2A 4MTBA 4AN7A 4LZ1H 2CHAC 3MU1A 4K8BA 1FDPA 2Q9KA 2FURA 3Q3YA 1SPJA 2FLBH 2G4UA 1GMHF 4I31A 4AORA 1C5LH 1EASA 1NU7B 2F9UA 1PQ8A 3AAVA 3LGVA 5FX5A 4Y7BA 1YGCH 3M5NA 1QQ4A 3A7WA 3SU5A 3A84A 2BB4A 1O36A 2ZFPH 1OKXA 3H09A 3LGWA 3MU0A 1OWIA 1K1IA 1MCVA 2OLGA 3O8DA 1XUJA 1A0HB 1VITF 1GL1A 2JDID 3E4VA 2XC0A 2ZECA 3FZDA 3SU0A 1KDQB 4CH2B 2OTVA 2FEQH 2I6QA 4JZEH 5EPNA 1TFXA 1GMDF 3BTME 3RXTA 3CS7A 1FY5A 3SOSA 1BTUA 3A7TA 1GGDB 3VXEH 4KP0A 3VB6A 4AB9A 2LP6A 1HAYB 1V2ST 3T5FH 4Y8ZA 2GCHF 2G55A 3LGUA 5JB8S 2ED4A 1FIZA 2J98B 4BAHB 2HTIA 1WAYB 3SGQE 2OC7A 3F2FA 1FY8E 3UWJH 2V35A 3A7XA 1WBGB 1O3CA 1YPHC 3F9GA 4FOUC 2PP6A 3ZZ4A 1DPOA 2TPIZ 2ZWLH 3QTOH 3RC5A 2F9VA 3TJNA 1MD8A 1KTSB 4MVNA 1JBUH 1HAVA 3Q77A 1Y3VA 3UFAA 3P70B 2IPQX 2Y5GA 1AZ8A 2A5IA 3TGIE 2BD5A 4Y71A 1O3JA 4Q7YA 2ZHEH 3GCTG 4IMZA 3BG4B 1CA0C 3A7VA 1O2QA 2PTNA 1EQ9A 4HMSA 2GGVB 4XBCA 4M7GA 2SFAA 3NK8A 4BNRA 2OQUA 1UTOA 4INHA 4YXWD 3BIUH 3UPEA 4TSFD 4FUJA 3RXMA 1UO6A 1USFA 2WSSD 1MTWA 2A2XH 4X6OA 2UUYA 2TGAA 1D6RA 2F9OA 3F9FA 4AYVB 2CMYA 1SGCA 1BHXF 4TT3D 1RFEA 1C4U2 1F0RA 1D6WA 1EPTA 1BTWA 2JH0D 4WMEA 1YC0A 5HIZA 3KCGH 1G3DA 3KEEA 3EAAA 2P59A 3KYGA 2ZDLA 3MNSA 4BXSA 1HUTH 2WUCA 3A87A 2G4TA 1GMHG 2ZU3A 1W0KD 3OEED 3L33A 3LGIA 3RH7A 3P6ZB 3TJUA 1A0LA 2P94A 1ACBE 5EXMA 4I8HA 2D8WA 4KGAA 2HLCA 2VVCA 1MCTA 1G79A 1TNLA 3TVJB 4YBNA 1VCPA 4FUBA 1OPHB 1VITG 2BMGB 5EPYA 2BY5X 1BTPA 1EAUA 2GV6A 3OX7U 1GMDG 1HJAB 2TRMA 3O8CA 5JABA 1QL9A 4W64A 4MPUA 5FCKA 1NFXA 1W10U 1GDUA 1NRNH 3SWJA 1C5UA 2GCHG 4NA7A 1PFXC 1EOLA 4X1NU 3QZRA 3S9AA 2HGTH 3DD2H 2XXLA 3RXCA 3RXHA 1HAOH 5DSFA 1ANDA 1BTZA 3R5RA 4D76A 3KQBA 1UVPA 1YBWA 2Z3DA 2W6JD 5JBAS 3L6PA 2BXTH 5A2MH 1ESAA 3F68H 1LVOA 5EW1H 2NU2E 1C5NH 1J9CH 2QEAA 3HKIB 2ECRA 3A20A 3R5YA 3VEQB 1RIWC 2VWNA 1AB9B 4B2CA 4YO9A 4AYYB 2LPRA 4JZ1A 4A1TA 5A0CA 3GYMA 2D1JA 1O5AB 2HNTF 1QBVH 1C5QA 8LPRA 1C5XB 1JNWA 4ABIA 1F2SE 1P2OA 1GBHA 4JYVH 4NWLA 1G2LA 4DURA 1EZQA 1GI2A 1BQYA 2Y5HA 3EAJA 2VPAA 1O32A 3PMBB 1O3IA 4ABEA 1MH0A 1D3QB 2ALVA 1TRNA 1WUNH 4DIIH 4O9VA 1WLKA 1LHDH 1O2TA 3ZZCA 1SGIB 4IC5A 4Y76A 2IOTA 1TRYA 1P3EA 4NA8A 5EOKA 1M9UA 2IJD1 1WTGH 2M5TA 4DT7B 2G51A 3NKKA 2P5ZX 1O2PA 3SGAE 1TOMH 3ZZ6A 2BVRH 3ZODA 2Y5FA 4BAQB 5C20A 2VB0A 1HFDA 2FDAA 1SGFG 1BA8B 4Y11E 1L1JA 1V6DA 1FAXA 5C5OA 3ZOCA 2KZ4A 3BEUA 2VGCB 5GNDA 2BDGA 3URCA 1C5WB 4HMXA 2BD4A 4BXWA 3KQDA 1GHZA 3LGTA 4CHAC 1NFYA 5EG4A 5J4SA 1YKTA 2IABA 1TQ7B 2RA3A 3QWCH 1P2QA 1SLVB 1O2XA 3TNTA 5HYOA 2KFWA 3V4HA 1Z8GA 2NU4E 1HAIH 3NPSA 2QF3A 1C4V2 3MU8A 2QV1A 2AHME 5DJ7A 1IHTH 4SGAE 1C1UH 1EKBB 1O5CB 2ZHWH 3M3SA 2FX4A 1GI0A 3V12A 2QGRA 1O3PB 3U28C 1V2PT 1FY3A 3RXVA 1TNHA 3A8BA 2A0QB 1DY8A 1JMOH 1YYY1 4X1RU 3GY5A 1EP6A 1E38B 1W7XH 3LONA 2ZDVH 1FAKH 3WWBA 2Z7FE 4O3TA 1HAXB 2G00A 1AFQC 3ZZ7A 1DICA 2FESH 1NS3A 5A8XA 4CRAA 3NUMA 2EI7A 2P16A 2ZGCA 2WPKS 2QAAA 2Z9GA 4IBLH 4TWWA 4Y7AA 3IG6B 1FPCH 4IMQA 5E2PA 1ZMLA 2ECUA 2R0LA 1TOCB 3UAIC 2FI4E 2ZG0H 3PROA 3ZYDA 2FO9A 1UCYK 3UNSA 1F0TA 3FO8D 2FTMA 3D62A 3SU2A 1QNJA 2XC4A 3U5WA 1TX8A 2PTCE 1SG8B 1O5FH 1WXRA 2ZI2H 1PQ7A 4Q80A 4LZ4B 1P9SA 1YPLH 2XWBI 4WH6A 2RG3A 1FLEE 1V2NT 1VJ9U 3FN8A 1BB0B 3GCHC 1SGRE 4OS4A 4NIYA 3RM2H 1UK3A 1PPGE 2TBSA 3RM0H 4DW2U 1QFKH 2ZPRA 2A31A 1CHOF 1AD8H 1SKYE 4H6SB 1T31A 1O3DA 2ZTYA 1J16A 1SGTA 4ZKRU 1T8NA 3UB0A 1FUJA 1F7ZA 1YCPH 1E36B 3SNCA 2HALA 2A7JA 5C2ZA 3V3MA 3SJOA 4B1TA 3EE0B 3EA7A 4WJG2 2YMSC 3W94A 1WDIA 4MTKA 4QT8C 2PLXA 1SGFA 2BLQA 3B23B 1O33A 4FUFA 1BTHH 1V2QT 4JYTA 1VCWA 2XC5A 2BX3A 2GMTB 3VY2A 1RGQA 2VH0A 1BMAA 4NFEA 3SJ9A 5LPRA 1ZSLA 1MU8B 3GCNA 1CVWH 3PV2A 4B74A 3VB7A 4HKHA 1YPGH 4Y0YE 4NIXA 1KLTA 1UMAH 4FU7A 4ZH8A 4NIWA 1A5IA 2XCNA 9LPRA 1D3PB 1TGBA 3TJOA 1H9IE 5A8ZA 1V2UT 2QXIA 4XSKU 4YTAA 2OQ5A 3DT0H 4Q7XA 2Z94A 1PPBH 1DDJA 4E06H 3BEIB 1ZPZA 2J95A 1SR5C 3P8GA 1FV9A 2W26A 3QGNB 2V3OH 2FG9A 4X2WA 1YLDA 5BNCA 1TB6H 3PRBA 4AFSA 1Q3XA 3K86A 2ZFRH 3W1EA 1ZLRA 3W95A 1ZMJA 4ACBA 5GJ4B 1C5PA 1N6YA 2TGTA 5A0BA 1SMFE 3F0OA 1FQ3A 1ANEA 2BY6X 4CBOA 5F8XA 2EC9H 2XNDD 3OY6U 3HPTB 4INKA 1E37B 4NGAH 4X1PU 4Z6AH 2G8TA 1EUFA 2BDBA 1N8OC 4K1EA 3RLWH 1P0SH 3H7OA 1I0RA 4XJ2A 1TGNA 3HMZA 2D2DA 4FU9A 4XOJA 3BTEE 5DP7A 4XRNA 1Z8IB 4BAMB 3IN6A 1ZGVA 1N6XA 5DN6D 1SGDE 1RTLA 2J98A 3ATLA 1BBRK 2ESTE 3KQCA 4X6NA 2ZGBH 1Y5UT 3QGJA 1C5VA 3EE7A 1YWUA 1W3QA 2XW9A 1MTNC 2H2ZA 3SZNA 1O3GA 1JIRA 2FPZA 2ZU4A 4WXVA 1GVLA 5ABWA 5HM2A 3TU7H 1P2IA 1CHOG 2BQ6B 2QXGA 3SHCH 3TK6A 4B76A 1L4DA 1A5GH 2B7DH 5GWZA 2ZDAH 4CR5A 3A88A 3NZIA 3F0PA 1X7AC 5C3NA 3L3TA 2GD4B 5B6LA 1LQDB 3SGBE 2RA0A 1AHTH 1K0HA 1UCYH 2XCFA 4NSYA 3BF6H 2ANYA 3FKSD 2PKSB 1D3DB 4ABDA 1MAYA 2PGQB 3LKWA 3VFEA 4B6EA 3R5ZA 3FP8E 4K69A 1XMNB 1GVKB 1OYTH 4X6PA 4ABFA 2BDHA 5CDFE 4MDSA 1DWBH 2WPLS 1ZSKA 2BLVA 4B73A 2BD7A 4UDWH 1Z6EA 2QCKA 5C0TA 1C1PA 3TGJE 3T29A 4A1VA 1OS8A 5CHAC 1LHGH 1L1NA 1TMBH 3OFND 2ANWA 2OC1A 1TWXB 6CHAB 4Q4LA 4RI0A 1P9UA 1T8LA 2EI8A 1C4Y2 2OBQA 4ESTE 2UUKB 1TE0A 3UTUH 1AQ7A 1GPZA 2QY0B 3HKJB 4Z85A 1BJUA 1PQ5A 3BTWE 1K1LA 1H8IH 5BRRE 2Q1JA 2OK5A 3SV8A 1GHWH 4Q63A 2FMJA 2Y7ZA 3T62A 2BVSH 4L82A 1C2HA 1MBMA 1KY9A 1P12E 1HBTH 2ANKH 1HAGE 1GBCA 3A85A 3SBKA 3V0XA 2P8OB 1KXEA 1OX1A 2XBWA 1DSTA 