2NR4A

Crystal structure of fmn-bound protein mm1853 from methanosarcina mazei, pfam duf447
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
192
structure length
191
Chain Sequence
DLSSFGIREGISEIIASTGFEHPNAAPIGIVMKGERPFVRLFKGSHTWENVLKEKCLASNVVYDPILFVRSTFSDLVPSEFEYVDGEFKFPVLKEAIAWVVFECINLRNTDQSLVADLVPLNAGFNERNIKELPVPNRGFNAVLEATVHATRYQLTGEEKYLELIRHYESLASKCGGDAEKKAMKLIYEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved hypothetical protein
publication title Crystal structure of conserved FMN bound hypothetical protein from Methanosarcina mazei
rcsb
source organism Methanosarcina mazei
molecule tags Structural genomics, unknown function
total genus 54
structure length 191
sequence length 192
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04289 DUF447 Protein of unknown function (DUF447)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.290 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical membrane protein ta0354_69_121. 2nr4A02
2.30.110.10 Mainly Beta Roll Pnp Oxidase; Chain A Electron Transport, Fmn-binding Protein; Chain A 2nr4A01
1X9BA 1YOAA 3F7EA 1I0SA 3NFWA 3ZODA 2ECRA 2I51A 5BNCA 1WLKA 3ZOHA 3A6QA 3DMBA 1USFA 1TY9A 2PTFA 1Y30A 5CHOA 2D36A 1G79A 2E83A 4F07A 2FG9A 4N7RC 2D37A 3AMFA 3U5WA 4HMWA 2IMLA 3ZOGA 2ED4A 4Z85A 1AXJA 1WLIA 3HMZA 4HMTA 3AWHA 4HMSA 1G76A 2HQ7A 3ZOCA 3PFTA 4IRAA 1XXOA 3VY5A 3BPKA 3ZOFA 1USCA 4QVBA 2QEAA 1CI0A 3TGVA 2ECUA 2FHQA 1RZ0A 1VL7A 4YWNA 2X1JA 3BNKA 2QCKA 3DB0A 2D38A 3A20A 3E4VA 3IN6A 2NR4A 4HMXA 1G78A 3H96A 3K86A 4XJ2A 1WV4A 3K87A 2X1KA 2I02A 2OL5A 1YLNA 4XHYA 3R5LA 2ASFA 2A2JA 2HTDA 1W9AA 1NRGA 2OU5A 3U0IA 5JABA 3EC6A 1DNLA 2HHZA 3R5YA 3K88A 3U34A 4R82A 5ESCA 3RH7A 3KYFA 1RFEA 3BA3A 3GASA 4YBNA 2GJGA 3B5MA 1WGBA 3R5PA 1JNWA 3ZOEA 1RZ1A 3VYAA 3CP3A 1EJEA 2AQ6A 1FLMA 2ARZA 1W3OA 2IG6A 1T9MA 3DNHA 1XHNA 2Q9KA 2R6VA 3SWJA 4ZKYA 2RE7A 2HTIA 3A6RA 4Y9IA 1W3QA 3HY8A 3KYGA 2VPAA 4L82A 2IABA 1G77A 3CB0A 3R5WA 2D5MA 2RDEA 1I0RA 4HMUA 1W3PA 4HX6A 3VY2A 1W3RA 3FGEA 3FKHA 3R5ZA 4HMVA 2HQ9A 3U35A 5CHEC 3R5RA 2R0XA 2FURA
chains in the Genus database with same CATH superfamily
1X9BA 1I0SA 5LB7B 5JRCB 1D0XA 3HE1A 4EEBA 1USFA 2KNDA 3UU4A 2VKHA 2D36A 2NW8A 2MTQA 3QB5K 1ZKEA 2IMLA 3ZC1A 2JRKA 3JAFA 4AQYT 3BQKA 1AXJA 5CA1E 2WDVA 3KV9A 4DR7T 2CEAA 5AQUB 2JQ9A 1MIVA 3ZSSA 2AE9A 2ECUA 3RPUA 4TNVA 3CPZA 4JI3T 5C3JA 1VL7A 2FJEA 2X1JA 2QCKA 1T72A 3K87A 2YN6A 5JDGA 4XHYA 4NXNT 5HEUA 2MAWA 5FKYA 5L2LA 1KNPA 5IHYA 3ZJ1A 3EC6A 3R5YA 3VKHA 3NZQA 3SS1A 2XQ6A 3P7IA 4ILUA 3RIUA 1ZP0A 2NTYA 4IREA 3B5MA 2CM0A 4IDZA 3CP3A 2E5VA 2YDRA 2CE7A 4XZCA 1W3OA 4DR2T 4IE6A 4U7YA 4KHPT 2XQ7A 3ZMSB 4ZKYA 2D0UA 4EOZB 1XMQT 2Z6EA 5BMVE 1W3QA 3KYGA 2XQYA 3CB0A 3RRWA 4CN4A 4MALA 2NW9A 2VL0A 3ZN1B 4GYRA 4GK5E 4KHZF 1T7SA 3C51A 1HNZT 4JYAT 3FBLA 2WBLA 3KBTA 1WLKA 4J2CA 1FIOA 1G79A 1LVKA 3ZEFB 5ABFB 5DQVA 2CBIA 2LRKA 4TWDA 5L3GB 1W0BA 3HMZA 1LRZA 3IEEA 4X62T 5ABHA 3BQIA 3PUYF 4Q25A 4OFZA 4K0KT 3ZOFA 4U2ZA 2VKDA 3K3OA 5HCJA 4CXYA 2JIWA 4JI7T 4DR6T 2UXDT 1G78A 2H7VC 5LG3A 2JQQA 4BAYB 1VCTA 2N9DA 2JQKA 5DABA 3WAKA 1JNZA 2H7OA 3OYZA 1FMWA 5ETWA 3T8OA 3T1YT 4HFCA 4ILAA 2D5UA 3GASA 3K8PC 3LJCA 2XAQB 5AQOB 4CZZB 3ZMVB 3RYFE 1XWMA 1KK7A 4U3CA 1BR0A 2UU9T 2VPAA 2CLYB 1ZHCA 3U3IA 2VKOA 2IC6A 2C5KT 3UU3A 1D1AA 3ZCIA 1U5PA 4HFDA 1IBLT 2DL1A 2L3LA 1CHUA 4HFEA 2JJ9A 4YTMA 4O4HE 3V5UA 3A6QA 5TAOA 5L4EA 2ZMAA 4EYYR 2DI4A 2RPAA 4KP3C 4U2YA 2XSBA 2MOZA 2XQ5A 4P1NA 5LXTE 1YXRA 4IL9A 4HMTA 4YXDA 4PJJA 5E0OA 4IRAA 1XXOA 3VY5A 3BPKA 4I43B 1MIWA 4PW8A 2H3RA 2Q9QB 5JTGA 4LF4T 3N9PA 2D38A 1XZYA 4EZHA 4IDOA 1I6ZA 2IIUA 3VR9A 2CLYC 3PUGA 3D0TA 1Z8UA 2HHZA 3U34A 1MNEA 