2NR4A

Crystal structure of fmn-bound protein mm1853 from methanosarcina mazei, pfam duf447
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
192
structure length
191
Chain Sequence
b'DLSSFGIREGISEIIASTGFEHPNAAPIGIVMKGERPFVRLFKGSHTWENVLKEKCLASNVVYDPILFVRSTFSDLVPSEFEYVDGEFKFPVLKEAIAWVVFECINLRNTDQSLVADLVPLNAGFNERNIKELPVPNRGFNAVLEATVHATRYQLTGEEKYLELIRHYESLASKCGGDAEKKAMKLIYEAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved hypothetical protein
publication title Crystal structure of conserved FMN bound hypothetical protein from Methanosarcina mazei
rcsb
source organism Methanosarcina mazei
molecule tags Structural genomics, unknown function
total genus 54
structure length 191
sequence length 192
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04289 DUF447 Protein of unknown function (DUF447)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.290 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical membrane protein ta0354_69_121. 2nr4A02
2.30.110.10 Mainly Beta Roll Pnp Oxidase; Chain A Electron Transport, Fmn-binding Protein; Chain A 2nr4A01
2HTIA 3U5WA 4HX6A 4N7RC 2QCKA 3AWHA 2HQ9A 1XXOA 3EC6A 4HMUA 3BNKA 4HMSA 2VPAA 2ARZA 3U34A 1AXJA 3FKHA 3ZOHA 3VY2A 3PFTA 3IN6A 2I02A 1EJEA 3TGVA 5BNCA 1G76A 3F7EA 2QEAA 2E83A 3CB0A 4HMWA 3R5LA 2X1JA 3K87A 1CI0A 3KYFA 3VY5A 3U35A 4ZKYA 3A20A 4Z85A 1WGBA 3A6RA 2A2JA 4IRAA 3E4VA 3GASA 5CHEC 3K88A 3BPKA 2RE7A 1RZ1A 2IG6A 3ZOFA 1G79A 2D38A 3R5YA 4HMXA 3B5MA 1X9BA 4HMVA 1W3PA 1I0SA 1W3OA 2ED4A 1T9MA 2GJGA 1W3RA 3DNHA 1USFA 3AMFA 3R5PA 4XJ2A 2I51A 3RH7A 1G78A 3A6QA 5CHOA 2OL5A 1WLIA 2PTFA 1Y30A 4YBNA 2FG9A 4XHYA 1W3QA 4L82A 2NR4A 3K86A 2D5MA 3H96A 3U0IA 4R82A 1JNWA 3R5RA 1W9AA 2ASFA 4YWNA 3ZODA 2HTDA 3NFWA 3VYAA 2Q9KA 2RDEA 4HMTA 5ESCA 1XHNA 2IMLA 3R5ZA 4F07A 1G77A 3HY8A 4Y9IA 5JABA 2AQ6A 2FHQA 3DMBA 3ZOGA 2FURA 3ZOCA 2ECRA 3HMZA 1I0RA 3SWJA 1NRGA 2R0XA 1TY9A 3ZOEA 1YLNA 2D36A 2HQ7A 2HHZA 3CP3A 1DNLA 3R5WA 1VL7A 1YOAA 1WV4A 1FLMA 2IABA 2D37A 2X1KA 1USCA 2R6VA 2OU5A 2ECUA 1WLKA 3DB0A 3KYGA 3FGEA 1RZ0A 3BA3A 4QVBA 1RFEA
chains in the Genus database with same CATH superfamily
3R6NA 4X1KE 1ZKEA 2W62A 5LJNA 4U31A 1KK7A 3AA6B 2CBJA 3ONJA 1Y64B 2CRBA 4GKJT 2DCFA 4P0BA 3ZSSA 1G76A 3AVRA 2YEVC 3VKGA 1O3XA 4HMWA 5HEJA 3TLTA 2X1JA 4KI0F 2JQQA 4ZI2D 3AE1A 2BKPA 2LOSA 1WR0A 3ZMVB 3B5MA 4HFEA 2SPCA 2JMHA 4EOZB 4PFPA 3CVRA 2YK0A 1MMDA 3BQKA 4MFRA 3PURA 4JI6T 3CX7B 3NBXX 5ABGA 3OYXA 3QB5K 3RIUA 4QX8B 1QUUA 5FMNA 4ZI2C 2M6BA 1MNDA 3HY8A 4Y9IA 2W63A 3ZT7A 3MKDA 3ABVA 2VKOA 3C4XA 5AQOB 4LF7T 1US7B 3ANWA 3HMZA 4X1YE 1TY9A 2V8SV 1XMOT 2E9XC 3RIFA 4YT0A 2HHZA 3HA4A 1I94T 5FYMA 2ZM2A 2MYSA 2WMOA 4HFVA 5AQTB 5LMUT 4PJMA 5JR9B 1VOMA 3FZKB 1KFYA 1WRDA 3GN5A 5GONE 2LRLA 4O4IE 1XZYA 5L4HA 5IHYA 3UULA 1RFEA 4PK6A 3P4PA 5DABA 5FL1A 2HTIA 2X66A 3KV5A 3UU3A 2Q9QC 4GK0E 2N1GA 3MA9A 5KXJA 4C90A 3LFMA 3KV6A 4B3TT 4DR7T 3LK42 4UR9A 2IAKA 4JEHB 1W9RA 1E7PA 3S4UA 4JI7T 3N2KE 3FZMB 1MMAA 1E1HB 4XBFB 3K3NA 2X9XA 2YU2A 2DLRA 2V7IA 3R5YA 1X9BA 2CXFA 1I0SA 4IE4A 1W3RA 3ZJ1A 5AQHB 3OBVE 2KLQA 1HS7A 2CEAA 5F8PA 3I0QA 5HXCA 2ASFA 1Z8UA 3NRXA 3ZCIA 2WMNA 5ETWA 4UEMA 1KF6A 5C8YE 5FY7A 3C98B 4ZI7E 2DNXA 4TNWA 3P50A 3AXJB 2ECRA 2J4GA 5DQWA 1NRGA 2R0XA 3ZOEA 2WCAA 5JVDE 3E08A 3BK9A 4TWHA 1HFAA 4EV6A 3NRYA 3B57A 1M62A 4JEUB 4OHFA 4CZZB 3ONXA 3QC9A 4I43B 1IAPA 3CMLA 2ZM8A 2QCKA 3PUWF 4HMUA 3UU4A 2M6IA 4U74A 4ISSA 3LBXB 4H9QC 3C64A 3FKHA 4QH1A 2V6YA 4KX6A 2WP9A 4AKLA 4DMVA 3PFTA 5KX5E 4DV0T 3UT5E 3EHZA 1XNQT 2WDVA 3JCFA 4TUYE 1CI0A 2WY2A 2L9QA 3WAKA 5EK3A 5FY0A 2K48A 1HX1B 2A72A 3RHWA 3K88A 2DWKA 4EIWA 1NEKA 1G79A 5LMNT 2PFVA 2X9YA 4CI3B 4Q25A 2I51A 