1GG6C 1S5SA 1S84A 3RXLA 4ZCNA 4Y10E 1PPEE 3EA8A 2AGEX 1SSXA 3ZZ5A 3EC6A 2ZF0H 5EGMA 1ZYOA 1MBQA 2XOKD 4NFFA 2TGPZ 8KME2 1P3CA 2GV7A 2O8LA 3QK1A 3RU4D 5TCAA 3FKHA 3PMHB 1P2MA 1C5SA 4A92A 3AAUA 3Q00A 1FI8A 4UONA 3JZ1B 4WXIA 1QCPA 3LC5A 2HTDA 1Q2WA 3B9FH 1DX5M 2FOCA 4I8JA 1D3TB 4ZAEA 3AK5A 1T4VH 3VGCC 3MNXA 3SJIA 1Y12A 2ZHQH 1ZTJA 2BLWA 3OYPA 3SV6A 1C2FA 1FJSA 3A82A 1XXOA 3K6YA 4B2AA 3EYDA 4XD7D 3LPRA 3SYJA 3CP3A 3NWUA 1WOFA 2BQ7B 1YPJH 3OE7D 1O2OA 1OP0A 1OYQA 2W6ID 2ZCHP 3MU5A 3M3VA 1EAWA 5I25A 5DK1A 1IQMA 1Y59T 3AW1A 4RT0A 2FYQA 4ZHAA 1Z6JH 5L30H 2Z3EA 3QO6A 3UREA 4BTTB 3M5OA 5LPFA 1T8OA 2RDLA 3SU4A 1ZHMA 4GUXA 1O38A 4RKJB 1MQ6A 2HQ9A 3I78A 1ORFA 1HNEE 3VY5A 1O35A 3HK6B 1EOJA 4ZXYH 2OINA 1GHBG 2RE7A 1RS0A 2ZPSA 2ZDKA 3U8OH 2V3HH 3ZZ8A 2CXVA 4NCYA 1ARCA 1NFUA 4JZDH 1GGDC 3F2GA 3ZZDA 2HNTC 2LELA 1QRWA 3A83A 2BVXH 2XBVA 5DGJA 2QCYA 5FBIA 3TH2H 3TGKE 2HHZA 2K4QA 4BAKB 1SHHB 5DPAA 1CSOE 4X2YA 3DHKH 4H42U 1DWEH 2CHAB 2VIOA 2P3UB 3BPKA 3UOUA 1MZDA 3A81A 1G77A 2IJOB 1UJ1A 3FGEA 3MFJA 1H8HD 3BTFE 3N99A 2C8WB 4YESB 1TYNA 4ZKSU 1SBWA 2ZDMA 4OGXA 3V7TA 1CBWC 3GCOA 2KAIB 3S0NA 2BD3A 3DUXH 1MU6B 2OXSA 1LMWB 3F3BA 5DP3A 2B5TB 4K60A 1JRSA 4K5ZA 1KMHB 3U98H 1F5RA 3UNQA 1MKWH 1NN6A 1CI0A 1OWEA 1SLWB 1VL7A 2O8WA 2VNTA 2QN5T 1ESBA 1XVMA 2W3KA 5AF9H 3OU0A 1UVUH 2PV9B 4J1YA 2AMDA 1A2CH 1DY9A 3SORA 1V2MT 1L0ZA 1AUJA 1BITA 3SV7A 3ODDA 1ESTA 1TA6A 4YT7H 1OP8A 2NR4A 3F7EA 1AVWA 1H4WA 1FPHH 1FN6A 3F2HA 2OC8A 3CS0A 1KLIH 5G4BA 1OWJA 1GI1A 2D26C 1QA0A 2A2QH 2G5VA 5F8TA 5LPEA 1TRMA 2VU8E 6ESTA 2EI6A 3H96A 1T9MA 1SLXB 1P11E 1GBFA 4AFQA 4OM9A 3KQEA 2L74A 4KTSA 1XKAC 3ZZ9A 1EB2A 3TJVA 4M9FA 1NBMD 1TBZH 1CA0B 3RXRA 3GY6A 1QRZA 2FZZA 2WINI 2R3UA 3LT3A 1IAUA 2QF4A 2STAE 1AY6H 4DT4A 5T1VA 3GYLB 2FTLE 4CRFA 2FS9A 4K1SA 1O3NA 1ELTA 4CRGA 1QRXA 3QLPH 1K22H 1SGQE 3M7TA 4WH8A 3QZQA 3K65B 5DP6A 4DCDA 3IITA 2FI3E 3MQKC 1XXFA 2ZEBA 4WF8A 2GKVE 9ESTA 5JBTA 4ISNA 3G01A 2ZPQA 3BTGE 2FOMB 3CNRA 3WW7A 2XBYA 4NZLA 3KYFA 2GZ7A 1JXPA 3ZZBA 3RC6A 3SHAH 2WPJS 1GHAF 2STBE 5JB9S 1V3XA 2M2AA 4GAWA 4X2XA 3GASA 2F9BH 2GT8A 2P95A 1KXBA 1ETSH 2A4GA 2UUJB 1LVMA 4R8TB 4UHVA 4K3JA 4JMYA 1GBEA 1PYTC 5EQSA 3GISB 1K21H 3IWMA 2H5DA 1DSUA 1RTKA 1Y3WA 4ZXXH 5DO4H 4ABHA 1AB9C 1H8DH 2ASUB 1C2EA 5JPMH 4DIHH 5E0JA 2HVYB 1O2UA 1Y30A 2HPQH 3GY2A 3ZZAA 2DE8A 2ZTZA 1DWCH 1TNKA 2C8XB 4XFQA 5E0GA 1O2WA 1EX3A 1MD7A 3OY5U 1TBQH 5EIYA 2VIVA 1GJCB 1ETRH 3JZ2B 1XXDA 3WWFA 1O3MA 5T6GA 3ZVGA 3ZIAD 2D38A 1GCTB 2A7CA 1W0JD 2G5NA 1VGCC 3LJOA 4A5TS 5LH8A 2F9NA 2Q6DA 3WY8A 1O3OA 3DB0A 2QA9E 3PMAB 3NXPA 1F5KU 3ZVFA 4KKDA 1FMGA 5FCRA 1YF4A 1UTQA 1V2RT 4MNVA 3DNHA 1INCA 2BOKA 5EJ1A 4AOQA 2F43B 1WV7H 2DUCA 2THFB 2F4LA 1GJDB 2RFKC 4J2YB 3U9AH 1GL0E 1XUIA 1GBDA 5CHEC 4H6TA 2BOHB 1LPGB 1PPFE 2H5CA 1S0RA 2ZQ1A 3U0IA 1C1MA 4UEHH 1CO7E 4Y79A 2VGCC 2R9PA 4O97A 1K1MA 2O8UA 1L2EA 4OS1A 4DY7B 3RXEA 4GLYA 3DFLA 1NRQH 1S81A 2AERH 1ZOMA 2VH6A 1VITH 2J92A 5CHBA 1BRAA 2PWXA 1ZHPA 2ZFFH 1GVZA 4ZROA 1DITH 4FUGA 1BJVA 1UW7A 3RUOA 4HI3A 4CRCA 3SO3A 2FOGA 3SQEE 3RP2A 1ELBA 2K8IA 4JCNA 1K2I1 1P02A 2VINA 3SNAA 5L2YH 1RZ0A 1HRTH 2GCTB 2PKAB 5FBEA 1GHAG 3FOAA 4GHQA 1GBLA 3OSYA 1J15A 2OD3B 2F9PA 1EJMA 2OC0A 4KTCA 1RFNA 3M36A 3PB1E 4YZUA 1PPZA 2R0KA 5SGAE 4IN1A 1CGIE 3NFWA 4OS7A 2VVVA 5EW2H 1AFEH 3AASA 2WPDD 2FI5E 1UTNA 1IOEA 1C2MA 2A32A 4CHAB 2CJIA 1LKBA 1O2LA 1E34B 1QJ1B 3P92A 1O39A 4GVUA 2ODPA 1WSSH 1ZJKA 1XVOA 4HFPB 1TNGA 1Y5AT 1FX0B 1P05A 4D8NA 4ZHMU 2B0FA 2I6SA 2VIPA 4HG6A 5FXLA 5C17A 1PYTD 2ZU1A 1EPTC 2EY4C 3MI4A 5BPEA 1RTFB 2JIZD 4FUHA 4BOHA 1FZZA 1EJNA 1P03A 1TX7A 5ESTE 3SV2H 2Z3CA 2WZQA 3SN8A 2Y6TA 1IQFA 2GDEH 3RXJA 1Y8TA 1HJ8A 4ZKYA 2QF0A 2HRVA 1ZTKA 1GI8B 3SW2B 1MTSA 2C8YB 3MYWA 3F1SB 4VGCC 1SC8U 2JJ2D 5KECA 4NSVA 2ZIQH 3F9EA 5LGOA 2BDYA 1KXAA 1S85A 3BTDE 3R5PA 3SV9A 1O34A 2FOBA 1NRSH 4JK6A 4FVDA 3GDVA 1GJ9B 1XX9A 1XUHA 3UR9A 2H6MA 1BTYA 2J94A 4ISOA 5CMXH 1T4UH 4MNXA 4YM9A 1QURH 3P8FA 4MQAA 1WV4A 5E8EH 4B75A 4LXBH 3BIVH 4TWYA 3MTYA 1AVXA 2P3FH 1GJ7B 1ZMNA 3RMLH 1HPGA 5TCCA 4ABBA 3ZZ3A 2GDDA 1GJ5H 4DOQA 1ZRKA 2PHBA 1NM6A 4O03A 3PV5A 1HYLA 2OL5A 2RCEA 1HJ9A 4MLFB 4TV4A 1EJAA 3BN9A 1RJXB 2B9LA 2CN0H 3I29A 3ZYEA 5TJXA 1P8VC 2ANMH 1SL3A 2YMSB 3MH7A 1AVGH 1A1RA 1PQAA 4P02A 4X1QU 2ZGHA 3HE1A 2OUAA 4OS5A 3SU1A 4Y0ZE 2QYIA 2K0QA 3A6RA 1B7XB 3DSOA 3OEHD 1SGPE 1W3OA 1O5GH 4SGBE 1G32B 1MABB 2GZ8A 3SZEA 4AC9A 2CF8H 2KCAA 5DP4A 5EXLA 1GBBA 4FUIA 4I86A 1WU1A 2NU0E 1YLNA 2ODQA 6GCHG 3SNBA 1DANH 1O3HA 3ATWA 4F48B 2ZU5A 1S0QA 4KTUA 1KXFA 2I51A 1ZPBA 1FY4A 4RT1A 2L1TA 4YLUA 3DMBA 5GDSH 1OWHA 3K9XB 1O5BB 3PO1B 3RXGA 3U8TH 2FXRA 4OS2A 3RU4T 3LJJA 2GT7A 3PMJA 4X8UH 3HK3B 4A7IB 4K2YA 1TGCA 1MKXK 2Z9IA 4I33A 4YOJA 2BYAX 3HGPA 1UVTH 3CENA 4R82A 2KAIA 2H9EH 1FY1A 3B8JA 4F07A 2R6VA 1V2JT 2H9TH 4BAOB 1WCZA 1XM1A 1OP2A 3PRDA 1YPHE 4Y6DA 1O2YA 3A6QA 1H1BA 1PPCE 1TY9A 2FLRH 5FPSA 5C5NA 5IK2D 4X8TH 2FODA 1HIAA 5C94A 5IDKA 2C90B 3MNCA 4UE7H 1FLMA 1A46H 4UFEH 3A7YA 1GMCF 4PROA 1XHNA 1IQIA 1W3RA 1K1JA 1H9HE 2PKSC 4MPXA 3RXPA 3SUEA 3TLOA 1BRUP 1NC6A 2GUJA 1TALA 2BY8X 3KF2A 1UTJA 1KLJH 1KIGH 4ZKNU 2HWLB 2GX4A 5T6DA 5CE1A 1P2KA
chains in the Genus database with same CATH topology