1KNZA 4F6RC 1GQEA 2WMOA 4JUYA 2DHRA 2GJGA 4F8HA 3CKDA 3OYXA 3WI3A 3RIUC 3ZCJA 1NENA 2YOEA 4HTEA 4GKKT 2XAFB 4HFIA 4OK0A 2D5MA 2IUBA 3L8RA 1OEDA 5J0ZA 1W3RA 3Q2MA 2WP9A 2W61A 2X0YA 3P8CD 2R0XA 2X67A 5IUXA 4QKNA 4P0AA 3ANWA 3IBPA 4DUYT 2XPKA 3GMIA 3LG7A 2K9AA 3CK6A 4H9RC 3TLWA 5LHGB 4YSXA 2W62A 3PU8A 2M6BA 3VR8A 3F57A 3I0OA 2XQ3A 2BS3A 2BBHA 2LOPA 2EHOA 2VL8A 2WM9A 1ZOYA 2CA5A 3LSVA 4A98A 4MBQA 2X0HA 3F2EA 3SFEA 5HWXA 2YINA 4LFCT 4XJ2A 1IBKT 3AE2A 3NZPA 4N78D 3EI0A 1WYCA 4WBOA 4HFHA 2LOSA 2BG9A 4XBFB 2HTDA 3RRCA 1NRGA 3PUSA 3JADA 2W0GA 3PUQA 5ESCA 3AEEA 3R6NA 4TZ4C 2X9HA 4AIUA 2WSSV 3QK6A 3VYAA 2AQ6A 1KFYA 3KINB 3TLUA 3OPCA 4H9SE 4TNWA 2L9QA 3MA9A 1WRDA 1XDOA 3Q5DA 4C91A 2R6VA 2W63A 2BZBA 3A6RA 5JRCA 3W15B 3ZYKA 2QYWA 1G77A 4ILCA 5FYMA 4KX6A 1W3PA 1OWAA 3ZMTB 2VQET 2FBWA 4QWNB 3PJAA 4EIWA 1T8BA 2X9YA 2X9XA 2MYSA 5HCMA 3F7EA 4DR4T 4EEDA 4ZI3C 2I51A 5DQWA 2XAHB 4JI4T 2ES0A 3RIFA 5CHOA 3RYHE 2D9DA 4O4LE 3O9XA 4O4IE 4IE4A 2ED4A 4FJOA 3N2GE 3N2KE 3UU5A 4QH1A 4ZS3A 2KINB 3EAMA 3UQ7A 2X0LB 4KBMB 3JC6D 3L39A 2HQ7A 1Y64B 3L09A 5JR9B 4DMVA 2NTXA 1OEDB 4YWNA 3UQ4A 4LMKA 3GA8A 1HNXT 3A7MA 3K86A 4PFPA 2XM2A 2QRXA 2OL5A 4ZZBA 2G0UA 3C64A 3SOLA 2UUCT 2QVAA 3ANWB 3JCFA 3N9QA 2E9XD 2CCQA 3RGLA 4NIQA 3J7Yq 4PK5A 3A8YC 1YQ4A 4P0BA 3R5PA 2WB5A 4OX9T 1IJ6A 1HX8A 3ZKRA 3DNHA 2BKNA 2EHOB 3UUBA 4ZEYA 2BBJA 2K4QA 4C90A 1N33T 4EAHA 3QNUA 3T1HT 3N5LA 4X66T 4HMVA 3Q9DA 2OLTA 5AQTB 2XQAA 2BG9B 3TLSA 3AEBA 3N9OA 4L5GA 5JR9C 3ZT6A 2XTLA 1OEDC 1FMVA 3ONLC 5J2TE 1TY9A 4X20E 2ODVA 4H63H 2J62A 2N1GA 3P4WA 3U5WA 2LM9A 4H9NC 1DU2A 3P4RA 3O4XE 1QLBA 4E7SA 4A5XA 4X65T 4O2BE 3V5SA 2AXDS 1HF8A 3CIRA 5HXHA 3I9YA 2LRLA 3JAEA 3RC8A 4ZHQE 2SPCA 4IGUA 3ONJA 3AE4A 5LHHB 2EHOC 5AQPB 5J1GA 4EYUA 2X1KA 4UVBB 2MBGA 2JPFA 3R5LA 3QUJA 3QC9A 2LT3A 3LK42 1WYBA 2GK9A 1YKHB 5CA0E 2RP4A 4PFOA 4UF0B 4W64A 2W66A 4GK0E 3OKQA 5FY0A 4YTNA 4DNDA 2BG9C 2V7LA 1N36T 2VWAA 2V7IA 2V26A 4OHFA 4DVDA 4EGWA 2D0TA 1UCUA 3NWIA 5LG4A 3K3NA 5LNKA 4AQGA 5LBMA 1IZNB 5C8YE 4X64T 1UK5A 2XQ4A 3P4QA 1BR1A 4H9OC 3NFWA 4IHJE 2ECRA 1MNDA 3AA0B 1HX1B 2Y8DA 3P4SA 2YK0A 1SE7A 2Q9QA 2B76A 4PJLA 3PUAA 2KXPB 3PUWF 2UXNB 4CI3B 4XAXB 1YW0A 1UUSA 1HTJF 3BNKA 3KVAA 1IBMT 2GUJA 2V8SV 2NR4A 2CMRA 1WV4A 2CXLA 1I94T 4LF9T 1IJ5A 4UHVA 1NEKA 3FZFB 1DNLA 1UX4A 3CX8B 3ESLA 5AQKB 4LMLA 4JI1T 1RZ1A 4B3TT 4DR1T 4ZI2C 1LKXA 1T9MA 5F3JA 4Z8XA 4AKGA 4ADZA 4I4TE 2DWGA 3EHZA 4ANJA 5AQRB 1SHZC 4CXWA 4YT0A 4UV8B 4JEUB 1I0RA 4HMUA 3RC3A 3K1SA 4DUZT 2YDSA 4LF8T 5LGNB 3M65A 3ONXA 1YQ3A 3H37A 3UUMA 5CHEC 2ZM8A 4EB6E 2WDRA 4L0RA 4NXMT 4K0UA 5LJMA 3BK9A 5AQHB 2W67A 2PTFA 2PG8A 4H9QC 1X79A 4UEMA 2IDOB 4Z91A 4PJNA 5H6RB 3HI2A 5ABEA 3ZJ2A 4X1KE 5HEJA 5J2UE 3RIAA 2KZ7B 1NWMX 5LGUB 3RQUA 3FB2A 1N32T 3ZOCA 2VKJA 4H63V 2XASB 1Z0PA 4MLKA 2ZLYA 2FHQA 3L3PA 5L3FB 3VRBA 2OA5A 1HR0T 3RKGA 3E4VA 3AA7B 5AQVB 4HKHA 1D1BA 3C98B 5HXRA 2BKOA 5AQMB 1W9AA 4IL4A 4IE7A 3K88A 3UFGA 2ACXA 3EAAA 2H88A 4ASKA 2IC9A 5H6QB 1YD8G 3I0QA 1E2AA 3C4XA 4DV3T 1E1HB 1XHNA 4DR3T 3FZMB 4Y9IA 3KDSE 2N2NA 5JDMA 2P9BA 4A97A 4P09A 4YY3T 1XNQT 1HG5A 2E83A 1M62A 3J9X1 2UXXB 4AI6A 5JR9A 2UUBT 4U33A 1WLIA 3C4WA 1MMNA 4LF5T 1S35A 4PJMA 3AWHA 1Y01A 4E7ZA 2Q9QC 4OYJA 4QVBA 2QEAA 5AQQB 2FJAA 4QH4A 3UUXB 2XZEA 2QGSA 3AVRA 2VQFT 2VASA 3AVSA 5LGTB 3H96A 5FXVA 2V6XA 3AA6B 4B3RT 1H7CA 2ZM0A 3K3QC 3Q5EA 5JVDE 4AKHA 3CQCB 3U0IA 2DNXA 4HFVA 2LKHA 1WGBA 2ZM6T 4X1YE 1FJGT 3OJAA 3VKGA 4AQFA 1KF6A 4DMWA 2WY2A 2K5BB 3VRAA 4L9IA 2A9UA 2XAJB 3HY8A 2CXDA 3ZMZB 5FXZA 3MJXA 4DO0A 4HX6A 3VY2A 2BDEA 5HXCA 3FGEA 2HH7A 3LBXA 4OYKA 5HYAA 3U35A 3ZC0A 4QX7B 4HN9A 1WLXA 3TLVA 5BNCA 2LHNA 3ZOHA 4B3ST 3AE5A 2VVSA 3DP7A 3NRYA 3RYIE 2D37A 2BS2A 