1FEWA 5JH7E 2XQ5A 4CQIA 4R82A 2WB5A 2XAQB 2LEHA 4HMTA 3R5ZA 4U3CA 5JDHA 2K4QA 3RF1A 4AKIA 3ZC0A 5E0OA 3PDYA 2WBLA 3DP7A 3UQ7A 3Q5WA 3EDVA 2JRKA 4M1PA 5HCMA 5J2UE 3IF8B 4A98A 1IBMT 1XDPA 3EDUA 2ODVA 5JDMA 4UV9B 3IHRA 2CMRA 1YD8G 4H9SE 5C2TA 2YKSA 5A1LA 4H9OC 3UU6A 4LFAT 5FVKA 3NZPA 3QUJA 2V7JA 2Z6EA 4JI4T 3EC6A 3A7MA 4JI2T 5LOVE 2DWGA 3UFGA 2UUCT 2V6XA 3P7IA 4ADZA 3UU8A 4ILAA 3AVSA 4YLHA 4BA9A 1GQEA 1LKXA 5IWAT 3P4RA 5LBQB 4HWFA 3RRWA 3BQLA 2BS2A 2LSYA 4UV8B 5ABHA 3T1YT 2K9AA 5AQLB 2KINB 4Z85A 4YHHT 3BQIA 3RRCA 4TNVA 3O1JA 3CIRA 2VKJA 2MBGA 2D38A 3VU7H 3ZT6A 2YDRA 3SFEA 4O4HE 1HNXT 4WBOA 3JC6C 4DMWA 5LG3A 1G78A 1Y30A 1N32T 4HFBA 2BG9E 5LGUB 4QX7B 4ZZCA 1UX4A 1UX5A 1ZHCA 4DR6T 5FL0A 2DHRA 3ZYMA 2XAGB 2CPTA 4X65T 3OJAA 3DMBA 3ZOGA 5F5WA 3JAFA 1S94A 4G2AA 2XTLA 4HGAA 5L47A 2D2SA 3I0OA 5J0ZA 2WWVA 3UQ4A 2X0LB 1VL7A 2VQET 1YOAA 2X1KA 4X5TA 2OU5A 2IUBA 2IC9A 4UELA 3OVUA 3L3PA 1J1JA 2WWUA 3HKBE 4CXWA 1BR0A 4QVBA 3ZYLA 5DQVA 3PUSA 4DR3T 4UF0B 1MMNA 4DV7T 3U78A 2V6YB 3ZT5A 3L8RA 5JRCA 3E22E 2LHNA 3ZOHA 1ZP0A 2I02A 3O1IA 5BNCA 3H3AA 2L8KA 3F7EA 2QEAA 4OFZA 2N2NA 3M65A 4ZKYA 2Q9QA 2X9HA 5JDGA 3LK2B 4DVDA 4OYKA 2RE7A 4PNIA 5LNKA 2W2UA 5LB7B 2ED4A 1CUNA 2EHOD 2ZM0A 4TX5A 4ZHQE 2BKNA 2W66A 2VVNA 4U7YA 5FXZA 2D5MA 3EVYA 3AAAB 4IHJE 3ZODA 4IDPA 3FBLA 5AFUL 1NAFA 1XHNA 1G77A 2JQHA 4OYJA 4ZS2A 5FVLA 2FHQA 3P4WA 5CB4E 4IL4A 2BG9B 2UUAT 3AEBA 4QH5A 5M4YA 2LKGA 2YU1A 2D36A 1X79A 1D1CA 1V9DA 5FY1A 2HN2A 3DB0A 3NWIA 3KV4A 2V7LA 1NENA 1T7SA 2UXCT 2UUBT 1B7TA 4X1IE 2LM9A 2RPAA 3U5WA 3HKCE 2CHOA 3AWHA 3KV9A 3ZC1A 2H3RA 4KHZF 4X64T 2MAWA 2X68A 2K5BB 2MPKA 3MK7C 5F3JA 3CQXC 2BVMA 3R5LA 4XAXB 4KUMB 4WZXA 1WGBA 2A2JA 4GK5E 3X1DA 3BPKA 4X20E 4ZS3A 4EEBA 3ONLC 1IJ6A 3SFDA 3IA3A 5LHGB 1N33T 2NTYA 4H63V 4UXNB 2W4XA 1WYBA 4YBNA 2RA1A 4IE7A 4B3MT 3H96A 2E5LT 5JTGA 4MTKA 4X66T 4KMCA 3EAAA 3SOLA 3AE3A 4U72A 2W61A 2E9XD 2JQ9A 3FBZA 4H9NC 4QXCB 3FZLB 2VURA 2D0TA 1YW0A 1YLNA 2CXLA 1W0AA 3NKZA 2XM1A 5HXEA 4NUVA 2HPLA 3ZMSB 4HWIB 4W64A 5HEGA 2D37A 2XSAA 4YY3T 4ILCA 4EZ4A 1KNZA 2LT3A 3VRBA 4DR2T 5TAOA 3E0ZA 2Q9QD 5JRCB 1JNRA 1LVKA 2B1EA 3T1HT 3ZJ2A 2H7VC 1VCSA 1YXRA 3QK6A 3UUNA 3TLWA 2I6HA 4H9RC 3KINB 3V4HA 1AJ3A 1LVFA 5ABFB 1RZ1A 1QLBA 3F31A 4MALA 3OYZA 2I59A 4AIUA 3DNHA 2L3LA 5JR9C 1MIWA 2IC6A 3PUZF 3P4QA 1ZOYA 3N9LA 4YWNA 4COFA 4IDOA 2H88A 5JQGE 5FNVE 4HKHA 3RC3A 1J5ET 4KP3C 2X51A 4QXHB 4LF4T 2XZEA 4DV2T 2HHHT 3C4WA 1U4QA 5EZYE 3ETUA 5HXSA 3LK3B 1YQ3A 4TV9E 3ZEFB 4JI3T 4IE6A 4AKRB 1M7KA 3P8CD 2YN6A 5BMVE 4JYAT 4EB6E 4A56A 1BR1A 2V7MA 2FJDA 2J1DG 1D0ZA 3RX6A 3AE5A 2VKHA 2UXXB 3ZSTA 3J9X1 2AXDS 4I55E 4HE8A 4Z8XA 1EJEA 4DUZT 4JI5T 1WFDA 2QGSA 4AQFC 2CA5A 4U2ZA 2JPFA 5AQSB 3GASA 1S35A 4ANJA 2V26A 5EK2A 3N2OA 3PU3A 2C5KT 5LXTE 2JIWA 4UVCB 1HNZT 3RH7A 3P4SA 2I0MA 4DIDB 2OL5A 3AE8A 4HFHA 3CK6A 3KBUA 4UIGA 1OXZA 2GK9A 3J7Yq 1J5WA 3PUXF 4V1Av 3I9WA 5CA1E 3PE0A 4YXDA 2PJQA 4MLKA 1Y01A 1MNEA 4PJNA 5AQKB 3O1HA 3SWJA 3TLVA 3EAMA 4IDQA 5LJMA 2IW5B 1HG2A 3VHLA 2IABA 3W15B 3UFEA 4FJOA 3MACA 3ANWB 3AEEA 3FGEA 1RZ0A 3HKEE 4UHVA 2EHOA 4J2CA 1D1BA 3PV0F 3H3MA 1XDOA 1KEYA 5LGTB 4YSZA 4L9IA 1SE7A 1OEDA 1XXOA 5LBMA 3UU5A 1IJ5A 1T72A 2A2FX 3GN5B 3CX8B 3ESLA 2Y48B 5JDQA 4H63H 4LMKA 5LA6E 4P0AA 3PJAA 2J62A 3HI2A 2KWIB 3U35A 4IRAA 5JDLA 2X67A 3QNUA 3AAEB 2IG6A 2H7OA 3JC6D 2UXNB 1VRBA 1W3OA 4HWHA 2FJBA 3R5PA 3ZN0B 3KVBA 2KSRA 3A6QA 3PJAJ 2PTFA 3KBTA 4YHJA 1W3QA 2NR4A 2XQ7A 3RI5A 4WNKA 4IE5A 5AQFB 2Q9KA 2RDEA 3ZPOA 2C0SA 2WZIA 2D5UA 3MZKB 3FB2A 3OKQA 1WCRA 3ZMZB 3NZQA 4NUUA 1OEDE 1U5PA 4UVBB 5HYAA 2V5CA 4DV6T 4AKGA 5AQIB 4ILUA 3VR9A 5HCJA 2VWAA 4I0UA 1WYCA 3BA3A 5L3EB 2JMKA 4JI1T 4HX6A 2HQ9A 3N9OA 4O8SA 2E8IA 4MHCA 