2HTIA 2RE7A 1WV4A 3HY8A 1G76A 2ASFA 2X1JA 3PFTA 3R5RA 3K87A 2A2JA 2FG9A 5KEDA 5BNCA 3K86A 4FOUC 3CNRA 4Z85A 5EJZA 2QEAA 2HHZA 2PTFA 3KYFA 2ECRA 3A20A 3R5YA 1RZ0A 3R5WA 1YOAA 3ZOGA 2OL5A 4L82A 2ECUA 3BPKA 3GASA 1G77A 3FGEA 2E83A 3AMFA 1EJEA 1JNWA 1NRGA 1DNLA 3AWHA 4P02A 2FHQA 3NFWA 1USCA 3VYAA 4HMSA 1I0RA 4XJ2A 3U35A 3A6RA 3HMZA 2AQ6A 3EC6A 3U5WA 2VPAA 1CI0A 1WLIA 2IG6A 4XRNA 1VL7A 2OU5A 4Y9IA 1W3OA 3IN6A 3ZOEA 2D36A 3DSGA 4HMVA 3ZOFA 3B5MA 2X1KA 4P00A 1USFA 1G78A 4HMUA 4N7RC 5CHOA 1Y30A 1WLKA 2RDEA 3FKHA 2R0XA 4I86A 3BA3A 1YWUA 1W3QA 5ESCA 1YLNA 4HG6A 4F48B 1RFEA 3CB0A 2I51A 4RT1A 3DMBA 4YWNA 2HTDA 2NR4A 5EIYA 3F7EA 1W3PA 3KYGA 3ZODA 2I02A 2D5MA 2D38A 3TGVA 2Q9KA 2FURA 3ZOHA 4HMWA 1XXOA 3DB0A 3RH7A 4ZKYA 3ZOCA 4QVBA 4R82A 2HQ7A 2D37A 4IRAA 2IMLA 1W9AA 4F07A 2R6VA 3CP3A 4XHYA 4HX6A 3H96A 4HMXA 1T9MA 1G79A 1I0SA 3R5ZA 3DNHA 4YBNA 5EJ1A 3A6QA 3BNKA 1TY9A 3K88A 2L74A 5KECA 2IABA 3VY2A 3E4VA 4HMTA 4RT0A 5KGOA 2ARZA 5CHEC 3U0IA 1FLMA 5JABA 1RZ1A 3R5PA 1XHNA 2GJGA 1W3RA 2QCKA 5EJLA 2HQ9A 3U34A 1WGBA 1AXJA 3SWJA 3VY5A 3R5LA 2ED4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HTI A;  2RE7 A;  1WV4 A;  3HY8 A;  1G76 A;  2ASF A;  2X1J A;  3PFT A;  3R5R A;  3K87 A;  2A2J A;  2FG9 A;  5KED A;  5BNC A;  3K86 A;  4FOU C;  3CNR A;  4Z85 A;  5EJZ A;  2QEA A;  2HHZ A;  2PTF A;  3KYF A;  2ECR A;  3A20 A;  3R5Y A;  1RZ0 A;  3R5W A;  1YOA A;  3ZOG A;  2OL5 A;  4L82 A;  2ECU A;  3BPK A;  3GAS A;  1G77 A;  3FGE A;  2E83 A;  3AMF A;  1EJE A;  1JNW A;  1NRG A;  1DNL A;  3AWH A;  4P02 A;  2FHQ A;  3NFW A;  1USC A;  3VYA A;  4HMS A;  1I0R A;  4XJ2 A;  3U35 A;  3A6R A;  3HMZ A;  2AQ6 A;  3EC6 A;  3U5W A;  2VPA A;  1CI0 A;  1WLI A;  2IG6 A;  4XRN A;  1VL7 A;  2OU5 A;  4Y9I A;  1W3O A;  3IN6 A;  3ZOE A;  2D36 A;  3DSG A;  4HMV A;  3ZOF A;  3B5M A;  2X1K A;  4P00 A;  1USF A;  1G78 A;  4HMU A;  4N7R C;  5CHO A;  1Y30 A;  1WLK A;  2RDE A;  3FKH A;  2R0X A;  4I86 A;  3BA3 A;  1YWU A;  1W3Q A;  5ESC A;  1YLN A;  4HG6 A;  4F48 B;  1RFE A;  3CB0 A;  2I51 A;  4RT1 A;  3DMB A;  4YWN A;  2HTD A;  2NR4 A;  5EIY A;  3F7E A;  1W3P A;  3KYG A;  3ZOD A;  2I02 A;  2D5M A;  2D38 A;  3TGV A;  2Q9K A;  2FUR A;  3ZOH A;  4HMW A;  1XXO A;  3DB0 A;  3RH7 A;  4ZKY A;  3ZOC A;  4QVB A;  4R82 A;  2HQ7 A;  2D37 A;  4IRA A;  2IML A;  1W9A A;  4F07 A;  2R6V A;  3CP3 A;  4XHY A;  4HX6 A;  3H96 A;  4HMX A;  1T9M A;  1G79 A;  1I0S A;  3R5Z A;  3DNH A;  4YBN A;  5EJ1 A;  3A6Q A;  3BNK A;  1TY9 A;  3K88 A;  2L74 A;  5KEC A;  2IAB A;  3VY2 A;  3E4V A;  4HMT A;  4RT0 A;  5KGO A;  2ARZ A;  5CHE C;  3U0I A;  1FLM A;  5JAB A;  1RZ1 A;  3R5P A;  1XHN A;  2GJG A;  1W3R A;  2QCK A;  5EJL A;  2HQ9 A;  3U34 A;  1WGB A;  1AXJ A;  3SWJ A;  3VY5 A;  3R5L A;  2ED4 A; 
#chains in the Genus database with same CATH topology
 1BUI A;  1NTP A;  1Z7K A;  2QIQ A;  1A5H A;  3A8C A;  4RN6 A;  4YLQ H;  5GXP A;  1NFW A;  4THN H;  4I8L A;  2BY7 X;  5JBC S;  3FVF B;  3ZVE A;  1B0F A;  3DCL A;  4AX9 H;  3D65 E;  1C5M D;  3ZVD A;  2PFE A;  3PWC A;  1ETT H;  4BAN B;  1V2K T;  1XUF A;  1CA8 B;  1G3B A;  2F3C E;  1TGS Z;  3I77 A;  1H9L B;  1UHB A;  6CHA C;  2SGA A;  2FYR A;  3MO9 A;  3MH6 A;  1C2K A;  1MMJ N;  3SU6 A;  4AG1 A;  4E7N A;  2QXH A;  2A45 B;  1DLE A;  2SNW A;  1C5Z B;  3BV9 B;  1LPZ B;  1GHB F;  1DLK B;  1QB6 A;  2BLO A;  1DNL A;  4TYD A;  2BTC E;  4Y8X A;  2ZQ2 A;  1TAW A;  2WPH S;  4MPV A;  3VYA A;  1GJB B;  3GY8 A;  1GJ4 H;  4RSP A;  2HVX A;  2J4I A;  4ISI H;  5HIY A;  4CRD A;  1WLI A;  2BD2 A;  2ZCL P;  3E8L A;  2ZHF H;  5EXN A;  2YNB A;  3P95 A;  4JK5 A;  3RXB A;  3PLP A;  2X1K A;  3FZZ A;  4XDE A;  4AFZ A;  7GCH F;  4ASH A;  2WUB A;  3VB4 A;  1EAT A;  1GBJ A;  1DXW A;  2PUQ H;  1AUT C;  1W8B H;  2OBO A;  1AU8 A;  3LDX H;  4X1S U;  1THP B;  2F91 A;  3SI3 H;  3A8D A;  1E1Q D;  2PSX A;  1ELA A;  4U2W A;  3Q3K A;  2K1Q A;  4U01 A;  5EOD A;  1GHV H;  4DVA U;  3STI A;  2I02 A;  4NIV A;  2LNC A;  2Y82 A;  3GY3 A;  3VPK A;  3TGV A;  3S69 A;  1IQK A;  1CHG A;  1TNI A;  5JDU B;  3SND A;  1C5T A;  3ATK A;  2ILN A;  1W9A A;  2HPP H;  1KYN A;  4I32 A;  1LVB A;  1S6L A;  1TX6 A;  1BRC E;  4HX6 A;  2BZA A;  4IGD A;  1GHY H;  1W12 U;  1O5D H;  5GPI B;  1LCY A;  1C9T A;  2O8M A;  2JET B;  1S82 A;  4UFG H;  4F55 A;  4HMT A;  1SVP A;  1NES E;  3SNE A;  3E16 B;  1GG6 B;  1GMC G;  3T25 A;  1GBA A;  2ALP A;  4AFU A;  1AN1 E;  1DOJ A;  1SOZ A;  1AWH B;  4X2V A;  1QB1 A;  4Q7Z A;  1WGB A;  1Z8J B;  4ISH H;  1C5R A;  3R5L A;  2XWA A;  3C27 B;  1TPS A;  2JH5 D;  3ODF A;  4FVB A;  2ZFS A;  2AS9 A;  3A80 A;  1CT2 E;  2IN2 A;  2KR7 A;  1G37 A;  1QTF A;  2ZO3 H;  2ASF A;  1EAX A;  2AMQ A;  2SNV A;  5A0A E;  2TGD A;  2X1J A;  1MTU A;  2A2J A;  4XBD A;  3VXF H;  1QHR B;  1AZZ A;  1KXC A;  1TQ0 B;  1W14 U;  1WTH D;  1NRP H;  3N7E A;  1MKX H;  1HV7 A;  3SI4 H;  3MH5 A;  1BBR H;  3T26 A;  5K7R A;  2BHG A;  2P93 A;  3RXQ A;  1TMU H;  3RLY H;  3MU4 A;  2G81 E;  4HZH A;  1DUA A;  3OTP A;  1BMN H;  3GY4 A;  4KEL A;  1MQ5 A;  2VWL A;  1GBT A;  1IQN A;  1TIO A;  1QBN A;  4IC6 A;  1W0Z U;  1U6Q A;  2GZ9 A;  2WV5 A;  1EXF A;  