5JDHA 2LSKA 5KDMC 4Z85A 2NOXA 4ISSA 5AQJB 3IF8B 3KFWX 2B1EA 3V4HA 2W2UA 4B3MT 4HMSA 2LM2A 3LK2B 3NBXX 2JMKA 1MIYA 3KV5A 3QB5A 4YJ3E 2I0MA 2CHNA 1RZ0A 3RLFF 4UF0A 2Q9QD 3A20A 3IN6A 4IDNA 5FL1A 2E8IA 2ASFA 3KV4A 2YEVC 3AECA 5FY1A 1SUMB 4NUVA 2C5IT 4DR5T 1V9DA 4PK6A 3PUVF 5LMUT 3RH3A 5GONE 2KMFA 5LA6E 2W00A 2WCAA 4ZOLE 4HE8A 2A3DA 4KUMB 4B6XA 2NWBA 1EJEA 4DV2T 1ZEEA 2CBJA 2Q9KA 1AJ3A 2CPTA 4O8SA 2C0SA 4JLEA 3F31A 4ISTA 3UUNA 2DLRA 2W4XA 3I1AA 4CI1B 2HPJA 3N9NA 2YU1A 3RKOA 1W09A 3ZODA 3A5XA 4PNIA 3CX7B 2PFVA 2WQYA 4ZXLA 5DJQC 4O4JE 4GOUA 4WYVA 3S4UA 3ZOGA 4QH5A 3ZYMA 4LMJA 3EDUA 4G2AA 3PFTA 2I6HA 4HWHA 1CI0A 3PUXF 2K48A 1Y12A 4AXPA 3LBXB 4ZI3D 2LHRA 3AXJA 5ADXL 2X68A 2I02A 2RA1A 2A2JA 4GIWA 3HKCE 2CWOA 4WW0A 5AQLB 3PTRB 1D0ZA 4X5TA 2IAKA 3KYFA 2FJDA 2LSJA 5HEGA 5JDNA 4HWFA 4TWFA 5AFUL 5LP6E 4HWDA 2ARZA 2FJBA 4CN6A 2UUAT 2KWIB 4BJMA 3UT5E 2LE8A 2Y6XA 4NUUA 4AQFC 5FNVE 1O3XA 3IA3A 5ABGA 2KLQA 3FHNA 3R84B 5EZYE 4HGAA 3E08A 3HKBE 3FZKB 3ZLIA 1US7B 3KV6A 2HN2A 5AQIB 3HA4A 2KWHA 1YOAA 4JI2T 3DMBA 3OVUA 4UVAB 1MMGA 2YKSA 1T98A 2IHR1 4JV5T 4JEHB 3RYCE 3Q5XA 2WWUA 2WWVA 1NAFA 3AMFA 1IAPA 5CB4E 4HMWA 1CUNA 5HAXA 3TKLB 2X51A 2HHHT 4HEAA 4TX5A 5L3DB 1XMOT 1HNWT 4G63A 2BS4A 2WU5A 5FP3A 4HMXA 4DV1T 4GKJT 2J4GA 1S94A 2F4VT 2LSGA 3FZLB 3HR0A 1UGOA 5FVLA 1VRBA 3PUZF 1WCRA 1J1JA 3LFMA 3AEDA 2V6YB 5LJNA 3G06A 5JDQA 1RFEA 5KX5E 5L47A 4BJNA 3AEAA 4DIDB 3VU7H 4IE5A 4ZI7E 3ABVA 5HWYA 3P50A 2XM1A 2D2SA 4M1PA 4MFRA 4V1Av 2EHOD 4AKIA 2IABA 3AXJB 3O1HA 5LOVE 2ODUA 2DCFA 2V5CA 5AQGB 5BR8T 4ZS2A 4WNKA 2BVMA 2E9XA 4DBRA 4IT4A 3EABA 3EUHA 4COFA 1L0VA 4QX8B 4TN7B 5AQFB 4F07A 2HN1A 1YKEB 2WU2A 2WMNA 4TWHA 4LFBT 4I0UA 1MMDA 4YTPA 4YHHT 4JI0T 4CI2B 4YHJA 4ILBA 2E5LT 3ZPOA 4UV9B 3TGVA 3VHLA 4DV4T 2JQHA 5CGMA 3FZHB 3DB0A 4I55E 4QXHB 3MZKB 4X1IE 2LSYA 3M3ZB 4GYSA 3BQLA 1HCIA 2LEHA 4QHOA 2ACZA 4EZ4A 2LJLA 2V5DA 2L8KA 1XDPA 2KT9A 3PURA 4QXBB 2ZM2A 4HKAA 3AEGA 4EXTA 1HFAA 2UXCT 2E2AA 4LFAT 3EVYA 4HFBA 4DV0T 3RX6A 5IYZE 4AKLA 4BA9A 1FLMA 4IE0A 4IDPA 4ERRA 3EDVA 3ZSTA 5LBQB 2WAUA 2HTIA 1HG2A 5AQNB 2VURA 2A72A 1W0AA 2RDEA 4A56A 4YFSA 2WZIA 5JQGE 3HKEE 4L82A 4U74A 3ZYLA 3H3AA 1D0YA 2CXFA 3QOFA 4YJ2E 3PDYA 2VK9A 4IDQA 3SRZA 1WR0A 4ZI2D 2XHEB 1VCSA 1KNRA 2PJQA 4N7RC 2DWKA 3GN5A 1M7KA 3H3MA 4AISA 2L1TA 5M4YA 2M67A 2R6GF 2XSAA 5FMNA 5LCYA 4WBNE 5CFBA 3MKDA 4MHCA 3CQGB 4LF7T 3LK3B 2A2FX 1USCA 2PBIA 3ETVA 2H89A 3AAAB 4ZZCA 5HXSA 2K24A 4U31A 4EV6A 2J1DG 1YLNA 2E9XB 5FXXA 2LLYA 5JREA 5KXJA 5FY7A 2X66A 3AAEB 2VVNA 4O2AE 3B13A 4TV4A 5L3EB 4CQIA 1LVFA 3RH7A 1J5ET 5L4HA 5LMNT 3CWZB 2XQ8A 1MMAA 5JH7E 5HXEA 3E22E 2WS3A 2V7MA 4CN1A 3SWJA 4NPPA 3AE9A 3N2OA 5L3CB 3AE8A 3JC6C 5A1LA 4UXNB 3KBUA 3GWHA 2BVLA 3CQXC 5FL0A 3MACA 3FKHA 2HQ9A 2QA7A 1BR2A 4I50E 3AE7A 4DV6T 4KI0F 3X1DA 3U78A 4UR9A 5AQSB 4TV8E 1Y30A 1KEYA 2E9XC 3MK7C 2VB6A 1D1CA 3HL6A 4KMCA 4JI8T 1OEDE 2FUPA 3OTOT 3CVRA 1U4QA 4LF6T 3UFEA 3PJAJ 3AE3A 1WFDA 2X9WA 2LSIA 5F8PA 5LYJE 5EK2A 1ZV4X 2YDQA 2CWYA 5C2TA 1HS7A 2NW7A 2WDQA 3B57A 1FEWA 1OXZA 5HEHA 1R8IA 3AE6A 4JI5T 3ZMUB 3RHWA 3HKDE 2P5ZX 1UURA 2V7KA 2K3WA 1QUUA 5JDFA 2OU5A 3C4ZA 5JABA 4DV7T 2V1DB 4R82A 3AA1B 1EZ3A 3FXEB 3GN5B 3I9WA 3BA3A 2XUEA 4YBNA 4YSZA 1SA0E 2BKPA 4HWCA 3N9LA 4MTKA 1WR6A 4DBQA 2CHOA 4U7IA 3PV0F 3UTKA 2BG9E 4AKRB 4HWIB 3ZT7A 2I59A 3ETUA 4YSYA 2Y48B 3PE0A 4PAGA 2KSRA 5FXWA 1W9RA 1N34T 2WZHA 2NP9A 3P4PA 3R5ZA 4IIJE 5CJ5A 5JDLA 2LKGA 2FURA 4UVCB 5F5WA 5HEOA 3N9MA 1J5WA 2J47A 3CX6B 2YU2A 3UU6A 2JMHA 4JBWF 2IW5B 3O1JA 3DJBA 2FG9A 1VOMA 3E0ZA 1E7PA 3SFDA 2XY8B 2MPKA 2CRBA 1QSDA 2UXBT 3FBZA 5IWAT 4WZXA 1G76A 3NRXA 4PK4A 3DTOA 3C50A 3TLTA 4Z90A 4CXXA 4TUYE 3OBVE 3O1IA 2V6YA 4FI5A 4U72A 4JI6T 1B7TA 5LHIB 5FVKA 3UU8A 4DV5T 3WAJA 3ZN0B 1BR4A 1G73A 4QXCB 3LDQB 3AEFA 4UIGA 3MXZA 3FXDB 1XNRT 3AE1A 3IHRA 3SWHA 3ZT5A 1JNWA 3ZOEA 2OV9A 1JNRA 3KVBA 5EK4A 3UULA 5ABFA 2XAGB 4TV9E 2XQ9A 2IG6A 3RI5A 2XJ7A 2C5JA 3AB3B 3Q5WA 3RF1A 2RE7A 3CMLA 5L3BB 5EK3A 3R5WA 1G8XA 5KMGP 3AAIA 2HPLA 3RQWA 3PU3A 3NKZA 2M6IA 2V7JA 3R5RA 4UELA 4H9PC 1UX5A 3NVOA 4YLHA