5CGMA 5L3GB 2KMFA 2ACXA 4QKNA 2FUPA 2IHR1 3IN6A 1UK5A 4EYYR 2VQFT 4Z90A 4HTEA 4AQYT 2E9XA 2A9UA 1ZEEA 3N5LA 5AQGB 2ZMAA 3A20A 1G73A 2LSKA 4EYUA 1Z0PA 4WYVA 2E5VA 4I50E 4HEAA 1FMWA 4IL9A 3RYFE 3TLSA 1XNRT 2VK9A 1USFA 3FHNA 1HNWT 1SUMB 5AQRB 3DTOA 2OA5A 3AE9A 1WLIA 5L3DB 1JNWA 3JAEA 3F2EA 4QXBB 1HG5A 2R6GF 2Y6XA 5HXHA 3IBPA 1W0BA 2K24A 5HWYA 3CPZA 5LHHB 4PW8A 4QH4A 4B3RT 1IBKT 4YSXA 2QRXA 2WZHA 2X0YA 4GYRA 4ZXLA 4HWCA 4PJJA 4PFOA 3RIAA 2R6VA 2NW8A 2EHOB 2D9DA 1HCIA 2VKDA 4AKHA 5LG4A 4L0RA 4AISA 3PTRB 1OEDB 4BJNA 2CLYC 3RC8A 3JADA 5AQMB 3NVOA 4N7RC 4OX9T 3FXDB 4HN9A 4DV1T 2HPJA 1UCUA 2D0UA 1AXJA 3RKGA 2XSBA 3D0TA 2LJLA 2BVLA 3TGVA 5HEOA 2BZBA 2QA7A 3CB0A 4IDNA 5L3BB 3G06A 4P1NA 2CM0A 2PBIA 2BG9C 2XAJB 2V7KA 2MTQA 3ZCJA 4CI1B 4HFCA 2MOZA 3KFWX 4L5GA 3RYCE 4LF6T 3AA0B 3A8YC 2UXBT 4AQFA 1EZ3A 2LM2A 3AXJA 3K3OA 4XHYA 2XQAA 2B76A 5KMGP 1W9AA 3F57A 1UURA 4LF5T 3Q5XA 2CBIA 2YDQA 2XQYA 4EZHA 1JNZA 4EGWA 5IYZE 1FJGT 3SRZA 2YDSA 2DL1A 3Q2MA 4DV3T 4IDZA 2XHEB 2X9WA 3CQCB 3AAIA 5L4EA 2ODUA 1WLKA 2XY8B 2WDQA 5FXWA 3LBXA 4E7ZA 2BS4A 4TV8E 2NW7A 3AA7B 1D1AA 3K1SA 2BBJA 2PG8A 5CJ5A 3ZYKA 2UU9T 3VY2A 1FMVA 2E9XB 2XM2A 2H89A 1I6ZA 5C3JA 5AQVB 2E83A 3RQUA 4C91A 3K87A 2BBHA 2YOEA 5EK4A 3E4VA 2NTXA 2UXDT 4IIJE 2IDOB 3PUVF 3ZOFA 2LRKA 2XJ7A 2BKOA 3N9NA 2XASB 3LSVA 4YJ2E 2Q9QB 2FG9A 2OLTA 3U0IA 5FKYA 4ILBA 4F8HA 4NXNT 1D0XA 3R5RA 4NXMT 2XQ6A 2ZLYA 1WLXA 2AQ6A 3AA1B 1KNPA 1N36T 3OTOT 4KBMB 1T8BA 1OWAA 4YTPA 4HFDA 4XZCA 5JDFA 2KNDA 4DV4T 3R5WA 4LMJA 1LRZA 1USCA 2VL0A 4O2BE 4LMLA 2ECUA 5FXXA 2FBWA 3KDSE 3UUXB 3M3ZB 2LKHA 4WBNE 4EXTA 4JI0T 3U3IA 5BR8T 2N9DA 2P9BA 2YINA 2WQYA 2WU2A 1E2AA 4BJMA 1DU2A 4JBWF 3B13A 5L3CB 3PU8A 3BNKA 3K8PC 2JQKA 2XQ9A 3C50A 2LSJA 2XUEA 3I1AA 3RLFF 1IZNB 3TKLB 3GA8A 2CHNA 4PK4A 2ZM6T 4JI8T 3VY5A 2FJEA 2GUJA 5IUXA 4EEDA 3RYIE 3MJXA 5AQQB 2WU5A 4IREA 2XQ4A 2IIUA 5ADXL 4AI6A 3HE1A 1KNRA 3ZN1B 5J1GA 2NOXA 1Y12A 1UUSA 4DR5T 4H9PC 4YSYA 4YTNA 2VVSA 3GWHA 4CXXA 3PUAA 2HTDA 2LSGA 3RYHE 2BS3A 2IMLA 4GKKT 4NPPA 1MIYA 2W0GA 3IEEA 3MXZA 4PK5A 4ZEYA 4TV4A 3EUHA 5H6RB 1L0VA 4UF0A 1IBLT 3A5XA 2CCQA 3L39A 4AQGA 5L3FB 2K3WA 2LOPA 2VB6A 4JV5T 5LCYA 2W67A 4O4JE 5ABEA 2NW9A 1G8XA 2X0HA 3C51A 3VRAA 2ACZA 4JLEA 1SHZC 3WAJA 4LF9T 5AQJB 1CHUA 4ASKA 4U33A 1H7CA 2CE7A 4K0UA 4O4LE 4DO0A 3U34A 3N2GE 3V5SA 3LDQB 2LHRA 3AEFA 3UUBA 1ZV4X 2KT9A 5AQPB 4CXYA 2A3DA 3KYFA 3DJBA 2AE9A 3A6RA 3HL6A 2CWYA 4A97A 3RIUC 2FJAA 4LF8T 3RH3A 4DBQA 5LGNB 2HN1A 4DR4T 2V1DB 2BDEA 3C4ZA 2F4VT 4Z91A 4IT4A 4B6XA 3FXEB 1UGOA 2KXPB 4XJ2A 4HKAA 2QVAA 2C5JA 4NIQA 4QWNB 2BG9A 4ZZBA 4L82A 4B3ST 4LFCT 1YQ4A 5CFBA 3ZMUB 3UUMA 3VYAA 3AEAA 2WDRA 1FIOA 1BR2A 5JABA 1WR6A 2OV9A 2KZ7B 1HR0T 3FZFB 2L1TA 3L09A 5FXVA 1DNLA 1WV4A 3FZHB 1FLMA 4CN4A 4YTMA 3N9PA 3V5UA 5DJQC 1NWMX 5AQUB 3KYGA 2JJ9A 3WI3A 4P09A 2VL8A 2XQ8A 2CXDA 3ETVA 1N34T 4GIWA 3I9YA 4KHPT 1MMGA 4TN7B 2NWBA 2VPAA 5HXRA 1R8IA 4U2YA 1BR4A 3PUYF 4N78D 3ZKRA 5LYJE 1HX8A 2W00A 3QOFA 3GMIA 5HEUA 3QB5A 3HKDE 2WS3A 3Q5DA 4A5XA 3HR0A 2LE8A 4PJLA 4AXPA 1D0YA 1HTJF 2XQ3A 2E2AA 3VKHA 3AE2A 2M67A 1W3PA 1MIVA 1T9MA 3Q5EA 3AMFA 4F6RC 5CHOA 5LP6E 5J2TE 3CQGB 3SS1A 4G63A 3PUQA 3RGLA 2WSSV 4DNDA 2LLYA 2P5ZX 4F07A 4ISTA 4HFIA 5JDNA 3ZOCA 2DI4A 2WM9A 4HWDA 4X62T 4TZ4C 2V5DA 2XAFB 2HQ7A 3R84B 3SWHA 4I4TE 3H37A 4CN1A 4DV5T 4JUYA 4O2AE 5HWXA 5JR9A 1XMQT 3T8OA 1YKEB 2RP4A 4U7IA 5LHIB 4TWDA 3Q9DA 4CI2B 4ZI3D 3TLUA 2HH7A 3CWZB 3OPCA 5HAXA 4HMSA 3LJCA 3K3QC 2ARZA 3AE4A 3CKDA 2CLYB 3AE6A 5L2LA 5ABFA 3O9XA 3UTKA 4QHOA 3ZMTB 2NP9A 4YJ3E 3RQWA 3O4XE 3LG7A 1YKHB 4YFSA 2LSIA 3KVAA 2C5IT 3EABA 2XAHB 5CHEC 4FI5A 4BAYB 4ZI3C 4HMXA 3AE7A 4HMVA 4PAGA 1HF8A 1W09A 2CWOA 2VASA 2GJGA 3CX6B 4OK0A 4GYSA 2ES0A 5JREA 2EHOC 4K0KT 2J47A 3VR8A 4ZOLE 3K86A 2QYWA 4ERRA 3AECA 2G0UA 2KWHA 3N9QA 4IE0A 5FP3A 3NFWA 5HEHA 3AEGA 1OEDC 5ESCA 5KDMC 4UVAB 4WW0A 5H6QB 2XPKA 4DBRA 3PUGA 4EAHA 3N9MA 3RPUA 2FURA 1VCTA 1I0RA 3ZLIA 3CP3A 1QSDA 1XWMA 4LFBT 5AQNB 3EI0A 4MBQA 1SA0E 3RKOA 4TWFA 4DR1T 4DUYT 4IGUA 3AB3B 2WAUA 4GOUA 5CA0E 4CN6A 1T98A 3AEDA 4E7SA 2Y8DA