3TNS A;  4D7G A;  1OXG A;  1UVO A;  3SUF A;  5I46 H;  3FP7 E;  1O3F A;  1RD3 B;  1V2T T;  2BDC A;  3QDZ B;  2PUX B;  4NG9 H;  1DUE A;  1TPP A;  5FAH A;  4WMD A;  1Q31 A;  1ABI H;  1TPA E;  1ANC A;  4ZKO U;  7GCH G;  2PGB B;  1E1R D;  1T7C A;  1O3L A;  1JWT A;  1BTX A;  5EQQ A;  1J17 T;  1O0D H;  3GDS A;  1SQT A;  3MHW U;  4ACA A;  5C1U A;  1EZS C;  2H1U A;  1MUE B;  1LHC H;  2VVU A;  1AGJ A;  3S9B A;  5ETX A;  2PKA A;  1FNI A;  1SI5 H;  1K9O E;  2AIQ A;  4WMF A;  1OWK A;  3UQO A;  5E0H A;  4GCH F;  4H4F A;  1HIA B;  4INL A;  1O37 A;  3DSP A;  1NY2 2;  1Z1I A;  2VIQ A;  2W3I A;  4IRA A;  1G2M A;  1HB0 B;  2SGD E;  1W2K H;  3BG4 C;  2GVF A;  2PSY A;  1ELE E;  1BCU H;  4GSO A;  2AYW A;  1NU9 A;  1O31 A;  3K6Z A;  1RXP A;  2AGG X;  1V2L T;  3U69 H;  1CBW B;  4FU8 A;  1S6F A;  5GIB A;  1P01 A;  1QA7 A;  4LK4 A;  4JZI A;  1RZ1 A;  1IQJ A;  1P06 A;  4B6F A;  3MMG A;  1GI7 B;  3RXK A;  1BOQ A;  4O3U A;  3M61 U;  4AGJ A;  2AIP A;  1O2V A;  5EJL A;  4U32 A;  4CBN A;  3S9C A;  3S7H B;  5JYI A;  2JJ1 D;  1EB1 H;  5FL7 D;  3FAN A;  3E6P H;  2ZU2 A;  1QB9 A;  1A4W H;  1UHB B;  4ABJ A;  3TK9 A;  3PTN A;  2FOH A;  2W5E A;  1O2J A;  3P8O A;  2FWW A;  3ZV9 A;  1O3A A;  1NRO H;  3H5C B;  5T3H A;  2YOL A;  2F83 A;  1DWD H;  3ENS B;  4RKO B;  2PTF A;  4WWY A;  3RXO A;  4A1X A;  1B0E A;  3R5W A;  1CU1 A;  1G36 A;  1S6H A;  2WYG A;  1C1Q A;  2ZHD A;  3M37 A;  2KX4 A;  1GI5 A;  2FIR H;  3E90 B;  1NRR H;  1YY3 A;  1BDA A;  2Z9L A;  1ZTL A;  3UNR A;  2V0B A;  1C5O H;  1VJA U;  1EJE A;  1QIX B;  2EEK A;  1ELC A;  1HJA C;  2JKH A;  1THR H;  5L2Z H;  1NZQ H;  2WYJ A;  3PLB A;  4F49 A;  3RDZ A;  1GI4 A;  1O3K A;  4WVP E;  4YT6 H;  3QX5 H;  1AE8 H;  1Y3Y A;  3DA9 B;  3O8B A;  4IS5 A;  8GCH F;  1P2N A;  2OU5 A;  2ZGJ A;  4HMV A;  2Z6B D;  3B5M A;  2FOA A;  4N7R C;  2A1D B;  3F6U H;  3LIW A;  1ZRB A;  3RMN H;  2VIW A;  1BIO A;  1V2O T;  1P10 A;  3T28 A;  2FOE A;  3ELA H;  5ESC A;  1PJP A;  1F0S A;  2W7U A;  5C67 A;  1HGT H;  1C1O A;  4JYU H;  1SLU B;  2XYA A;  2BD8 A;  1IQG A;  4JZF H;  4AZ2 B;  3TPI Z;  1YCP M;  4YWN A;  1IHS H;  2BQW B;  1GI3 A;  3EGK H;  5C1X A;  1CT0 E;  1UTM A;  1LO6 A;  2FM2 A;  3D23 A;  4GCH G;  5DG6 A;  3EA9 A;  1UVS H;  1O5E H;  8EST E;  3GS9 A;  1B5G H;  3KHV A;  3RXF A;  1P04 A;  1V2W T;  1VR1 H;  3RMO H;  2KM0 A;  2KCP A;  1YP9 A;  2IML A;  2V6N A;  5F53 A;  3M5L A;  1LTO A;  3SUD A;  1OWD A;  1C5Y B;  1IQE A;  3FAO A;  2FS8 A;  3Q3X A;  1GCT C;  1W7G H;  3BTK E;  2KCY A;  4TY7 A;  1HXF H;  3S7K B;  1BMF D;  1C2D A;  3HGN A;  3RU4 E;  1ELD E;  1YCP K;  1GWA A;  3RXU A;  3KQ5 A;  1O2R A;  1QL8 A;  1AXJ A;  3STJ A;  3SQH E;  3PWB A;  1ZGI A;  2ZKS A;  1XKB C;  3RXA A;  3A89 A;  1AKS B;  5A09 A;  3RXD A;  4TPI Z;  1E35 B;  1RIW B;  3E1X B;  3HY8 A;  1G76 A;  4E7R G;  5A8Y A;  4HGC A;  4TPY A;  1O2K A;  2ZFQ H;  1Y3U A;  4CRE A;  1C9P A;  7LPR A;  3P8N A;  3ZVA A;  1EAI A;  2C8Z B;  3CP7 A;  1O2H A;  3N7D A;  1WYK A;  4UD9 H;  1D9I A;  1COW D;  5HXF A;  3GIC B;  1YOA A;  5K0H A;  4K1T A;  4XE4 A;  1IQL A;  1YLC A;  2UWO A;  3AW0 A;  1VGC B;  2G52 A;  4I7Y H;  4CR9 A;  4NZQ A;  1XUK A;  4FET A;  1NRG A;  1OOK B;  2J97 A;  4AG2 A;  3KNX A;  1HAZ B;  2UWP A;  3RC4 A;  1F0U A;  3BTH E;  1BRB E;  2GCT C;  3U1I B;  1H8E D;  1K1O A;  2WHX A;  4AGK A;  3PTB A;  8GCH G;  2IG6 A;  3E91 A;  4TY6 A;  3ZOE A;  2CV3 A;  1WQV H;  1TON A;  3UWI A;  1TBR H;  1SQR A;  1N1L A;  1TAB E;  4P00 A;  1GBK A;  2ZDN A;  2FP7 B;  2RDE A;  2J5U A;  3M5M A;  4ZHL U;  1EP5 A;  4HTC H;  1KSN A;  2VWO A;  1LKA A;  1GCD A;  1K28 D;  1SB1 H;  2A5K A;  2O8T A;  2ZP0 H;  1VKY A;  3AVZ A;  1DT2 A;  4ZMA H;  3BTT E;  1RRK A;  1C1R A;  1KXD A;  2C3S A;  4A6L A;  3UUZ A;  4YOI A;  4ABG A;  1CGJ E;  1JRT A;  5EQR A;  2D5M A;  4ISL A;  1C2G A;  4B2B A;  4D7F A;  1HDT H;  2BXU H;  2Q6F A;  2VJ1 A;  5E2O A;  2ZFT A;  2XNI A;  4Z0K A;  2D37 A;  3LC3 A;  3GOV B;  4X8V H;  1BZX E;  1A7S A;  3E3T A;  3M7U A;  3VB3 A;  2FX6 A;  1OSS A;  1ANB A;  1ARB A;  1SHY A;  1O2N A;  3URD A;  3EDX B;  1HAV B;  6GCH F;  1GDQ A;  3KN2 A;  1HLT H;  3BNK A;  1L1G A;  1GHX H;  4WY3 A;  2CGA A;  1J8A A;  2V7Q D;  5AHG H;  2ARZ A;  1EZU C;  4IN2 A;  4BTU B;  4GHT A;  4OS6 A;  2Z9J A;  1Z71 A;  4UFD H;  1A3E H;  3R0F A;  2AGI X;  4B71 A;  4MG3 A;  3T27 A;  2A4R A;  4LOY H;  3VB5 A;  1O3B A;  2A7H A;  2V3M A;  5FHT A;  3U34 A;  1SGN E;  1AO5 A;  2BDI A;  2SGE E;  3A86 A;  3ATM A;  1AFQ B;  1BMM H;  4FUC A;  1QGF A;  4NWK A;  4FUE A;  3E0N B;  1LQE A;  5FPT A;  3QN7 A;  4D9Q A;  1HAP H;  1O2S A;  1UK2 A;  2XRC A;  2YNA A;  3PFT A;  7KME H;  4UFF H;  3K87 A;  1FON A;  1HCG A;  1QQU A;  5KED A;  1AE5 A;  3H7T A;  3OTJ E;  1EPT B;  2ZTX A;  5AFY H;  3QTV H;  3TH3 H;  2OP9 A;  1QR3 E;  1G30 B;  1TNJ A;  1YPK H;  3TIT A;  1FIW A;  5J4Q A;  4X6M A;  2GMT C;  1K1P A;  1KTT B;  4MPW A;  1O2I A;  2QXJ A;  4YOG A;  1ELF A;  3LH3 A;  3RXI A;  5DP5 A;  1GI6 A;  1NBM E;  1GI9 B;  3GCH B;  2VWM A;  1UTK A;  3N7O A;  1NPM A;  1ZHR A;  1W11 U;  2A4Q A;  1YM0 A;  1CT4 E;  1SGY E;  5H4I B;  4VGC B;  4Y9I A;  1C1W H;  