chains in the Genus database with same CATH topology
1X9BA 1YOAA 3F7EA 1I0SA 3NFWA 3ZODA 2ECRA 2I51A 5BNCA 1WLKA 3ZOHA 3A6QA 3DMBA 1USFA 1TY9A 2PTFA 1Y30A 5CHOA 2D36A 1G79A 2E83A 4F07A 2FG9A 4N7RC 2D37A 3AMFA 3U5WA 4HMWA 2IMLA 3ZOGA 2ED4A 4Z85A 1AXJA 1WLIA 3HMZA 4HMTA 3AWHA 4HMSA 1G76A 2HQ7A 3ZOCA 3PFTA 4IRAA 1XXOA 3VY5A 3BPKA 3ZOFA 1USCA 4QVBA 2QEAA 1CI0A 3TGVA 2ECUA 2FHQA 1RZ0A 1VL7A 4YWNA 2X1JA 3BNKA 2QCKA 3DB0A 2D38A 3A20A 3E4VA 3IN6A 2NR4A 4HMXA 1G78A 3H96A 3K86A 4XJ2A 1WV4A 3K87A 2X1KA 2I02A 2OL5A 1YLNA 4XHYA 3R5LA 2ASFA 2A2JA 2HTDA 1W9AA 1NRGA 2OU5A 3U0IA 5JABA 3EC6A 1DNLA 2HHZA 3R5YA 3K88A 3U34A 4R82A 5ESCA 3RH7A 3KYFA 1RFEA 3BA3A 3GASA 4YBNA 2GJGA 3B5MA 1WGBA 3R5PA 1JNWA 3ZOEA 1RZ1A 3VYAA 3CP3A 1EJEA 2AQ6A 1FLMA 2ARZA 1W3OA 2IG6A 1T9MA 3DNHA 1XHNA 2Q9KA 2R6VA 3SWJA 4ZKYA 2RE7A 2HTIA 3A6RA 4Y9IA 1W3QA 3HY8A 3KYGA 2VPAA 4L82A 2IABA 1G77A 3CB0A 3R5WA 2D5MA 2RDEA 1I0RA 4HMUA 1W3PA 4HX6A 3VY2A 1W3RA 3FGEA 3FKHA 3R5ZA 4HMVA 2HQ9A 3U35A 5CHEC 3R5RA 2R0XA 2FURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X9B A;  1YOA A;  3F7E A;  1I0S A;  3NFW A;  3ZOD A;  2ECR A;  2I51 A;  5BNC A;  1WLK A;  3ZOH A;  3A6Q A;  3DMB A;  1USF A;  1TY9 A;  2PTF A;  1Y30 A;  5CHO A;  2D36 A;  1G79 A;  2E83 A;  4F07 A;  2FG9 A;  4N7R C;  2D37 A;  3AMF A;  3U5W A;  4HMW A;  2IML A;  3ZOG A;  2ED4 A;  4Z85 A;  1AXJ A;  1WLI A;  3HMZ A;  4HMT A;  3AWH A;  4HMS A;  1G76 A;  2HQ7 A;  3ZOC A;  3PFT A;  4IRA A;  1XXO A;  3VY5 A;  3BPK A;  3ZOF A;  1USC A;  4QVB A;  2QEA A;  1CI0 A;  3TGV A;  2ECU A;  2FHQ A;  1RZ0 A;  1VL7 A;  4YWN A;  2X1J A;  3BNK A;  2QCK A;  3DB0 A;  2D38 A;  3A20 A;  3E4V A;  3IN6 A;  2NR4 A;  4HMX A;  1G78 A;  3H96 A;  3K86 A;  4XJ2 A;  1WV4 A;  3K87 A;  2X1K A;  2I02 A;  2OL5 A;  1YLN A;  4XHY A;  3R5L A;  2ASF A;  2A2J A;  2HTD A;  1W9A A;  1NRG A;  2OU5 A;  3U0I A;  5JAB A;  3EC6 A;  1DNL A;  2HHZ A;  3R5Y A;  3K88 A;  3U34 A;  4R82 A;  5ESC A;  3RH7 A;  3KYF A;  1RFE A;  3BA3 A;  3GAS A;  4YBN A;  2GJG A;  3B5M A;  1WGB A;  3R5P A;  1JNW A;  3ZOE A;  1RZ1 A;  3VYA A;  3CP3 A;  1EJE A;  2AQ6 A;  1FLM A;  2ARZ A;  1W3O A;  2IG6 A;  1T9M A;  3DNH A;  1XHN A;  2Q9K A;  2R6V A;  3SWJ A;  4ZKY A;  2RE7 A;  2HTI A;  3A6R A;  4Y9I A;  1W3Q A;  3HY8 A;  3KYG A;  2VPA A;  4L82 A;  2IAB A;  1G77 A;  3CB0 A;  3R5W A;  2D5M A;  2RDE A;  1I0R A;  4HMU A;  1W3P A;  4HX6 A;  3VY2 A;  1W3R A;  3FGE A;  3FKH A;  3R5Z A;  4HMV A;  2HQ9 A;  3U35 A;  5CHE C;  3R5R A;  2R0X A;  2FUR A; 
#chains in the Genus database with same CATH topology
 1X9B A;  1I0S A;  5LB7 B;  5JRC B;  1D0X A;  3HE1 A;  4EEB A;  1USF A;  2KND A;  3UU4 A;  2VKH A;  2D36 A;  2NW8 A;  2MTQ A;  3QB5 K;  1ZKE A;  2IML A;  3ZC1 A;  2JRK A;  3JAF A;  4AQY T;  3BQK A;  1AXJ A;  5CA1 E;  2WDV A;  3KV9 A;  4DR7 T;  2CEA A;  5AQU B;  2JQ9 A;  1MIV A;  3ZSS A;  2AE9 A;  2ECU A;  3RPU A;  4TNV A;  3CPZ A;  4JI3 T;  5C3J A;  1VL7 A;  2FJE A;  2X1J A;  2QCK A;  1T72 A;  3K87 A;  2YN6 A;  5JDG A;  4XHY A;  4NXN T;  5HEU A;  2MAW A;  5FKY A;  5L2L A;  1KNP A;  5IHY A;  3ZJ1 A;  3EC6 A;  3R5Y A;  3VKH A;  3NZQ A;  3SS1 A;  2XQ6 A;  3P7I A;  4ILU A;  3RIU A;  1ZP0 A;  2NTY A;  4IRE A;  3B5M A;  2CM0 A;  4IDZ A;  3CP3 A;  2E5V A;  2YDR A;  2CE7 A;  4XZC A;  1W3O