chains in the Genus database with same CATH topology
2HTIA 3U5WA 4HX6A 4N7RC 2QCKA 3AWHA 2HQ9A 1XXOA 3EC6A 4HMUA 3BNKA 4HMSA 2VPAA 2ARZA 3U34A 1AXJA 3FKHA 3ZOHA 3VY2A 3PFTA 3IN6A 2I02A 1EJEA 3TGVA 5BNCA 1G76A 3F7EA 2QEAA 2E83A 3CB0A 4HMWA 3R5LA 2X1JA 3K87A 1CI0A 3KYFA 3VY5A 3U35A 4ZKYA 3A20A 4Z85A 1WGBA 3A6RA 2A2JA 4IRAA 3E4VA 3GASA 5CHEC 3K88A 3BPKA 2RE7A 1RZ1A 2IG6A 3ZOFA 1G79A 2D38A 3R5YA 4HMXA 3B5MA 1X9BA 4HMVA 1W3PA 1I0SA 1W3OA 2ED4A 1T9MA 2GJGA 1W3RA 3DNHA 1USFA 3AMFA 3R5PA 4XJ2A 2I51A 3RH7A 1G78A 3A6QA 5CHOA 2OL5A 1WLIA 2PTFA 1Y30A 4YBNA 2FG9A 4XHYA 1W3QA 4L82A 2NR4A 3K86A 2D5MA 3H96A 3U0IA 4R82A 1JNWA 3R5RA 1W9AA 2ASFA 4YWNA 3ZODA 2HTDA 3NFWA 3VYAA 2Q9KA 2RDEA 4HMTA 5ESCA 1XHNA 2IMLA 3R5ZA 4F07A 1G77A 3HY8A 4Y9IA 5JABA 2AQ6A 2FHQA 3DMBA 3ZOGA 2FURA 3ZOCA 2ECRA 3HMZA 1I0RA 3SWJA 1NRGA 2R0XA 1TY9A 3ZOEA 1YLNA 2D36A 2HQ7A 2HHZA 3CP3A 1DNLA 3R5WA 1VL7A 1YOAA 1WV4A 1FLMA 2IABA 2D37A 2X1KA 1USCA 2R6VA 2OU5A 2ECUA 1WLKA 3DB0A 3KYGA 3FGEA 1RZ0A 3BA3A 4QVBA 1RFEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HTI A;  3U5W A;  4HX6 A;  4N7R C;  2QCK A;  3AWH A;  2HQ9 A;  1XXO A;  3EC6 A;  4HMU A;  3BNK A;  4HMS A;  2VPA A;  2ARZ A;  3U34 A;  1AXJ A;  3FKH A;  3ZOH A;  3VY2 A;  3PFT A;  3IN6 A;  2I02 A;  1EJE A;  3TGV A;  5BNC A;  1G76 A;  3F7E A;  2QEA A;  2E83 A;  3CB0 A;  4HMW A;  3R5L A;  2X1J A;  3K87 A;  1CI0 A;  3KYF A;  3VY5 A;  3U35 A;  4ZKY A;  3A20 A;  4Z85 A;  1WGB A;  3A6R A;  2A2J A;  4IRA A;  3E4V A;  3GAS A;  5CHE C;  3K88 A;  3BPK A;  2RE7 A;  1RZ1 A;  2IG6 A;  3ZOF A;  1G79 A;  2D38 A;  3R5Y A;  4HMX A;  3B5M A;  1X9B A;  4HMV A;  1W3P A;  1I0S A;  1W3O A;  2ED4 A;  1T9M A;  2GJG A;  1W3R A;  3DNH A;  1USF A;  3AMF A;  3R5P A;  4XJ2 A;  2I51 A;  3RH7 A;  1G78 A;  3A6Q A;  5CHO A;  2OL5 A;  1WLI A;  2PTF A;  1Y30 A;  4YBN A;  2FG9 A;  4XHY A;  1W3Q A;  4L82 A;  2NR4 A;  3K86 A;  2D5M A;  3H96 A;  3U0I A;  4R82 A;  1JNW A;  3R5R A;  1W9A A;  2ASF A;  4YWN A;  3ZOD A;  2HTD A;  3NFW A;  3VYA A;  2Q9K A;  2RDE A;  4HMT A;  5ESC A;  1XHN A;  2IML A;  3R5Z A;  4F07 A;  1G77 A;  3HY8 A;  4Y9I A;  5JAB A;  2AQ6 A;  2FHQ A;  3DMB A;  3ZOG A;  2FUR A;  3ZOC A;  2ECR A;  3HMZ A;  1I0R A;  3SWJ A;  1NRG A;  2R0X A;  1TY9 A;  3ZOE A;  1YLN A;  2D36 A;  2HQ7 A;  2HHZ A;  3CP3 A;  1DNL A;  3R5W A;  1VL7 A;  1YOA A;  1WV4 A;  1FLM A;  2IAB A;  2D37 A;  2X1K A;  1USC A;  2R6V A;  2OU5 A;  2ECU A;  1WLK A;  3DB0 A;  3KYG A;  3FGE A;  1RZ0 A;  3BA3 A;  4QVB A;  1RFE A; 
#chains in the Genus database with same CATH topology
 3R6N A;  4X1K E;  1ZKE A;  2W62 A;  5LJN A;  4U31 A;  1KK7 A;  3AA6 B;  2CBJ A;  3ONJ A;  1Y64 B;  2CRB A;  4GKJ T;  2DCF A;  4P0B A;  3ZSS A;  1G76 A;  3AVR A;  2YEV C;  3VKG A;  1O3X A;  4HMW A;  5HEJ A;  3TLT A;  2X1J A;  4KI0 F;  2JQQ A;  4ZI2 D;  3AE1 A;  2BKP A;  2LOS A;  1WR0 A;  3ZMV B;  3B5M A;  4HFE A;  2SPC A;  2JMH A;  4EOZ B;  4PFP A;  3CVR A;  2YK0 A;  1MMD A;  3BQK A;  4MFR A;  3PUR A;  4JI6 T;  3CX7 B;  3NBX X;  5ABG A;  3OYX A;  3QB5 K;  3RIU A;  4QX8 B;  1QUU A;  5FMN A;  4ZI2 C;  2M6B A;  1MND A;  3HY8 A;  4Y9I A;  2W63 A;  3ZT7 A;  3MKD A;  3ABV A;  2VKO A;  3C4X A;  5AQO B;  4LF7 T;  1US7 B;  3ANW A;  3HMZ A;  4X1Y E;  1TY9 A;  2V8S V;  1XMO T;  2E9X C;  3RIF