2D36 A;  2J38 A;  1TLD A;  1Z8R A;  3ZOF A;  1AI8 H;  1ID5 H;  2GP9 B;  4IW4 E;  1A0J A;  1G78 A;  4HMU A;  5CHO A;  3A8A A;  2WPM S;  2EA3 A;  1ABJ H;  1IQH A;  4GPG A;  4BTI B;  1TPO A;  1VCQ A;  3ZV8 A;  1E79 D;  1UK4 A;  2IPH A;  5FPY A;  1PPH E;  1ZR0 A;  2B8O H;  2BM2 A;  3SUG A;  3EST A;  3VG8 A;  5C0U A;  5IYT A;  4MNY A;  1C1T A;  1LDT T;  1W3P A;  1VZQ H;  2J2U A;  2WPI S;  4Y8Y A;  3DFJ A;  2VID A;  5F8Z A;  2SGQ E;  3EQ0 H;  3UOP A;  5F03 A;  3Q76 A;  3UIR A;  2XTT B;  4QVB A;  2HQ7 A;  4E05 H;  3MNB A;  4XHY A;  4MNW A;  2HNT E;  2ZC9 H;  2C4F H;  3MO3 A;  3PO1 C;  1I0S A;  2R2M B;  1GBI A;  1C1V H;  2VBC A;  1HXE H;  3U8R H;  3SJ8 A;  3K88 A;  2UUF B;  3D49 H;  1NO9 H;  1GDN A;  4D9R A;  1FXY A;  1CQQ A;  2O9Q A;  1OHH D;  3U1J B;  1QY6 A;  1LVY A;  2ZCK P;  3MOC A;  4K8Y A;  1NT1 A;  5GCH F;  3BG8 A;  1KDQ A;  1O2Z A;  1LHE H;  5AVD A;  3QUM P;  1F5L A;  2NU3 E;  2ZGX H;  1SGE E;  1XUG A;  4CRB A;  4ABA A;  5F6M A;  1JIM A;  3ATI A;  3C1K A;  3PYH A;  1SFI A;  7EST E;  2TIO A;  3LGY A;  4Q2K A;  1AIX H;  1W13 U;  2XBX A;  2AEI H;  3BSQ A;  3P17 H;  2GTB A;  5HM9 A;  1C1N A;  2Y80 A;  1LHF H;  3ZVB A;  5EJZ A;  1G9I E;  2EQN A;  1N8O B;  1O3E A;  1Y3X A;  3BEF B;  1GJ8 B;  2H9H A;  2PR3 A;  3MH4 A;  3ZOG A;  1E0F D;  2ZNK H;  2L6O A;  1QJ6 B;  4DG4 A;  4I8G A;  2C93 B;  3LOX A;  5AFZ H;  1MZA A;  3AMF A;  3NRL A;  1FN8 A;  2AMP A;  3GDU A;  3MWI U;  3ITI A;  5T6F A;  1ZPC A;  2FHQ A;  1UCY E;  3F9H A;  3M35 A;  1USC A;  1DS2 E;  1TGT A;  2PW8 H;  2SGP E;  3U35 A;  5HMA A;  1MTN B;  2KCO A;  1YPM H;  1DXP A;  2SGF E;  3DSG A;  1YPE H;  1P57 B;  2AFQ B;  1THS H;  5HGG A;  3BTQ E;  4AB8 A;  1L4Z A;  4CH8 B;  5HKK D;  1UTL M;  2NWN A;  1JOU B;  1W3C A;  2R3Y A;  5B6O A;  3ZVC A;  2JH6 D;  1ELG A;  3CB0 A;  1BT7 A;  2DE9 A;  2NU1 E;  2QE7 D;  1GJA B;  3M7Q A;  1C2L A;  2HOB A;  2WV4 A;  5C1Y A;  1WQS A;  1SFQ B;  2CF9 H;  4DGJ A;  2Y81 A;  5FX6 A;  2R2W U;  1MTV A;  1LPK B;  3ZOH A;  1V2V T;  2A5A A;  4HMW A;  1MKW K;  1ZSJ A;  5PTP A;  1DVA H;  1P2J A;  2YMS D;  4NA9 H;  2BDA A;  2P8O C;  3UQV A;  2ODY B;  1D4P B;  1J14 A;  3M3T A;  4FUD A;  4R0I A;  3E0P B;  2BY9 X;  3FFG A;  1UTP A;  1HAH H;  5CHA B;  3SU3 A;  3KL6 A;  3K2U A;  1A61 H;  1CGH A;  1DM4 B;  5KGO A;  1T32 A;  3UY9 A;  5JBB S;  4U30 A;  1GJ6 A;  1Z1J A;  2ULL A;  2GJG A;  3PLK A;  4I8K A;  3TIU A;  3V13 A;  2J9N A;  2ZA5 A;  5GCH G;  2J34 A;  3TH4 H;  1DE7 H;  5L6N H;  2Z9K A;  3KID U;  4OGY A;  2JET C;  2BX4 A;  2P3T B;  2BD9 A;  2WV9 A;  1C1S A;  1DFP A;  3SJK A;  1ELV A;  4ZUH A;  1O2M A;  2HLD D;  3PV4 A;  1SQO A;  1K1N A;  3TK5 A;  1G3C A;  5DP8 A;  2W7S A;  1TMT H;  1QZ8 A;  5DP9 A;  3MO6 A;  2A4O A;  3T2N A;  3KGP A;  4XBB A;  3FP6 E;  3GY7 A;  1BHX B;  1EZX C;  1QL7 A;  1EFR D;  3OAA D;  1MAX A;  4DJZ B;  5ESB A;  3RXS A;  1QBO A;  1SQA A;  1W0Y H;  1ZZZ A;  1G3E A;  3R3G B;  4X8S H;  2E83 A;  3O8R A;  1GBM A;  1CE5 A;  1TA2 A;  3AWH A;  6LPR A;  3GCT F;  1ZJD A;  2QF5 A;  2OCV B;  2ZZU H;  3HAT H;  2AQ6 A;  1QJ7 B;  1AWF H;  1O30 A;  4Z1M D;  3UR6 A;  4X0W U;  2BZ6 H;  2UWL A;  1AMH A;  4F4O C;  1AKS A;  3LU9 B;  1SOT A;  3NCL A;  2AH4 X;  3LH1 A;  1F92 A;  2R0X A;  1BBR E;  3PM3 A;  3VGC B;  4ASU D;  1C2J A;  3BA3 A;  1A3B H;  1S83 A;  1BML A;  3A7Z A;  5DKM A;  1C2I A;  5EU8 A;  2CK3 D;  2FOF A;  1O2G H;  4FXG H;  3RMM H;  2Q6G A;  1Y5B T;  1P09 A;  1T8M A;  2Y7X A;  2QC2 A;  4MTB A;  4AN7 A;  4LZ1 H;  2CHA C;  3MU1 A;  4K8B A;  1FDP A;  2Q9K A;  2FUR A;  3Q3Y A;  1SPJ A;  2FLB H;  2G4U A;  1GMH F;  4I31 A;  4AOR A;  1C5L H;  1EAS A;  1NU7 B;  2F9U A;  1PQ8 A;  3AAV A;  3LGV A;  5FX5 A;  4Y7B A;  1YGC H;  3M5N A;  1QQ4 A;  3A7W A;  3SU5 A;  3A84 A;  2BB4 A;  1O36 A;  2ZFP H;  1OKX A;  3H09 A;  3LGW A;  3MU0 A;  1OWI A;  1K1I A;  1MCV A;  2OLG A;  3O8D A;  1XUJ A;  1A0H B;  1VIT F;  1GL1 A;  2JDI D;  3E4V A;  2XC0 A;  2ZEC A;  3FZD A;  3SU0 A;  1KDQ B;  4CH2 B;  2OTV A;  2FEQ H;  2I6Q A;  4JZE H;  5EPN A;  1TFX A;  1GMD F;  3BTM E;  3RXT A;  3CS7 A;  1FY5 A;  3SOS A;  1BTU A;  3A7T A;  1GGD B;  3VXE H;  4KP0 A;  3VB6 A;  4AB9 A;  2LP6 A;  1HAY B;  1V2S T;  3T5F H;  4Y8Z A;  2GCH F;  2G55 A;  3LGU A;  5JB8 S;  2ED4 A;  1FIZ A;  2J98 B;  4BAH B;  2HTI A;  1WAY B;  3SGQ E;  2OC7 A;  3F2F A;  1FY8 E;  3UWJ H;  2V35 A;  3A7X A;  1WBG B;  1O3C A;  1YPH C;  3F9G A;  4FOU C;  2PP6 A;  3ZZ4 A;  1DPO A;  2TPI Z;  2ZWL H;  3QTO H;  3RC5 A;  2F9V A;  3TJN A;  1MD8 A;  1KTS B;  4MVN A;  1JBU H;  1HAV A;  3Q77 A;  1Y3V A;  3UFA A;  3P70 B;  2IPQ X;  2Y5G A;  1AZ8 A;  2A5I A;  3TGI E;  2BD5 A;  4Y71 A;  1O3J A;  4Q7Y A;  2ZHE H;  3GCT G;  4IMZ A;  3BG4 B;  1CA0 C;  3A7V A;  1O2Q A;  2PTN A;  1EQ9 A;  4HMS A;  2GGV B;  4XBC A;  4M7G A;  2SFA A;  3NK8 A;  4BNR A;  2OQU A;  1UTO A;  4INH A;  4YXW D;  3BIU H;  3UPE A;  4TSF D;  4FUJ A;  3RXM A;  1UO6 A;  1USF A;  2WSS D;  1MTW A;  2A2X H;  4X6O A;  2UUY A;  2TGA A;  1D6R A;  2F9O A;  3F9F A;  4AYV B;  2CMY A;  1SGC A;  1BHX F;  4TT3 D;  1RFE A;  1C4U 2;  1F0R A;  1D6W A;  1EPT A;  1BTW A;  2JH0 D;  4WME A;  