A;  4DR2 T;  4IE6 A;  4U7Y A;  4KHP T;  2XQ7 A;  3ZMS B;  4ZKY A;  2D0U A;  4EOZ B;  1XMQ T;  2Z6E A;  5BMV E;  1W3Q A;  3KYG A;  2XQY A;  3CB0 A;  3RRW A;  4CN4 A;  4MAL A;  2NW9 A;  2VL0 A;  3ZN1 B;  4GYR A;  4GK5 E;  4KHZ F;  1T7S A;  3C51 A;  1HNZ T;  4JYA T;  3FBL A;  2WBL A;  3KBT A;  1WLK A;  4J2C A;  1FIO A;  1G79 A;  1LVK A;  3ZEF B;  5ABF B;  5DQV A;  2CBI A;  2LRK A;  4TWD A;  5L3G B;  1W0B A;  3HMZ A;  1LRZ A;  3IEE A;  4X62 T;  5ABH A;  3BQI A;  3PUY F;  4Q25 A;  4OFZ A;  4K0K T;  3ZOF A;  4U2Z A;  2VKD A;  3K3O A;  5HCJ A;  4CXY A;  2JIW A;  4JI7 T;  4DR6 T;  2UXD T;  1G78 A;  2H7V C;  5LG3 A;  2JQQ A;  4BAY B;  1VCT A;  2N9D A;  2JQK A;  5DAB A;  3WAK A;  1JNZ A;  2H7O A;  3OYZ A;  1FMW A;  5ETW A;  3T8O A;  3T1Y T;  4HFC A;  4ILA A;  2D5U A;  3GAS A;  3K8P C;  3LJC A;  2XAQ B;  5AQO B;  4CZZ B;  3ZMV B;  3RYF E;  1XWM A;  1KK7 A;  4U3C A;  1BR0 A;  2UU9 T;  2VPA A;  2CLY B;  1ZHC A;  3U3I A;  2VKO A;  2IC6 A;  2C5K T;  3UU3 A;  1D1A A;  3ZCI A;  1U5P A;  4HFD A;  1IBL T;  2DL1 A;  2L3L A;  1CHU A;  4HFE A;  2JJ9 A;  4YTM A;  4O4H E;  3V5U A;  3A6Q A;  5TAO A;  5L4E A;  2ZMA A;  4EYY R;  2DI4 A;  2RPA A;  4KP3 C;  4U2Y A;  2XSB A;  2MOZ A;  2XQ5 A;  4P1N A;  5LXT E;  1YXR A;  4IL9 A;  4HMT A;  4YXD A;  4PJJ A;  5E0O A;  4IRA A;  1XXO A;  3VY5 A;  3BPK A;  4I43 B;  1MIW A;  4PW8 A;  2H3R A;  2Q9Q B;  5JTG A;  4LF4 T;  3N9P A;  2D38 A;  1XZY A;  4EZH A;  4IDO A;  1I6Z A;  2IIU A;  3VR9 A;  2CLY C;  3PUG A;  3D0T A;  1Z8U A;  2HHZ A;  3U34 A;  1MNE A;  1KNZ A;  4F6R C;  1GQE A;  2WMO A;  4JUY A;  2DHR A;  2GJG A;  4F8H A;  3CKD A;  3OYX A;  3WI3 A;  3RIU C;  3ZCJ A;  1NEN A;  2YOE A;  4HTE A;  4GKK T;  2XAF B;  4HFI A;  4OK0 A;  2D5M A;  2IUB A;  3L8R A;  1OED A;  5J0Z A;  1W3R A;  3Q2M A;  2WP9 A;  2W61 A;  2X0Y A;  3P8C D;  2R0X A;  2X67 A;  5IUX A;  4QKN A;  4P0A A;  3ANW A;  3IBP A;  4DUY T;  2XPK A;  3GMI A;  3LG7 A;  2K9A A;  3CK6 A;  4H9R C;  3TLW A;  5LHG B;  4YSX A;  2W62 A;  3PU8 A;  2M6B A;  3VR8 A;  3F57 A;  3I0O A;  2XQ3 A;  2BS3 A;  2BBH A;  2LOP A;  2EHO A;  2VL8 A;  2WM9 A;  1ZOY A;  2CA5 A;  3LSV A;  4A98 A;  4MBQ A;  2X0H A;  3F2E A;  3SFE A;  5HWX A;  2YIN A;  4LFC T;  4XJ2 A;  1IBK T;  3AE2 A;  3NZP A;  4N78 D;  3EI0 A;  1WYC A;  4WBO A;  4HFH A;  2LOS A;  2BG9 A;  4XBF B;  2HTD A;  3RRC A;  1NRG A;  3PUS A;  3JAD A;  2W0G A;  3PUQ A;  5ESC A;  3AEE A;  3R6N A;  4TZ4 C;  2X9H A;  4AIU A;  2WSS V;  3QK6 A;  3VYA A;  2AQ6 A;  1KFY A;  3KIN B;  3TLU A;  3OPC A;  4H9S E;  4TNW A;  2L9Q A;  3MA9 A;  1WRD A;  1XDO A;  3Q5D A;  4C91 A;  2R6V A;  2W63 A;  2BZB A;  3A6R A;  5JRC A;  3W15 B;  3ZYK A;  2QYW A;  1G77 A;  4ILC A;  5FYM A;  4KX6 A;  1W3P A;  1OWA A;  3ZMT B;  2VQE T;  2FBW A;  4QWN B;  3PJA A;  4EIW A;  1T8B A;  2X9Y A;  2X9X A;  2MYS A;  5HCM A;  3F7E A;  4DR4 T;  4EED A;  4ZI3 C;  2I51 A;  5DQW A;  2XAH B;  4JI4 T;  2ES0 A;  3RIF A;  5CHO A;  3RYH E;  2D9D A;  4O4L E;  3O9X A;  4O4I E;  4IE4 A;  2ED4 A;  4FJO A;  3N2G E;  3N2K E;  3UU5 A;  4QH1 A;  4ZS3 A;  2KIN B;  3EAM A;  3UQ7 A;  2X0L B;  4KBM B;  3JC6 D;  3L39 A;  2HQ7 A;  1Y64 B;  3L09 A;  5JR9 B;  4DMV A;  2NTX A;  1OED B;  4YWN A;  3UQ4 A;  4LMK A;  3GA8 A;  1HNX T;  3A7M A;  3K86 A;  4PFP A;  2XM2 A;  2QRX A;  2OL5 A;  4ZZB A;  2G0U A;  3C64 A;  3SOL A;  2UUC T;  2QVA A;  3ANW B;  3JCF A;  3N9Q A;  2E9X D;  2CCQ A;  3RGL A;  4NIQ A;  3J7Y q;  4PK5 A;  3A8Y C;  1YQ4 A;  4P0B A;  3R5P A;  2WB5 A;  4OX9 T;  1IJ6 A;  1HX8 A;  3ZKR A;  3DNH A;  2BKN A;  2EHO B;  3UUB A;  4ZEY A;  2BBJ A;  2K4Q A;  4C90 A;  1N33 T;  4EAH A;  3QNU A;  3T1H T;  3N5L A;  4X66 