A;  4YT0 A;  2HHZ A;  3HA4 A;  1I94 T;  5FYM A;  2ZM2 A;  2MYS A;  2WMO A;  4HFV A;  5AQT B;  5LMU T;  4PJM A;  5JR9 B;  1VOM A;  3FZK B;  1KFY A;  1WRD A;  3GN5 A;  5GON E;  2LRL A;  4O4I E;  1XZY A;  5L4H A;  5IHY A;  3UUL A;  1RFE A;  4PK6 A;  3P4P A;  5DAB A;  5FL1 A;  2HTI A;  2X66 A;  3KV5 A;  3UU3 A;  2Q9Q C;  4GK0 E;  2N1G A;  3MA9 A;  5KXJ A;  4C90 A;  3LFM A;  3KV6 A;  4B3T T;  4DR7 T;  3LK4 2;  4UR9 A;  2IAK A;  4JEH B;  1W9R A;  1E7P A;  3S4U A;  4JI7 T;  3N2K E;  3FZM B;  1MMA A;  1E1H B;  4XBF B;  3K3N A;  2X9X A;  2YU2 A;  2DLR A;  2V7I A;  3R5Y A;  1X9B A;  2CXF A;  1I0S A;  4IE4 A;  1W3R A;  3ZJ1 A;  5AQH B;  3OBV E;  2KLQ A;  1HS7 A;  2CEA A;  5F8P A;  3I0Q A;  5HXC A;  2ASF A;  1Z8U A;  3NRX A;  3ZCI A;  2WMN A;  5ETW A;  4UEM A;  1KF6 A;  5C8Y E;  5FY7 A;  3C98 B;  4ZI7 E;  2DNX A;  4TNW A;  3P50 A;  3AXJ B;  2ECR A;  2J4G A;  5DQW A;  1NRG A;  2R0X A;  3ZOE A;  2WCA A;  5JVD E;  3E08 A;  3BK9 A;  4TWH A;  1HFA A;  4EV6 A;  3NRY A;  3B57 A;  1M62 A;  4JEU B;  4OHF A;  4CZZ B;  3ONX A;  3QC9 A;  4I43 B;  1IAP A;  3CML A;  2ZM8 A;  2QCK A;  3PUW F;  4HMU A;  3UU4 A;  2M6I A;  4U74 A;  4ISS A;  3LBX B;  4H9Q C;  3C64 A;  3FKH A;  4QH1 A;  2V6Y A;  4KX6 A;  2WP9 A;  4AKL A;  4DMV A;  3PFT A;  5KX5 E;  4DV0 T;  3UT5 E;  3EHZ A;  1XNQ T;  2WDV A;  3JCF A;  4TUY E;  1CI0 A;  2WY2 A;  2L9Q A;  3WAK A;  5EK3 A;  5FY0 A;  2K48 A;  1HX1 B;  2A72 A;  3RHW A;  3K88 A;  2DWK A;  4EIW A;  1NEK A;  1G79 A;  5LMN T;  2PFV A;  2X9Y A;  4CI3 B;  4Q25 A;  2I51 A;  1FEW A;  5JH7 E;  2XQ5 A;  4CQI A;  4R82 A;  2WB5 A;  2XAQ B;  2LEH A;  4HMT A;  3R5Z A;  4U3C A;  5JDH A;  2K4Q A;  3RF1 A;  4AKI A;  3ZC0 A;  5E0O A;  3PDY A;  2WBL A;  3DP7 A;  3UQ7 A;  3Q5W A;  3EDV A;  2JRK A;  4M1P A;  5HCM A;  5J2U E;  3IF8 B;  4A98 A;  1IBM T;  1XDP A;  3EDU A;  2ODV A;  5JDM A;  4UV9 B;  3IHR A;  2CMR A;  1YD8 G;  4H9S E;  5C2T A;  2YKS A;  5A1L A;  4H9O C;  3UU6 A;  4LFA T;  5FVK A;  3NZP A;  3QUJ A;  2V7J A;  2Z6E A;  4JI4 T;  3EC6 A;  3A7M A;  4JI2 T;  5LOV E;  2DWG A;  3UFG A;  2UUC T;  2V6X A;  3P7I A;  4ADZ A;  3UU8 A;  4ILA A;  3AVS A;  4YLH A;  4BA9 A;  1GQE A;  1LKX A;  5IWA T;  3P4R A;  5LBQ B;  4HWF A;  3RRW A;  3BQL A;  2BS2 A;  2LSY A;  4UV8 B;  5ABH A;  3T1Y T;  2K9A A;  5AQL B;  2KIN B;  4Z85 A;  4YHH T;  3BQI A;  3RRC A;  4TNV A;  3O1J A;  3CIR A;  2VKJ A;  2MBG A;  2D38 A;  3VU7 H;  3ZT6 A;  2YDR A;  3SFE A;  4O4H E;  1HNX T;  4WBO A;  3JC6 C;  4DMW A;  5LG3 A;  1G78 A;  1Y30 A;  1N32 T;  4HFB A;  2BG9 E;  5LGU B;  4QX7 B;  4ZZC A;  1UX4 A;  1UX5 A;  1ZHC A;  4DR6 T;  5FL0 A;  2DHR A;  3ZYM A;  2XAG B;  2CPT A;  4X65 T;  3OJA A;  3DMB A;  3ZOG A;  5F5W A;  3JAF A;  1S94 A;  4G2A A;  2XTL A;  4HGA A;  5L47 A;  2D2S A;  3I0O A;  5J0Z A;  2WWV A;  3UQ4 A;  2X0L B;  1VL7 A;  2VQE T;  1YOA A;  2X1K A;  4X5T A;  2OU5 A;  2IUB A;  2IC9 A;  4UEL A;  3OVU A;  3L3P A;  1J1J A;  2WWU A;  3HKB E;  4CXW A;  1BR0 A;  4QVB A;  3ZYL A;  5DQV A;  3PUS A;  4DR3 T;  4UF0 B;  1MMN A;  4DV7 T;  3U78 A;  2V6Y B;  3ZT5 A;  3L8R A;  5JRC A;  3E22 E;  2LHN A;  3ZOH A;  1ZP0 A;  2I02 A;  3O1I A;  5BNC A;  3H3A A;  2L8K A;  3F7E A;  2QEA A;  4OFZ A;  2N2N A;  3M65 A;  4ZKY A;  2Q9Q A;  2X9H A;  5JDG A;  3LK2 B;  4DVD A;  4OYK A;  2RE7 A;  4PNI A;  5LNK A;  2W2U A;  5LB7 B;  2ED4 A;  1CUN A;  2EHO D;  2ZM0 A;  4TX5 A;  4ZHQ E;  2BKN A;  2W66 A;  2VVN A;  4U7Y A;  5FXZ A;  2D5M A;  3EVY A;  3AAA B;  4IHJ E;  3ZOD A;  4IDP A;  3FBL A;  5AFU L;  1NAF A;  1XHN A;  1G77 A;  2JQH A;  4OYJ A;  4ZS2 A;  5FVL A;  2FHQ A;  3P4W A;  5CB4 E;  4IL4 A;  2BG9 B;  2UUA T;  3AEB A;  4QH5 