1YC0 A;  5HIZ A;  3KCG H;  1G3D A;  3KEE A;  3EAA A;  2P59 A;  3KYG A;  2ZDL A;  3MNS A;  4BXS A;  1HUT H;  2WUC A;  3A87 A;  2G4T A;  1GMH G;  2ZU3 A;  1W0K D;  3OEE D;  3L33 A;  3LGI A;  3RH7 A;  3P6Z B;  3TJU A;  1A0L A;  2P94 A;  1ACB E;  5EXM A;  4I8H A;  2D8W A;  4KGA A;  2HLC A;  2VVC A;  1MCT A;  1G79 A;  1TNL A;  3TVJ B;  4YBN A;  1VCP A;  4FUB A;  1OPH B;  1VIT G;  2BMG B;  5EPY A;  2BY5 X;  1BTP A;  1EAU A;  2GV6 A;  3OX7 U;  1GMD G;  1HJA B;  2TRM A;  3O8C A;  5JAB A;  1QL9 A;  4W64 A;  4MPU A;  5FCK A;  1NFX A;  1W10 U;  1GDU A;  1NRN H;  3SWJ A;  1C5U A;  2GCH G;  4NA7 A;  1PFX C;  1EOL A;  4X1N U;  3QZR A;  3S9A A;  2HGT H;  3DD2 H;  2XXL A;  3RXC A;  3RXH A;  1HAO H;  5DSF A;  1AND A;  1BTZ A;  3R5R A;  4D76 A;  3KQB A;  1UVP A;  1YBW A;  2Z3D A;  2W6J D;  5JBA S;  3L6P A;  2BXT H;  5A2M H;  1ESA A;  3F68 H;  1LVO A;  5EW1 H;  2NU2 E;  1C5N H;  1J9C H;  2QEA A;  3HKI B;  2ECR A;  3A20 A;  3R5Y A;  3VEQ B;  1RIW C;  2VWN A;  1AB9 B;  4B2C A;  4YO9 A;  4AYY B;  2LPR A;  4JZ1 A;  4A1T A;  5A0C A;  3GYM A;  2D1J A;  1O5A B;  2HNT F;  1QBV H;  1C5Q A;  8LPR A;  1C5X B;  1JNW A;  4ABI A;  1F2S E;  1P2O A;  1GBH A;  4JYV H;  4NWL A;  1G2L A;  4DUR A;  1EZQ A;  1GI2 A;  1BQY A;  2Y5H A;  3EAJ A;  2VPA A;  1O32 A;  3PMB B;  1O3I A;  4ABE A;  1MH0 A;  1D3Q B;  2ALV A;  1TRN A;  1WUN H;  4DII H;  4O9V A;  1WLK A;  1LHD H;  1O2T A;  3ZZC A;  1SGI B;  4IC5 A;  4Y76 A;  2IOT A;  1TRY A;  1P3E A;  4NA8 A;  5EOK A;  1M9U A;  2IJD 1;  1WTG H;  2M5T A;  4DT7 B;  2G51 A;  3NKK A;  2P5Z X;  1O2P A;  3SGA E;  1TOM H;  3ZZ6 A;  2BVR H;  3ZOD A;  2Y5F A;  4BAQ B;  5C20 A;  2VB0 A;  1HFD A;  2FDA A;  1SGF G;  1BA8 B;  4Y11 E;  1L1J A;  1V6D A;  1FAX A;  5C5O A;  3ZOC A;  2KZ4 A;  3BEU A;  2VGC B;  5GND A;  2BDG A;  3URC A;  1C5W B;  4HMX A;  2BD4 A;  4BXW A;  3KQD A;  1GHZ A;  3LGT A;  4CHA C;  1NFY A;  5EG4 A;  5J4S A;  1YKT A;  2IAB A;  1TQ7 B;  2RA3 A;  3QWC H;  1P2Q A;  1SLV B;  1O2X A;  3TNT A;  5HYO A;  2KFW A;  3V4H A;  1Z8G A;  2NU4 E;  1HAI H;  3NPS A;  2QF3 A;  1C4V 2;  3MU8 A;  2QV1 A;  2AHM E;  5DJ7 A;  1IHT H;  4SGA E;  1C1U H;  1EKB B;  1O5C B;  2ZHW H;  3M3S A;  2FX4 A;  1GI0 A;  3V12 A;  2QGR A;  1O3P B;  3U28 C;  1V2P T;  1FY3 A;  3RXV A;  1TNH A;  3A8B A;  2A0Q B;  1DY8 A;  1JMO H;  1YYY 1;  4X1R U;  3GY5 A;  1EP6 A;  1E38 B;  1W7X H;  3LON A;  2ZDV H;  1FAK H;  3WWB A;  2Z7F E;  4O3T A;  1HAX B;  2G00 A;  1AFQ C;  3ZZ7 A;  1DIC A;  2FES H;  1NS3 A;  5A8X A;  4CRA A;  3NUM A;  2EI7 A;  2P16 A;  2ZGC A;  2WPK S;  2QAA A;  2Z9G A;  4IBL H;  4TWW A;  4Y7A A;  3IG6 B;  1FPC H;  4IMQ A;  5E2P A;  1ZML A;  2ECU A;  2R0L A;  1TOC B;  3UAI C;  2FI4 E;  2ZG0 H;  3PRO A;  3ZYD A;  2FO9 A;  1UCY K;  3UNS A;  1F0T A;  3FO8 D;  2FTM A;  3D62 A;  3SU2 A;  1QNJ A;  2XC4 A;  3U5W A;  1TX8 A;  2PTC E;  1SG8 B;  1O5F H;  1WXR A;  2ZI2 H;  1PQ7 A;  4Q80 A;  4LZ4 B;  1P9S A;  1YPL H;  2XWB I;  4WH6 A;  2RG3 A;  1FLE E;  1V2N T;  1VJ9 U;  3FN8 A;  1BB0 B;  3GCH C;  1SGR E;  4OS4 A;  4NIY A;  3RM2 H;  1UK3 A;  1PPG E;  2TBS A;  3RM0 H;  4DW2 U;  1QFK H;  2ZPR A;  2A31 A;  1CHO F;  1AD8 H;  1SKY E;  4H6S B;  1T31 A;  1O3D A;  2ZTY A;  1J16 A;  1SGT A;  4ZKR U;  1T8N A;  3UB0 A;  1FUJ A;  1F7Z A;  1YCP H;  1E36 B;  3SNC A;  2HAL A;  2A7J A;  5C2Z A;  3V3M A;  3SJO A;  4B1T A;  3EE0 B;  3EA7 A;  4WJG 2;  2YMS C;  3W94 A;  1WDI A;  4MTK A;  4QT8 C;  2PLX A;  1SGF A;  2BLQ A;  3B23 B;  1O33 A;  4FUF A;  1BTH H;  1V2Q T;  4JYT A;  1VCW A;  2XC5 A;  2BX3 A;  2GMT B;  3VY2 A;  1RGQ A;  2VH0 A;  1BMA A;  4NFE A;  3SJ9 A;  5LPR A;  1ZSL A;  1MU8 B;  3GCN A;  1CVW H;  3PV2 A;  4B74 A;  3VB7 A;  4HKH A;  1YPG H;  4Y0Y E;  4NIX A;  1KLT A;  1UMA H;  4FU7 A;  4ZH8 A;  4NIW A;  1A5I A;  2XCN A;  9LPR A;  1D3P B;  1TGB A;  3TJO A;  1H9I E;  5A8Z A;  1V2U T;  2QXI A;  4XSK U;  4YTA A;  2OQ5 A;  3DT0 H;  4Q7X A;  2Z94 A;  1PPB H;  1DDJ A;  4E06 H;  3BEI B;  1ZPZ A;  2J95 A;  1SR5 C;  3P8G A;  1FV9 A;  2W26 A;  3QGN B;  2V3O H;  2FG9 A;  4X2W A;  1YLD A;  5BNC A;  1TB6 H;  3PRB A;  4AFS A;  1Q3X A;  3K86 A;  2ZFR H;  3W1E A;  1ZLR A;  3W95 A;  1ZMJ A;  4ACB A;  5GJ4 B;  1C5P A;  1N6Y A;  2TGT A;  5A0B A;  1SMF E;  3F0O A;  1FQ3 A;  1ANE A;  2BY6 X;  4CBO A;  5F8X A;  2EC9 H;  2XND D;  3OY6 U;  3HPT B;  4INK A;  1E37 B;  4NGA H;  4X1P U;  4Z6A H;  2G8T A;  1EUF A;  2BDB A;  1N8O C;  4K1E A;  3RLW H;  1P0S H;  3H7O A;  1I0R A;  4XJ2 A;  1TGN A;  3HMZ A;  2D2D A;  4FU9 A;  4XOJ A;  3BTE E;  5DP7 A;  4XRN A;  1Z8I B;  4BAM B;  3IN6 A;  1ZGV A;  1N6X A;  5DN6 D;  1SGD E;  1RTL A;  2J98 A;  3ATL A;  1BBR K;  2EST E;  3KQC A;  4X6N A;  2ZGB H;  1Y5U T;  3QGJ A;  1C5V A;  3EE7 A;  1YWU A;  1W3Q A;  2XW9 A;  1MTN C;  2H2Z A;  3SZN A;  1O3G A;  1JIR A;  2FPZ A;  2ZU4 A;  4WXV A;  1GVL A;  5ABW A;  5HM2 A;  3TU7 H;  1P2I A;  1CHO G;  2BQ6 B;  2QXG A;  3SHC H;  3TK6 A;  4B76 A;  1L4D A;  1A5G H;  2B7D H;  5GWZ A;  2ZDA H;  4CR5 A;  3A88 A;  3NZI A;  3F0P A;  1X7A C;  5C3N A;  3L3T A;  2GD4 B;  5B6L A;  1LQD B;  3SGB E;  2RA0 A;  1AHT H;  1K0H A;  1UCY H;  2XCF A;  