T;  4HMV A;  3Q9D A;  2OLT A;  5AQT B;  2XQA A;  2BG9 B;  3TLS A;  3AEB A;  3N9O A;  4L5G A;  5JR9 C;  3ZT6 A;  2XTL A;  1OED C;  1FMV A;  3ONL C;  5J2T E;  1TY9 A;  4X20 E;  2ODV A;  4H63 H;  2J62 A;  2N1G A;  3P4W A;  3U5W A;  2LM9 A;  4H9N C;  1DU2 A;  3P4R A;  3O4X E;  1QLB A;  4E7S A;  4A5X A;  4X65 T;  4O2B E;  3V5S A;  2AXD S;  1HF8 A;  3CIR A;  5HXH A;  3I9Y A;  2LRL A;  3JAE A;  3RC8 A;  4ZHQ E;  2SPC A;  4IGU A;  3ONJ A;  3AE4 A;  5LHH B;  2EHO C;  5AQP B;  5J1G A;  4EYU A;  2X1K A;  4UVB B;  2MBG A;  2JPF A;  3R5L A;  3QUJ A;  3QC9 A;  2LT3 A;  3LK4 2;  1WYB A;  2GK9 A;  1YKH B;  5CA0 E;  2RP4 A;  4PFO A;  4UF0 B;  4W64 A;  2W66 A;  4GK0 E;  3OKQ A;  5FY0 A;  4YTN A;  4DND A;  2BG9 C;  2V7L A;  1N36 T;  2VWA A;  2V7I A;  2V26 A;  4OHF A;  4DVD A;  4EGW A;  2D0T A;  1UCU A;  3NWI A;  5LG4 A;  3K3N A;  5LNK A;  4AQG A;  5LBM A;  1IZN B;  5C8Y E;  4X64 T;  1UK5 A;  2XQ4 A;  3P4Q A;  1BR1 A;  4H9O C;  3NFW A;  4IHJ E;  2ECR A;  1MND A;  3AA0 B;  1HX1 B;  2Y8D A;  3P4S A;  2YK0 A;  1SE7 A;  2Q9Q A;  2B76 A;  4PJL A;  3PUA A;  2KXP B;  3PUW F;  2UXN B;  4CI3 B;  4XAX B;  1YW0 A;  1UUS A;  1HTJ F;  3BNK A;  3KVA A;  1IBM T;  2GUJ A;  2V8S V;  2NR4 A;  2CMR A;  1WV4 A;  2CXL A;  1I94 T;  4LF9 T;  1IJ5 A;  4UHV A;  1NEK A;  3FZF B;  1DNL A;  1UX4 A;  3CX8 B;  3ESL A;  5AQK B;  4LML A;  4JI1 T;  1RZ1 A;  4B3T T;  4DR1 T;  4ZI2 C;  1LKX A;  1T9M A;  5F3J A;  4Z8X A;  4AKG A;  4ADZ A;  4I4T E;  2DWG A;  3EHZ A;  4ANJ A;  5AQR B;  1SHZ C;  4CXW A;  4YT0 A;  4UV8 B;  4JEU B;  1I0R A;  4HMU A;  3RC3 A;  3K1S A;  4DUZ T;  2YDS A;  4LF8 T;  5LGN B;  3M65 A;  3ONX A;  1YQ3 A;  3H37 A;  3UUM A;  5CHE C;  2ZM8 A;  4EB6 E;  2WDR A;  4L0R A;  4NXM T;  4K0U A;  5LJM A;  3BK9 A;  5AQH B;  2W67 A;  2PTF A;  2PG8 A;  4H9Q C;  1X79 A;  4UEM A;  2IDO B;  4Z91 A;  4PJN A;  5H6R B;  3HI2 A;  5ABE A;  3ZJ2 A;  4X1K E;  5HEJ A;  5J2U E;  3RIA A;  2KZ7 B;  1NWM X;  5LGU B;  3RQU A;  3FB2 A;  1N32 T;  3ZOC A;  2VKJ A;  4H63 V;  2XAS B;  1Z0P A;  4MLK A;  2ZLY A;  2FHQ A;  3L3P A;  5L3F B;  3VRB A;  2OA5 A;  1HR0 T;  3RKG A;  3E4V A;  3AA7 B;  5AQV B;  4HKH A;  1D1B A;  3C98 B;  5HXR A;  2BKO A;  5AQM B;  1W9A A;  4IL4 A;  4IE7 A;  3K88 A;  3UFG A;  2ACX A;  3EAA A;  2H88 A;  4ASK A;  2IC9 A;  5H6Q B;  1YD8 G;  3I0Q A;  1E2A A;  3C4X A;  4DV3 T;  1E1H B;  1XHN A;  4DR3 T;  3FZM B;  4Y9I A;  3KDS E;  2N2N A;  5JDM A;  2P9B A;  4A97 A;  4P09 A;  4YY3 T;  1XNQ T;  1HG5 A;  2E83 A;  1M62 A;  3J9X 1;  2UXX B;  4AI6 A;  5JR9 A;  2UUB T;  4U33 A;  1WLI A;  3C4W A;  1MMN A;  4LF5 T;  1S35 A;  4PJM A;  3AWH A;  1Y01 A;  4E7Z A;  2Q9Q C;  4OYJ A;  4QVB A;  2QEA A;  5AQQ B;  2FJA A;  4QH4 A;  3UUX B;  2XZE A;  2QGS A;  3AVR A;  2VQF T;  2VAS A;  3AVS A;  5LGT B;  3H96 A;  5FXV A;  2V6X A;  3AA6 B;  4B3R T;  1H7C A;  2ZM0 A;  3K3Q C;  3Q5E A;  5JVD E;  4AKH A;  3CQC B;  3U0I A;  2DNX A;  4HFV A;  2LKH A;  1WGB A;  2ZM6 T;  4X1Y E;  1FJG T;  3OJA A;  3VKG A;  4AQF A;  1KF6 A;  4DMW A;  2WY2 A;  2K5B B;  3VRA A;  4L9I A;  2A9U A;  2XAJ B;  3HY8 A;  2CXD A;  3ZMZ B;  5FXZ A;  3MJX A;  4DO0 A;  4HX6 A;  3VY2 A;  2BDE A;  5HXC A;  3FGE A;  2HH7 A;  3LBX A;  4OYK A;  5HYA A;  3U35 A;  3ZC0 A;  4QX7 B;  4HN9 A;  1WLX A;  3TLV A;  5BNC A;  2LHN A;  3ZOH A;  4B3S T;  3AE5 A;  2VVS A;  3DP7 A;  3NRY A;  3RYI E;  2D37 A;  2BS2 A;  5JDH A;  2LSK A;  5KDM C;  4Z85 A;  2NOX A;  4ISS A;  5AQJ B;  3IF8 B;  3KFW X;  2B1E A;  3V4H A;  2W2U A;  4B3M T;  4HMS A;  2LM2 A;  3LK2 B;  3NBX X;  2JMK A;  1MIY A;  3KV5 A;  3QB5 A;  4YJ3 E;  2I0M A;  2CHN A;  1RZ0 A;  3RLF F;  4UF0 A;  2Q9Q D;  3A20 A;  