A;  5M4Y A;  2LKG A;  2YU1 A;  2D36 A;  1X79 A;  1D1C A;  1V9D A;  5FY1 A;  2HN2 A;  3DB0 A;  3NWI A;  3KV4 A;  2V7L A;  1NEN A;  1T7S A;  2UXC T;  2UUB T;  1B7T A;  4X1I E;  2LM9 A;  2RPA A;  3U5W A;  3HKC E;  2CHO A;  3AWH A;  3KV9 A;  3ZC1 A;  2H3R A;  4KHZ F;  4X64 T;  2MAW A;  2X68 A;  2K5B B;  2MPK A;  3MK7 C;  5F3J A;  3CQX C;  2BVM A;  3R5L A;  4XAX B;  4KUM B;  4WZX A;  1WGB A;  2A2J A;  4GK5 E;  3X1D A;  3BPK A;  4X20 E;  4ZS3 A;  4EEB A;  3ONL C;  1IJ6 A;  3SFD A;  3IA3 A;  5LHG B;  1N33 T;  2NTY A;  4H63 V;  4UXN B;  2W4X A;  1WYB A;  4YBN A;  2RA1 A;  4IE7 A;  4B3M T;  3H96 A;  2E5L T;  5JTG A;  4MTK A;  4X66 T;  4KMC A;  3EAA A;  3SOL A;  3AE3 A;  4U72 A;  2W61 A;  2E9X D;  2JQ9 A;  3FBZ A;  4H9N C;  4QXC B;  3FZL B;  2VUR A;  2D0T A;  1YW0 A;  1YLN A;  2CXL A;  1W0A A;  3NKZ A;  2XM1 A;  5HXE A;  4NUV A;  2HPL A;  3ZMS B;  4HWI B;  4W64 A;  5HEG A;  2D37 A;  2XSA A;  4YY3 T;  4ILC A;  4EZ4 A;  1KNZ A;  2LT3 A;  3VRB A;  4DR2 T;  5TAO A;  3E0Z A;  2Q9Q D;  5JRC B;  1JNR A;  1LVK A;  2B1E A;  3T1H T;  3ZJ2 A;  2H7V C;  1VCS A;  1YXR A;  3QK6 A;  3UUN A;  3TLW A;  2I6H A;  4H9R C;  3KIN B;  3V4H A;  1AJ3 A;  1LVF A;  5ABF B;  1RZ1 A;  1QLB A;  3F31 A;  4MAL A;  3OYZ A;  2I59 A;  4AIU A;  3DNH A;  2L3L A;  5JR9 C;  1MIW A;  2IC6 A;  3PUZ F;  3P4Q A;  1ZOY A;  3N9L A;  4YWN A;  4COF A;  4IDO A;  2H88 A;  5JQG E;  5FNV E;  4HKH A;  3RC3 A;  1J5E T;  4KP3 C;  2X51 A;  4QXH B;  4LF4 T;  2XZE A;  4DV2 T;  2HHH T;  3C4W A;  1U4Q A;  5EZY E;  3ETU A;  5HXS A;  3LK3 B;  1YQ3 A;  4TV9 E;  3ZEF B;  4JI3 T;  4IE6 A;  4AKR B;  1M7K A;  3P8C D;  2YN6 A;  5BMV E;  4JYA T;  4EB6 E;  4A56 A;  1BR1 A;  2V7M A;  2FJD A;  2J1D G;  1D0Z A;  3RX6 A;  3AE5 A;  2VKH A;  2UXX B;  3ZST A;  3J9X 1;  2AXD S;  4I55 E;  4HE8 A;  4Z8X A;  1EJE A;  4DUZ T;  4JI5 T;  1WFD A;  2QGS A;  4AQF C;  2CA5 A;  4U2Z A;  2JPF A;  5AQS B;  3GAS A;  1S35 A;  4ANJ A;  2V26 A;  5EK2 A;  3N2O A;  3PU3 A;  2C5K T;  5LXT E;  2JIW A;  4UVC B;  1HNZ T;  3RH7 A;  3P4S A;  2I0M A;  4DID B;  2OL5 A;  3AE8 A;  4HFH A;  3CK6 A;  3KBU A;  4UIG A;  1OXZ A;  2GK9 A;  3J7Y q;  1J5W A;  3PUX F;  4V1A v;  3I9W A;  5CA1 E;  3PE0 A;  4YXD A;  2PJQ A;  4MLK A;  1Y01 A;  1MNE A;  4PJN A;  5AQK B;  3O1H A;  3SWJ A;  3TLV A;  3EAM A;  4IDQ A;  5LJM A;  2IW5 B;  1HG2 A;  3VHL A;  2IAB A;  3W15 B;  3UFE A;  4FJO A;  3MAC A;  3ANW B;  3AEE A;  3FGE A;  1RZ0 A;  3HKE E;  4UHV A;  2EHO A;  4J2C A;  1D1B A;  3PV0 F;  3H3M A;  1XDO A;  1KEY A;  5LGT B;  4YSZ A;  4L9I A;  1SE7 A;  1OED A;  1XXO A;  5LBM A;  3UU5 A;  1IJ5 A;  1T72 A;  2A2F X;  3GN5 B;  3CX8 B;  3ESL A;  2Y48 B;  5JDQ A;  4H63 H;  4LMK A;  5LA6 E;  4P0A A;  3PJA A;  2J62 A;  3HI2 A;  2KWI B;  3U35 A;  4IRA A;  5JDL A;  2X67 A;  3QNU A;  3AAE B;  2IG6 A;  2H7O A;  3JC6 D;  2UXN B;  1VRB A;  1W3O A;  4HWH A;  2FJB A;  3R5P A;  3ZN0 B;  3KVB A;  2KSR A;  3A6Q A;  3PJA J;  2PTF A;  3KBT A;  4YHJ A;  1W3Q A;  2NR4 A;  2XQ7 A;  3RI5 A;  4WNK A;  4IE5 A;  5AQF B;  2Q9K A;  2RDE A;  3ZPO A;  2C0S A;  2WZI A;  2D5U A;  3MZK B;  3FB2 A;  3OKQ A;  1WCR A;  3ZMZ B;  3NZQ A;  4NUU A;  1OED E;  1U5P A;  4UVB B;  5HYA A;  2V5C A;  4DV6 T;  4AKG A;  5AQI B;  4ILU A;  3VR9 A;  5HCJ A;  2VWA A;  4I0U A;  1WYC A;  3BA3 A;  5L3E B;  2JMK A;  4JI1 T;  4HX6 A;  2HQ9 A;  3N9O A;  4O8S A;  2E8I A;  4MHC A;  5CGM A;  5L3G B;  2KMF A;  2ACX A;  4QKN A;  2FUP A;  2IHR 1;  3IN6 A;  1UK5 A;  4EYY R;  2VQF T;  4Z90 A;  4HTE A;  4AQY T;  2E9X A;  2A9U A;  1ZEE A;  3N5L A;  5AQG B;  2ZMA A;  3A20 A;  1G73 A;  2LSK A;  4EYU A;  1Z0P A;  4WYV A;  2E5V A;  4I50 E;  4HEA A;  