4NSY A;  3BF6 H;  2ANY A;  3FKS D;  2PKS B;  1D3D B;  4ABD A;  1MAY A;  2PGQ B;  3LKW A;  3VFE A;  4B6E A;  3R5Z A;  3FP8 E;  4K69 A;  1XMN B;  1GVK B;  1OYT H;  4X6P A;  4ABF A;  2BDH A;  5CDF E;  4MDS A;  1DWB H;  2WPL S;  1ZSK A;  2BLV A;  4B73 A;  2BD7 A;  4UDW H;  1Z6E A;  2QCK A;  5C0T A;  1C1P A;  3TGJ E;  3T29 A;  4A1V A;  1OS8 A;  5CHA C;  1LHG H;  1L1N A;  1TMB H;  3OFN D;  2ANW A;  2OC1 A;  1TWX B;  6CHA B;  4Q4L A;  4RI0 A;  1P9U A;  1T8L A;  2EI8 A;  1C4Y 2;  2OBQ A;  4EST E;  2UUK B;  1TE0 A;  3UTU H;  1AQ7 A;  1GPZ A;  2QY0 B;  3HKJ B;  4Z85 A;  1BJU A;  1PQ5 A;  3BTW E;  1K1L A;  1H8I H;  5BRR E;  2Q1J A;  2OK5 A;  3SV8 A;  1GHW H;  4Q63 A;  2FMJ A;  2Y7Z A;  3T62 A;  2BVS H;  4L82 A;  1C2H A;  1MBM A;  1KY9 A;  1P12 E;  1HBT H;  2ANK H;  1HAG E;  1GBC A;  3A85 A;  3SBK A;  3V0X A;  2P8O B;  1KXE A;  1OX1 A;  2XBW A;  1DST A;  1GG6 C;  1S5S A;  1S84 A;  3RXL A;  4ZCN A;  4Y10 E;  1PPE E;  3EA8 A;  2AGE X;  1SSX A;  3ZZ5 A;  3EC6 A;  2ZF0 H;  5EGM A;  1ZYO A;  1MBQ A;  2XOK D;  4NFF A;  2TGP Z;  8KME 2;  1P3C A;  2GV7 A;  2O8L A;  3QK1 A;  3RU4 D;  5TCA A;  3FKH A;  3PMH B;  1P2M A;  1C5S A;  4A92 A;  3AAU A;  3Q00 A;  1FI8 A;  4UON A;  3JZ1 B;  4WXI A;  1QCP A;  3LC5 A;  2HTD A;  1Q2W A;  3B9F H;  1DX5 M;  2FOC A;  4I8J A;  1D3T B;  4ZAE A;  3AK5 A;  1T4V H;  3VGC C;  3MNX A;  3SJI A;  1Y12 A;  2ZHQ H;  1ZTJ A;  2BLW A;  3OYP A;  3SV6 A;  1C2F A;  1FJS A;  3A82 A;  1XXO A;  3K6Y A;  4B2A A;  3EYD A;  4XD7 D;  3LPR A;  3SYJ A;  3CP3 A;  3NWU A;  1WOF A;  2BQ7 B;  1YPJ H;  3OE7 D;  1O2O A;  1OP0 A;  1OYQ A;  2W6I D;  2ZCH P;  3MU5 A;  3M3V A;  1EAW A;  5I25 A;  5DK1 A;  1IQM A;  1Y59 T;  3AW1 A;  4RT0 A;  2FYQ A;  4ZHA A;  1Z6J H;  5L30 H;  2Z3E A;  3QO6 A;  3URE A;  4BTT B;  3M5O A;  5LPF A;  1T8O A;  2RDL A;  3SU4 A;  1ZHM A;  4GUX A;  1O38 A;  4RKJ B;  1MQ6 A;  2HQ9 A;  3I78 A;  1ORF A;  1HNE E;  3VY5 A;  1O35 A;  3HK6 B;  1EOJ A;  4ZXY H;  2OIN A;  1GHB G;  2RE7 A;  1RS0 A;  2ZPS A;  2ZDK A;  3U8O H;  2V3H H;  3ZZ8 A;  2CXV A;  4NCY A;  1ARC A;  1NFU A;  4JZD H;  1GGD C;  3F2G A;  3ZZD A;  2HNT C;  2LEL A;  1QRW A;  3A83 A;  2BVX H;  2XBV A;  5DGJ A;  2QCY A;  5FBI A;  3TH2 H;  3TGK E;  2HHZ A;  2K4Q A;  4BAK B;  1SHH B;  5DPA A;  1CSO E;  4X2Y A;  3DHK H;  4H42 U;  1DWE H;  2CHA B;  2VIO A;  2P3U B;  3BPK A;  3UOU A;  1MZD A;  3A81 A;  1G77 A;  2IJO B;  1UJ1 A;  3FGE A;  3MFJ A;  1H8H D;  3BTF E;  3N99 A;  2C8W B;  4YES B;  1TYN A;  4ZKS U;  1SBW A;  2ZDM A;  4OGX A;  3V7T A;  1CBW C;  3GCO A;  2KAI B;  3S0N A;  2BD3 A;  3DUX H;  1MU6 B;  2OXS A;  1LMW B;  3F3B A;  5DP3 A;  2B5T B;  4K60 A;  1JRS A;  4K5Z A;  1KMH B;  3U98 H;  1F5R A;  3UNQ A;  1MKW H;  1NN6 A;  1CI0 A;  1OWE A;  1SLW B;  1VL7 A;  2O8W A;  2VNT A;  2QN5 T;  1ESB A;  1XVM A;  2W3K A;  5AF9 H;  3OU0 A;  1UVU H;  2PV9 B;  4J1Y A;  2AMD A;  1A2C H;  1DY9 A;  3SOR A;  1V2M T;  1L0Z A;  1AUJ A;  1BIT A;  3SV7 A;  3ODD A;  1EST A;  1TA6 A;  4YT7 H;  1OP8 A;  2NR4 A;  3F7E A;  1AVW A;  1H4W A;  1FPH H;  1FN6 A;  3F2H A;  2OC8 A;  3CS0 A;  1KLI H;  5G4B A;  1OWJ A;  1GI1 A;  2D26 C;  1QA0 A;  2A2Q H;  2G5V A;  5F8T A;  5LPE A;  1TRM A;  2VU8 E;  6EST A;  2EI6 A;  3H96 A;  1T9M A;  1SLX B;  1P11 E;  1GBF A;  4AFQ A;  4OM9 A;  3KQE A;  2L74 A;  4KTS A;  1XKA C;  3ZZ9 A;  1EB2 A;  3TJV A;  4M9F A;  1NBM D;  1TBZ H;  1CA0 B;  3RXR A;  3GY6 A;  1QRZ A;  2FZZ A;  2WIN I;  2R3U A;  3LT3 A;  1IAU A;  2QF4 A;  2STA E;  1AY6 H;  4DT4 A;  5T1V A;  3GYL B;  2FTL E;  4CRF A;  2FS9 A;  4K1S A;  1O3N A;  1ELT A;  4CRG A;  1QRX A;  3QLP H;  1K22 H;  1SGQ E;  3M7T A;  4WH8 A;  3QZQ A;  3K65 B;  5DP6 A;  4DCD A;  3IIT A;  2FI3 E;  3MQK C;  1XXF A;  2ZEB A;  4WF8 A;  2GKV E;  9EST A;  5JBT A;  4ISN A;  3G01 A;  2ZPQ A;  3BTG E;  2FOM B;  3CNR A;  3WW7 A;  2XBY A;  4NZL A;  3KYF A;  2GZ7 A;  1JXP A;  3ZZB A;  3RC6 A;  3SHA H;  2WPJ S;  1GHA F;  2STB E;  5JB9 S;  1V3X A;  2M2A A;  4GAW A;  4X2X A;  3GAS A;  2F9B H;  2GT8 A;  2P95 A;  1KXB A;  1ETS H;  2A4G A;  2UUJ B;  1LVM A;  4R8T B;  4UHV A;  4K3J A;  4JMY A;  1GBE A;  1PYT C;  5EQS A;  3GIS B;  1K21 H;  3IWM A;  2H5D A;  1DSU A;  1RTK A;  1Y3W A;  4ZXX H;  5DO4 H;  4ABH A;  1AB9 C;  1H8D H;  2ASU B;  1C2E A;  5JPM H;  4DIH H;  5E0J A;  2HVY B;  1O2U A;  1Y30 A;  2HPQ H;  3GY2 A;  3ZZA A;  2DE8 A;  2ZTZ A;  1DWC H;  1TNK A;  2C8X B;  4XFQ A;  5E0G A;  1O2W A;  1EX3 A;  1MD7 A;  3OY5 U;  1TBQ H;  5EIY A;  2VIV A;  1GJC B;  1ETR H;  3JZ2 B;  1XXD A;  3WWF A;  1O3M A;  5T6G A;  3ZVG A;  3ZIA D;  2D38 A;  1GCT B;  2A7C A;  1W0J D;  2G5N A;  1VGC C;  3LJO A;  4A5T S;  5LH8 A;  2F9N A;  2Q6D A;  3WY8 A;  1O3O A;  3DB0 A;  2QA9 E;  3PMA B;  3NXP A;  1F5K U;  3ZVF A;  4KKD A;  1FMG A;  5FCR A;  1YF4 A;  1UTQ A;  1V2R T;  4MNV A;  3DNH A;  1INC A;  2BOK A;  5EJ1 A;  4AOQ A;  2F43 B;  1WV7 H;  2DUC A;  2THF B;  2F4L A;  1GJD B;  2RFK C;  4J2Y B;  3U9A H;  1GL0 E;  1XUI A;  1GBD A;  5CHE C;  4H6T A;  2BOH B;  1LPG B;  1PPF E;  2H5C A;  1S0R A;  2ZQ1 A;  3U0I A;  1C1M A;  4UEH H;  1CO7 E;  4Y79 A;  2VGC C;  2R9P A;  4O97 A;  