3IN6 A;  4IDN A;  5FL1 A;  2E8I A;  2ASF A;  3KV4 A;  2YEV C;  3AEC A;  5FY1 A;  1SUM B;  4NUV A;  2C5I T;  4DR5 T;  1V9D A;  4PK6 A;  3PUV F;  5LMU T;  3RH3 A;  5GON E;  2KMF A;  5LA6 E;  2W00 A;  2WCA A;  4ZOL E;  4HE8 A;  2A3D A;  4KUM B;  4B6X A;  2NWB A;  1EJE A;  4DV2 T;  1ZEE A;  2CBJ A;  2Q9K A;  1AJ3 A;  2CPT A;  4O8S A;  2C0S A;  4JLE A;  3F31 A;  4IST A;  3UUN A;  2DLR A;  2W4X A;  3I1A A;  4CI1 B;  2HPJ A;  3N9N A;  2YU1 A;  3RKO A;  1W09 A;  3ZOD A;  3A5X A;  4PNI A;  3CX7 B;  2PFV A;  2WQY A;  4ZXL A;  5DJQ C;  4O4J E;  4GOU A;  4WYV A;  3S4U A;  3ZOG A;  4QH5 A;  3ZYM A;  4LMJ A;  3EDU A;  4G2A A;  3PFT A;  2I6H A;  4HWH A;  1CI0 A;  3PUX F;  2K48 A;  1Y12 A;  4AXP A;  3LBX B;  4ZI3 D;  2LHR A;  3AXJ A;  5ADX L;  2X68 A;  2I02 A;  2RA1 A;  2A2J A;  4GIW A;  3HKC E;  2CWO A;  4WW0 A;  5AQL B;  3PTR B;  1D0Z A;  4X5T A;  2IAK A;  3KYF A;  2FJD A;  2LSJ A;  5HEG A;  5JDN A;  4HWF A;  4TWF A;  5AFU L;  5LP6 E;  4HWD A;  2ARZ A;  2FJB A;  4CN6 A;  2UUA T;  2KWI B;  4BJM A;  3UT5 E;  2LE8 A;  2Y6X A;  4NUU A;  4AQF C;  5FNV E;  1O3X A;  3IA3 A;  5ABG A;  2KLQ A;  3FHN A;  3R84 B;  5EZY E;  4HGA A;  3E08 A;  3HKB E;  3FZK B;  3ZLI A;  1US7 B;  3KV6 A;  2HN2 A;  5AQI B;  3HA4 A;  2KWH A;  1YOA A;  4JI2 T;  3DMB A;  3OVU A;  4UVA B;  1MMG A;  2YKS A;  1T98 A;  2IHR 1;  4JV5 T;  4JEH B;  3RYC E;  3Q5X A;  2WWU A;  2WWV A;  1NAF A;  3AMF A;  1IAP A;  5CB4 E;  4HMW A;  1CUN A;  5HAX A;  3TKL B;  2X51 A;  2HHH T;  4HEA A;  4TX5 A;  5L3D B;  1XMO T;  1HNW T;  4G63 A;  2BS4 A;  2WU5 A;  5FP3 A;  4HMX A;  4DV1 T;  4GKJ T;  2J4G A;  1S94 A;  2F4V T;  2LSG A;  3FZL B;  3HR0 A;  1UGO A;  5FVL A;  1VRB A;  3PUZ F;  1WCR A;  1J1J A;  3LFM A;  3AED A;  2V6Y B;  5LJN A;  3G06 A;  5JDQ A;  1RFE A;  5KX5 E;  5L47 A;  4BJN A;  3AEA A;  4DID B;  3VU7 H;  4IE5 A;  4ZI7 E;  3ABV A;  5HWY A;  3P50 A;  2XM1 A;  2D2S A;  4M1P A;  4MFR A;  4V1A v;  2EHO D;  4AKI A;  2IAB A;  3AXJ B;  3O1H A;  5LOV E;  2ODU A;  2DCF A;  2V5C A;  5AQG B;  5BR8 T;  4ZS2 A;  4WNK A;  2BVM A;  2E9X A;  4DBR A;  4IT4 A;  3EAB A;  3EUH A;  4COF A;  1L0V A;  4QX8 B;  4TN7 B;  5AQF B;  4F07 A;  2HN1 A;  1YKE B;  2WU2 A;  2WMN A;  4TWH A;  4LFB T;  4I0U A;  1MMD A;  4YTP A;  4YHH T;  4JI0 T;  4CI2 B;  4YHJ A;  4ILB A;  2E5L T;  3ZPO A;  4UV9 B;  3TGV A;  3VHL A;  4DV4 T;  2JQH A;  5CGM A;  3FZH B;  3DB0 A;  4I55 E;  4QXH B;  3MZK B;  4X1I E;  2LSY A;  3M3Z B;  4GYS A;  3BQL A;  1HCI A;  2LEH A;  4QHO A;  2ACZ A;  4EZ4 A;  2LJL A;  2V5D A;  2L8K A;  1XDP A;  2KT9 A;  3PUR A;  4QXB B;  2ZM2 A;  4HKA A;  3AEG A;  4EXT A;  1HFA A;  2UXC T;  2E2A A;  4LFA T;  3EVY A;  4HFB A;  4DV0 T;  3RX6 A;  5IYZ E;  4AKL A;  4BA9 A;  1FLM A;  4IE0 A;  4IDP A;  4ERR A;  3EDV A;  3ZST A;  5LBQ B;  2WAU A;  2HTI A;  1HG2 A;  5AQN B;  2VUR A;  2A72 A;  1W0A A;  2RDE A;  4A56 A;  4YFS A;  2WZI A;  5JQG E;  3HKE E;  4L82 A;  4U74 A;  3ZYL A;  3H3A A;  1D0Y A;  2CXF A;  3QOF A;  4YJ2 E;  3PDY A;  2VK9 A;  4IDQ A;  3SRZ A;  1WR0 A;  4ZI2 D;  2XHE B;  1VCS A;  1KNR A;  2PJQ A;  4N7R C;  2DWK A;  3GN5 A;  1M7K A;  3H3M A;  4AIS A;  2L1T A;  5M4Y A;  2M67 A;  2R6G F;  2XSA A;  5FMN A;  5LCY A;  4WBN E;  5CFB A;  3MKD A;  4MHC A;  3CQG B;  4LF7 T;  3LK3 B;  2A2F X;  1USC A;  2PBI A;  3ETV A;  2H89 A;  3AAA B;  4ZZC A;  5HXS A;  2K24 A;  4U31 A;  4EV6 A;  2J1D G;  1YLN A;  2E9X B;  5FXX A;  2LLY A;  5JRE A;  5KXJ A;  5FY7 A;  2X66 A;  3AAE B;  2VVN A;  4O2A E;  3B13 A;  4TV4 A;  5L3E B;  4CQI A;  1LVF A;  3RH7 A;  1J5E T;  5L4H A;  5LMN T;  3CWZ B;  2XQ8 A;  1MMA A;  5JH7 E;  5HXE A;  3E22 E;  2WS3 A;  2V7M A;  4CN1 A;  