1FMW A;  4IL9 A;  3RYF E;  3TLS A;  1XNR T;  2VK9 A;  1USF A;  3FHN A;  1HNW T;  1SUM B;  5AQR B;  3DTO A;  2OA5 A;  3AE9 A;  1WLI A;  5L3D B;  1JNW A;  3JAE A;  3F2E A;  4QXB B;  1HG5 A;  2R6G F;  2Y6X A;  5HXH A;  3IBP A;  1W0B A;  2K24 A;  5HWY A;  3CPZ A;  5LHH B;  4PW8 A;  4QH4 A;  4B3R T;  1IBK T;  4YSX A;  2QRX A;  2WZH A;  2X0Y A;  4GYR A;  4ZXL A;  4HWC A;  4PJJ A;  4PFO A;  3RIA A;  2R6V A;  2NW8 A;  2EHO B;  2D9D A;  1HCI A;  2VKD A;  4AKH A;  5LG4 A;  4L0R A;  4AIS A;  3PTR B;  1OED B;  4BJN A;  2CLY C;  3RC8 A;  3JAD A;  5AQM B;  3NVO A;  4N7R C;  4OX9 T;  3FXD B;  4HN9 A;  4DV1 T;  2HPJ A;  1UCU A;  2D0U A;  1AXJ A;  3RKG A;  2XSB A;  3D0T A;  2LJL A;  2BVL A;  3TGV A;  5HEO A;  2BZB A;  2QA7 A;  3CB0 A;  4IDN A;  5L3B B;  3G06 A;  4P1N A;  2CM0 A;  2PBI A;  2BG9 C;  2XAJ B;  2V7K A;  2MTQ A;  3ZCJ A;  4CI1 B;  4HFC A;  2MOZ A;  3KFW X;  4L5G A;  3RYC E;  4LF6 T;  3AA0 B;  3A8Y C;  2UXB T;  4AQF A;  1EZ3 A;  2LM2 A;  3AXJ A;  3K3O A;  4XHY A;  2XQA A;  2B76 A;  5KMG P;  1W9A A;  3F57 A;  1UUR A;  4LF5 T;  3Q5X A;  2CBI A;  2YDQ A;  2XQY A;  4EZH A;  1JNZ A;  4EGW A;  5IYZ E;  1FJG T;  3SRZ A;  2YDS A;  2DL1 A;  3Q2M A;  4DV3 T;  4IDZ A;  2XHE B;  2X9W A;  3CQC B;  3AAI A;  5L4E A;  2ODU A;  1WLK A;  2XY8 B;  2WDQ A;  5FXW A;  3LBX A;  4E7Z A;  2BS4 A;  4TV8 E;  2NW7 A;  3AA7 B;  1D1A A;  3K1S A;  2BBJ A;  2PG8 A;  5CJ5 A;  3ZYK A;  2UU9 T;  3VY2 A;  1FMV A;  2E9X B;  2XM2 A;  2H89 A;  1I6Z A;  5C3J A;  5AQV B;  2E83 A;  3RQU A;  4C91 A;  3K87 A;  2BBH A;  2YOE A;  5EK4 A;  3E4V A;  2NTX A;  2UXD T;  4IIJ E;  2IDO B;  3PUV F;  3ZOF A;  2LRK A;  2XJ7 A;  2BKO A;  3N9N A;  2XAS B;  3LSV A;  4YJ2 E;  2Q9Q B;  2FG9 A;  2OLT A;  3U0I A;  5FKY A;  4ILB A;  4F8H A;  4NXN T;  1D0X A;  3R5R A;  4NXM T;  2XQ6 A;  2ZLY A;  1WLX A;  2AQ6 A;  3AA1 B;  1KNP A;  1N36 T;  3OTO T;  4KBM B;  1T8B A;  1OWA A;  4YTP A;  4HFD A;  4XZC A;  5JDF A;  2KND A;  4DV4 T;  3R5W A;  4LMJ A;  1LRZ A;  1USC A;  2VL0 A;  4O2B E;  4LML A;  2ECU A;  5FXX A;  2FBW A;  3KDS E;  3UUX B;  3M3Z B;  2LKH A;  4WBN E;  4EXT A;  4JI0 T;  3U3I A;  5BR8 T;  2N9D A;  2P9B A;  2YIN A;  2WQY A;  2WU2 A;  1E2A A;  4BJM A;  1DU2 A;  4JBW F;  3B13 A;  5L3C B;  3PU8 A;  3BNK A;  3K8P C;  2JQK A;  2XQ9 A;  3C50 A;  2LSJ A;  2XUE A;  3I1A A;  3RLF F;  1IZN B;  3TKL B;  3GA8 A;  2CHN A;  4PK4 A;  2ZM6 T;  4JI8 T;  3VY5 A;  2FJE A;  2GUJ A;  5IUX A;  4EED A;  3RYI E;  3MJX A;  5AQQ B;  2WU5 A;  4IRE A;  2XQ4 A;  2IIU A;  5ADX L;  4AI6 A;  3HE1 A;  1KNR A;  3ZN1 B;  5J1G A;  2NOX A;  1Y12 A;  1UUS A;  4DR5 T;  4H9P C;  4YSY A;  4YTN A;  2VVS A;  3GWH A;  4CXX A;  3PUA A;  2HTD A;  2LSG A;  3RYH E;  2BS3 A;  2IML A;  4GKK T;  4NPP A;  1MIY A;  2W0G A;  3IEE A;  3MXZ A;  4PK5 A;  4ZEY A;  4TV4 A;  3EUH A;  5H6R B;  1L0V A;  4UF0 A;  1IBL T;  3A5X A;  2CCQ A;  3L39 A;  4AQG A;  5L3F B;  2K3W A;  2LOP A;  2VB6 A;  4JV5 T;  5LCY A;  2W67 A;  4O4J E;  5ABE A;  2NW9 A;  1G8X A;  2X0H A;  3C51 A;  3VRA A;  2ACZ A;  4JLE A;  1SHZ C;  3WAJ A;  4LF9 T;  5AQJ B;  1CHU A;  4ASK A;  4U33 A;  1H7C A;  2CE7 A;  4K0U A;  4O4L E;  4DO0 A;  3U34 A;  3N2G E;  3V5S A;  3LDQ B;  2LHR A;  3AEF A;  3UUB A;  1ZV4 X;  2KT9 A;  5AQP B;  4CXY A;  2A3D A;  3KYF A;  3DJB A;  2AE9 A;  3A6R A;  3HL6 A;  2CWY A;  4A97 A;  3RIU C;  2FJA A;  4LF8 T;  3RH3 A;  4DBQ A;  5LGN B;  2HN1 A;  4DR4 T;  2V1D B;  2BDE A;  3C4Z A;  2F4V T;  4Z91 A;  4IT4 A;  4B6X A;  3FXE B;  1UGO A;  2KXP B;  4XJ2 A;  4HKA A;  2QVA A;  2C5J A;  4NIQ A;  4QWN B;  2BG9 A;  4ZZB A;  4L82 A;  4B3S T;  4LFC T;  1YQ4 A;  5CFB A;  3ZMU B;  3UUM A;  3VYA A;  