1K1M A;  2O8U A;  1L2E A;  4OS1 A;  4DY7 B;  3RXE A;  4GLY A;  3DFL A;  1NRQ H;  1S81 A;  2AER H;  1ZOM A;  2VH6 A;  1VIT H;  2J92 A;  5CHB A;  1BRA A;  2PWX A;  1ZHP A;  2ZFF H;  1GVZ A;  4ZRO A;  1DIT H;  4FUG A;  1BJV A;  1UW7 A;  3RUO A;  4HI3 A;  4CRC A;  3SO3 A;  2FOG A;  3SQE E;  3RP2 A;  1ELB A;  2K8I A;  4JCN A;  1K2I 1;  1P02 A;  2VIN A;  3SNA A;  5L2Y H;  1RZ0 A;  1HRT H;  2GCT B;  2PKA B;  5FBE A;  1GHA G;  3FOA A;  4GHQ A;  1GBL A;  3OSY A;  1J15 A;  2OD3 B;  2F9P A;  1EJM A;  2OC0 A;  4KTC A;  1RFN A;  3M36 A;  3PB1 E;  4YZU A;  1PPZ A;  2R0K A;  5SGA E;  4IN1 A;  1CGI E;  3NFW A;  4OS7 A;  2VVV A;  5EW2 H;  1AFE H;  3AAS A;  2WPD D;  2FI5 E;  1UTN A;  1IOE A;  1C2M A;  2A32 A;  4CHA B;  2CJI A;  1LKB A;  1O2L A;  1E34 B;  1QJ1 B;  3P92 A;  1O39 A;  4GVU A;  2ODP A;  1WSS H;  1ZJK A;  1XVO A;  4HFP B;  1TNG A;  1Y5A T;  1FX0 B;  1P05 A;  4D8N A;  4ZHM U;  2B0F A;  2I6S A;  2VIP A;  4HG6 A;  5FXL A;  5C17 A;  1PYT D;  2ZU1 A;  1EPT C;  2EY4 C;  3MI4 A;  5BPE A;  1RTF B;  2JIZ D;  4FUH A;  4BOH A;  1FZZ A;  1EJN A;  1P03 A;  1TX7 A;  5EST E;  3SV2 H;  2Z3C A;  2WZQ A;  3SN8 A;  2Y6T A;  1IQF A;  2GDE H;  3RXJ A;  1Y8T A;  1HJ8 A;  4ZKY A;  2QF0 A;  2HRV A;  1ZTK A;  1GI8 B;  3SW2 B;  1MTS A;  2C8Y B;  3MYW A;  3F1S B;  4VGC C;  1SC8 U;  2JJ2 D;  5KEC A;  4NSV A;  2ZIQ H;  3F9E A;  5LGO A;  2BDY A;  1KXA A;  1S85 A;  3BTD E;  3R5P A;  3SV9 A;  1O34 A;  2FOB A;  1NRS H;  4JK6 A;  4FVD A;  3GDV A;  1GJ9 B;  1XX9 A;  1XUH A;  3UR9 A;  2H6M A;  1BTY A;  2J94 A;  4ISO A;  5CMX H;  1T4U H;  4MNX A;  4YM9 A;  1QUR H;  3P8F A;  4MQA A;  1WV4 A;  5E8E H;  4B75 A;  4LXB H;  3BIV H;  4TWY A;  3MTY A;  1AVX A;  2P3F H;  1GJ7 B;  1ZMN A;  3RML H;  1HPG A;  5TCC A;  4ABB A;  3ZZ3 A;  2GDD A;  1GJ5 H;  4DOQ A;  1ZRK A;  2PHB A;  1NM6 A;  4O03 A;  3PV5 A;  1HYL A;  2OL5 A;  2RCE A;  1HJ9 A;  4MLF B;  4TV4 A;  1EJA A;  3BN9 A;  1RJX B;  2B9L A;  2CN0 H;  3I29 A;  3ZYE A;  5TJX A;  1P8V C;  2ANM H;  1SL3 A;  2YMS B;  3MH7 A;  1AVG H;  1A1R A;  1PQA A;  4P02 A;  4X1Q U;  2ZGH A;  3HE1 A;  2OUA A;  4OS5 A;  3SU1 A;  4Y0Z E;  2QYI A;  2K0Q A;  3A6R A;  1B7X B;  3DSO A;  3OEH D;  1SGP E;  1W3O A;  1O5G H;  4SGB E;  1G32 B;  1MAB B;  2GZ8 A;  3SZE A;  4AC9 A;  2CF8 H;  2KCA A;  5DP4 A;  5EXL A;  1GBB A;  4FUI A;  4I86 A;  1WU1 A;  2NU0 E;  1YLN A;  2ODQ A;  6GCH G;  3SNB A;  1DAN H;  1O3H A;  3ATW A;  4F48 B;  2ZU5 A;  1S0Q A;  4KTU A;  1KXF A;  2I51 A;  1ZPB A;  1FY4 A;  4RT1 A;  2L1T A;  4YLU A;  3DMB A;  5GDS H;  1OWH A;  3K9X B;  1O5B B;  3PO1 B;  3RXG A;  3U8T H;  2FXR A;  4OS2 A;  3RU4 T;  3LJJ A;  2GT7 A;  3PMJ A;  4X8U H;  3HK3 B;  4A7I B;  4K2Y A;  1TGC A;  1MKX K;  2Z9I A;  4I33 A;  4YOJ A;  2BYA X;  3HGP A;  1UVT H;  3CEN A;  4R82 A;  2KAI A;  2H9E H;  1FY1 A;  3B8J A;  4F07 A;  2R6V A;  1V2J T;  2H9T H;  4BAO B;  1WCZ A;  1XM1 A;  1OP2 A;  3PRD A;  1YPH E;  4Y6D A;  1O2Y A;  3A6Q A;  1H1B A;  1PPC E;  1TY9 A;  2FLR H;  5FPS A;  5C5N A;  5IK2 D;  4X8T H;  2FOD A;  1HIA A;  5C94 A;  5IDK A;  2C90 B;  3MNC A;  4UE7 H;  1FLM A;  1A46 H;  4UFE H;  3A7Y A;  1GMC F;  4PRO A;  1XHN A;  1IQI A;  1W3R A;  1K1J A;  1H9H E;  2PKS C;  4MPX A;  3RXP A;  3SUE A;  3TLO A;  1BRU P;  1NC6 A;  2GUJ A;  1TAL A;  2BY8 X;  3KF2 A;  1UTJ A;  1KLJ H;  1KIG H;  4ZKN U;  2HWL B;  2GX4 A;  5T6D A;  5CE1 A;  1P2K A; 
#chains in the Genus database with same CATH homology
 2HTI A;  2RE7 A;  1WV4 A;  3HY8 A;  1G76 A;  2ASF A;  2X1J A;  3PFT A;  3R5R A;  3K87 A;  2A2J A;  2FG9 A;  5KED A;  5BNC A;  3K86 A;  4FOU C;  3CNR A;  4Z85 A;  5EJZ A;  2QEA A;  2HHZ A;  2PTF A;  3KYF A;  2ECR A;  3A20 A;  3R5Y A;  1RZ0 A;  3R5W A;  1YOA A;  3ZOG A;  2OL5 A;  4L82 A;  2ECU A;  3BPK A;  3GAS A;  1G77 A;  3FGE A;  2E83 A;  3AMF A;  1EJE A;  1JNW A;  1NRG A;  1DNL A;  3AWH A;  4P02 A;  2FHQ A;  3NFW A;  1USC A;  3VYA A;  4HMS A;  1I0R A;  4XJ2 A;  3U35 A;  3A6R A;  3HMZ A;  2AQ6 A;  3EC6 A;  3U5W A;  2VPA A;  1CI0 A;  1WLI A;  2IG6 A;  4XRN A;  1VL7 A;  2OU5 A;  4Y9I A;  1W3O A;  3IN6 A;  3ZOE A;  2D36 A;  3DSG A;  4HMV A;  3ZOF A;  3B5M A;  2X1K A;  4P00 A;  1USF A;  1G78 A;  4HMU A;  4N7R C;  5CHO A;  1Y30 A;  1WLK A;  2RDE A;  3FKH A;  2R0X A;  4I86 A;  3BA3 A;  1YWU A;  1W3Q A;  5ESC A;  1YLN A;  4HG6 A;  4F48 B;  1RFE A;  3CB0 A;  2I51 A;  4RT1 A;  3DMB A;  4YWN A;  2HTD A;  2NR4 A;  5EIY A;  3F7E A;  1W3P A;  3KYG A;  3ZOD A;  2I02 A;  2D5M A;  2D38 A;  3TGV A;  2Q9K A;  2FUR A;  3ZOH A;  4HMW A;  1XXO A;  3DB0 A;  3RH7 A;  4ZKY A;  3ZOC A;  4QVB A;  4R82 A;  2HQ7 A;  2D37 A;  4IRA A;  2IML A;  1W9A A;  4F07 A;  2R6V A;  3CP3 A;  4XHY A;  4HX6 A;  3H96 A;  4HMX A;  1T9M A;  1G79 A;  1I0S A;  3R5Z A;  3DNH A;  4YBN A;  5EJ1 A;  3A6Q A;  3BNK A;  1TY9 A;  3K88 A;  2L74 A;  5KEC A;  2IAB A;  3VY2 A;  3E4V A;  4HMT A;  4RT0 A;  5KGO A;  2ARZ A;  5CHE C;  3U0I A;  1FLM A;  5JAB A;  1RZ1 A;  3R5P A;  1XHN A;  2GJG A;  1W3R A;  2QCK A;  5EJL A;  2HQ9 A;  3U34 A;  1WGB A;  1AXJ A;  3SWJ A;  3VY5 A;  3R5L A;  2ED4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...