3SWJ A;  4NPP A;  3AE9 A;  3N2O A;  5L3C B;  3AE8 A;  3JC6 C;  5A1L A;  4UXN B;  3KBU A;  3GWH A;  2BVL A;  3CQX C;  5FL0 A;  3MAC A;  3FKH A;  2HQ9 A;  2QA7 A;  1BR2 A;  4I50 E;  3AE7 A;  4DV6 T;  4KI0 F;  3X1D A;  3U78 A;  4UR9 A;  5AQS B;  4TV8 E;  1Y30 A;  1KEY A;  2E9X C;  3MK7 C;  2VB6 A;  1D1C A;  3HL6 A;  4KMC A;  4JI8 T;  1OED E;  2FUP A;  3OTO T;  3CVR A;  1U4Q A;  4LF6 T;  3UFE A;  3PJA J;  3AE3 A;  1WFD A;  2X9W A;  2LSI A;  5F8P A;  5LYJ E;  5EK2 A;  1ZV4 X;  2YDQ A;  2CWY A;  5C2T A;  1HS7 A;  2NW7 A;  2WDQ A;  3B57 A;  1FEW A;  1OXZ A;  5HEH A;  1R8I A;  3AE6 A;  4JI5 T;  3ZMU B;  3RHW A;  3HKD E;  2P5Z X;  1UUR A;  2V7K A;  2K3W A;  1QUU A;  5JDF A;  2OU5 A;  3C4Z A;  5JAB A;  4DV7 T;  2V1D B;  4R82 A;  3AA1 B;  1EZ3 A;  3FXE B;  3GN5 B;  3I9W A;  3BA3 A;  2XUE A;  4YBN A;  4YSZ A;  1SA0 E;  2BKP A;  4HWC A;  3N9L A;  4MTK A;  1WR6 A;  4DBQ A;  2CHO A;  4U7I A;  3PV0 F;  3UTK A;  2BG9 E;  4AKR B;  4HWI B;  3ZT7 A;  2I59 A;  3ETU A;  4YSY A;  2Y48 B;  3PE0 A;  4PAG A;  2KSR A;  5FXW A;  1W9R A;  1N34 T;  2WZH A;  2NP9 A;  3P4P A;  3R5Z A;  4IIJ E;  5CJ5 A;  5JDL A;  2LKG A;  2FUR A;  4UVC B;  5F5W A;  5HEO A;  3N9M A;  1J5W A;  2J47 A;  3CX6 B;  2YU2 A;  3UU6 A;  2JMH A;  4JBW F;  2IW5 B;  3O1J A;  3DJB A;  2FG9 A;  1VOM A;  3E0Z A;  1E7P A;  3SFD A;  2XY8 B;  2MPK A;  2CRB A;  1QSD A;  2UXB T;  3FBZ A;  5IWA T;  4WZX A;  1G76 A;  3NRX A;  4PK4 A;  3DTO A;  3C50 A;  3TLT A;  4Z90 A;  4CXX A;  4TUY E;  3OBV E;  3O1I A;  2V6Y A;  4FI5 A;  4U72 A;  4JI6 T;  1B7T A;  5LHI B;  5FVK A;  3UU8 A;  4DV5 T;  3WAJ A;  3ZN0 B;  1BR4 A;  1G73 A;  4QXC B;  3LDQ B;  3AEF A;  4UIG A;  3MXZ A;  3FXD B;  1XNR T;  3AE1 A;  3IHR A;  3SWH A;  3ZT5 A;  1JNW A;  3ZOE A;  2OV9 A;  1JNR A;  3KVB A;  5EK4 A;  3UUL A;  5ABF A;  2XAG B;  4TV9 E;  2XQ9 A;  2IG6 A;  3RI5 A;  2XJ7 A;  2C5J A;  3AB3 B;  3Q5W A;  3RF1 A;  2RE7 A;  3CML A;  5L3B B;  5EK3 A;  3R5W A;  1G8X A;  5KMG P;  3AAI A;  2HPL A;  3RQW A;  3PU3 A;  3NKZ A;  2M6I A;  2V7J A;  3R5R A;  4UEL A;  4H9P C;  1UX5 A;  3NVO A;  4YLH A; 
#chains in the Genus database with same CATH homology
 1X9B A;  1YOA A;  3F7E A;  1I0S A;  3NFW A;  3ZOD A;  2ECR A;  2I51 A;  5BNC A;  1WLK A;  3ZOH A;  3A6Q A;  3DMB A;  1USF A;  1TY9 A;  2PTF A;  1Y30 A;  5CHO A;  2D36 A;  1G79 A;  2E83 A;  4F07 A;  2FG9 A;  4N7R C;  2D37 A;  3AMF A;  3U5W A;  4HMW A;  2IML A;  3ZOG A;  2ED4 A;  4Z85 A;  1AXJ A;  1WLI A;  3HMZ A;  4HMT A;  3AWH A;  4HMS A;  1G76 A;  2HQ7 A;  3ZOC A;  3PFT A;  4IRA A;  1XXO A;  3VY5 A;  3BPK A;  3ZOF A;  1USC A;  4QVB A;  2QEA A;  1CI0 A;  3TGV A;  2ECU A;  2FHQ A;  1RZ0 A;  1VL7 A;  4YWN A;  2X1J A;  3BNK A;  2QCK A;  3DB0 A;  2D38 A;  3A20 A;  3E4V A;  3IN6 A;  2NR4 A;  4HMX A;  1G78 A;  3H96 A;  3K86 A;  4XJ2 A;  1WV4 A;  3K87 A;  2X1K A;  2I02 A;  2OL5 A;  1YLN A;  4XHY A;  3R5L A;  2ASF A;  2A2J A;  2HTD A;  1W9A A;  1NRG A;  2OU5 A;  3U0I A;  5JAB A;  3EC6 A;  1DNL A;  2HHZ A;  3R5Y A;  3K88 A;  3U34 A;  4R82 A;  5ESC A;  3RH7 A;  3KYF A;  1RFE A;  3BA3 A;  3GAS A;  4YBN A;  2GJG A;  3B5M A;  1WGB A;  3R5P A;  1JNW A;  3ZOE A;  1RZ1 A;  3VYA A;  3CP3 A;  1EJE A;  2AQ6 A;  1FLM A;  2ARZ A;  1W3O A;  2IG6 A;  1T9M A;  3DNH A;  1XHN A;  2Q9K A;  2R6V A;  3SWJ A;  4ZKY A;  2RE7 A;  2HTI A;  3A6R A;  4Y9I A;  1W3Q A;  3HY8 A;  3KYG A;  2VPA A;  4L82 A;  2IAB A;  1G77 A;  3CB0 A;  3R5W A;  2D5M A;  2RDE A;  1I0R A;  4HMU A;  1W3P A;  4HX6 A;  3VY2 A;  1W3R A;  3FGE A;  3FKH A;  3R5Z A;  4HMV A;  2HQ9 A;  3U35 A;  5CHE C;  3R5R A;  2R0X A;  2FUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...