3AEA A;  2WDR A;  1FIO A;  1BR2 A;  5JAB A;  1WR6 A;  2OV9 A;  2KZ7 B;  1HR0 T;  3FZF B;  2L1T A;  3L09 A;  5FXV A;  1DNL A;  1WV4 A;  3FZH B;  1FLM A;  4CN4 A;  4YTM A;  3N9P A;  3V5U A;  5DJQ C;  1NWM X;  5AQU B;  3KYG A;  2JJ9 A;  3WI3 A;  4P09 A;  2VL8 A;  2XQ8 A;  2CXD A;  3ETV A;  1N34 T;  4GIW A;  3I9Y A;  4KHP T;  1MMG A;  4TN7 B;  2NWB A;  2VPA A;  5HXR A;  1R8I A;  4U2Y A;  1BR4 A;  3PUY F;  4N78 D;  3ZKR A;  5LYJ E;  1HX8 A;  2W00 A;  3QOF A;  3GMI A;  5HEU A;  3QB5 A;  3HKD E;  2WS3 A;  3Q5D A;  4A5X A;  3HR0 A;  2LE8 A;  4PJL A;  4AXP A;  1D0Y A;  1HTJ F;  2XQ3 A;  2E2A A;  3VKH A;  3AE2 A;  2M67 A;  1W3P A;  1MIV A;  1T9M A;  3Q5E A;  3AMF A;  4F6R C;  5CHO A;  5LP6 E;  5J2T E;  3CQG B;  3SS1 A;  4G63 A;  3PUQ A;  3RGL A;  2WSS V;  4DND A;  2LLY A;  2P5Z X;  4F07 A;  4IST A;  4HFI A;  5JDN A;  3ZOC A;  2DI4 A;  2WM9 A;  4HWD A;  4X62 T;  4TZ4 C;  2V5D A;  2XAF B;  2HQ7 A;  3R84 B;  3SWH A;  4I4T E;  3H37 A;  4CN1 A;  4DV5 T;  4JUY A;  4O2A E;  5HWX A;  5JR9 A;  1XMQ T;  3T8O A;  1YKE B;  2RP4 A;  4U7I A;  5LHI B;  4TWD A;  3Q9D A;  4CI2 B;  4ZI3 D;  3TLU A;  2HH7 A;  3CWZ B;  3OPC A;  5HAX A;  4HMS A;  3LJC A;  3K3Q C;  2ARZ A;  3AE4 A;  3CKD A;  2CLY B;  3AE6 A;  5L2L A;  5ABF A;  3O9X A;  3UTK A;  4QHO A;  3ZMT B;  2NP9 A;  4YJ3 E;  3RQW A;  3O4X E;  3LG7 A;  1YKH B;  4YFS A;  2LSI A;  3KVA A;  2C5I T;  3EAB A;  2XAH B;  5CHE C;  4FI5 A;  4BAY B;  4ZI3 C;  4HMX A;  3AE7 A;  4HMV A;  4PAG A;  1HF8 A;  1W09 A;  2CWO A;  2VAS A;  2GJG A;  3CX6 B;  4OK0 A;  4GYS A;  2ES0 A;  5JRE A;  2EHO C;  4K0K T;  2J47 A;  3VR8 A;  4ZOL E;  3K86 A;  2QYW A;  4ERR A;  3AEC A;  2G0U A;  2KWH A;  3N9Q A;  4IE0 A;  5FP3 A;  3NFW A;  5HEH A;  3AEG A;  1OED C;  5ESC A;  5KDM C;  4UVA B;  4WW0 A;  5H6Q B;  2XPK A;  4DBR A;  3PUG A;  4EAH A;  3N9M A;  3RPU A;  2FUR A;  1VCT A;  1I0R A;  3ZLI A;  3CP3 A;  1QSD A;  1XWM A;  4LFB T;  5AQN B;  3EI0 A;  4MBQ A;  1SA0 E;  3RKO A;  4TWF A;  4DR1 T;  4DUY T;  4IGU A;  3AB3 B;  2WAU A;  4GOU A;  5CA0 E;  4CN6 A;  1T98 A;  3AED A;  4E7S A;  2Y8D A; 
#chains in the Genus database with same CATH homology
 2HTI A;  3U5W A;  4HX6 A;  4N7R C;  2QCK A;  3AWH A;  2HQ9 A;  1XXO A;  3EC6 A;  4HMU A;  3BNK A;  4HMS A;  2VPA A;  2ARZ A;  3U34 A;  1AXJ A;  3FKH A;  3ZOH A;  3VY2 A;  3PFT A;  3IN6 A;  2I02 A;  1EJE A;  3TGV A;  5BNC A;  1G76 A;  3F7E A;  2QEA A;  2E83 A;  3CB0 A;  4HMW A;  3R5L A;  2X1J A;  3K87 A;  1CI0 A;  3KYF A;  3VY5 A;  3U35 A;  4ZKY A;  3A20 A;  4Z85 A;  1WGB A;  3A6R A;  2A2J A;  4IRA A;  3E4V A;  3GAS A;  5CHE C;  3K88 A;  3BPK A;  2RE7 A;  1RZ1 A;  2IG6 A;  3ZOF A;  1G79 A;  2D38 A;  3R5Y A;  4HMX A;  3B5M A;  1X9B A;  4HMV A;  1W3P A;  1I0S A;  1W3O A;  2ED4 A;  1T9M A;  2GJG A;  1W3R A;  3DNH A;  1USF A;  3AMF A;  3R5P A;  4XJ2 A;  2I51 A;  3RH7 A;  1G78 A;  3A6Q A;  5CHO A;  2OL5 A;  1WLI A;  2PTF A;  1Y30 A;  4YBN A;  2FG9 A;  4XHY A;  1W3Q A;  4L82 A;  2NR4 A;  3K86 A;  2D5M A;  3H96 A;  3U0I A;  4R82 A;  1JNW A;  3R5R A;  1W9A A;  2ASF A;  4YWN A;  3ZOD A;  2HTD A;  3NFW A;  3VYA A;  2Q9K A;  2RDE A;  4HMT A;  5ESC A;  1XHN A;  2IML A;  3R5Z A;  4F07 A;  1G77 A;  3HY8 A;  4Y9I A;  5JAB A;  2AQ6 A;  2FHQ A;  3DMB A;  3ZOG A;  2FUR A;  3ZOC A;  2ECR A;  3HMZ A;  1I0R A;  3SWJ A;  1NRG A;  2R0X A;  1TY9 A;  3ZOE A;  1YLN A;  2D36 A;  2HQ7 A;  2HHZ A;  3CP3 A;  1DNL A;  3R5W A;  1VL7 A;  1YOA A;  1WV4 A;  1FLM A;  2IAB A;  2D37 A;  2X1K A;  1USC A;  2R6V A;  2OU5 A;  2ECU A;  1WLK A;  3DB0 A;  3KYG A;  3FGE A;  1RZ0 A;  3BA3 A;  4QVB A;  1RFE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...