2NR4A

Crystal structure of fmn-bound protein mm1853 from methanosarcina mazei, pfam duf447
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
192
structure length
191
Chain Sequence
DLSSFGIREGISEIIASTGFEHPNAAPIGIVMKGERPFVRLFKGSHTWENVLKEKCLASNVVYDPILFVRSTFSDLVPSEFEYVDGEFKFPVLKEAIAWVVFECINLRNTDQSLVADLVPLNAGFNERNIKELPVPNRGFNAVLEATVHATRYQLTGEEKYLELIRHYESLASKCGGDAEKKAMKLIYEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of conserved FMN bound hypothetical protein from Methanosarcina mazei
rcsb
source organism Methanosarcina mazei
molecule tags Structural genomics, unknown function
molecule keywords Conserved hypothetical protein
total genus 54
structure length 191
sequence length 192
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04289 DUF447 Protein of unknown function (DUF447)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.290 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical membrane protein ta0354_69_121. 2nr4A02
2.30.110.10 Mainly Beta Roll Pnp Oxidase; Chain A Electron Transport, Fmn-binding Protein; Chain A 2nr4A01
2X1KA 3VYAA 5CHEC 3ZOEA 2QCKA 3SWJA 1FLMA 1RFEA 4L82A 4R82A 3R5PA 3R5ZA 3H96A 3A6RA 2IG6A 2D5MA 4HMSA 2FURA 2ECUA 1G76A 3VY5A 3IN6A 3VY2A 1W3QA 2D38A 3U34A 2FHQA 3ZOHA 1G77A 3TGVA 3U35A 1RZ0A 1YOAA 3R5LA 3ZOGA 3NFWA 3BNKA 2ARZA 3HY8A 2IMLA 3K87A 4IRAA 2OL5A 4F07A 2D36A 4HMUA 4XJ2A 1WLKA 3B5MA 3K88A 3A6QA 4HMXA 4QVBA 1VL7A 2HTDA 1RZ1A 1G78A 2HQ7A 3BPKA 4HMWA 3CP3A 1I0RA 5JABA 3F7EA 2E83A 4HX6A 3DB0A 5CHOA 2HHZA 2RE7A 1T9MA 2IABA 1I0SA 3PFTA 2I02A 3R5WA 1G79A 1EJEA 3GASA 1W3RA 1JNWA 2A2JA 5BNCA 2RDEA 3R5YA 2ECRA 3AWHA 4HMTA 1TY9A 1X9BA 3R5RA 1W3OA 3E4VA 2AQ6A 4YBNA 4XHYA 2ASFA 2QEAA 1W3PA 3ZOCA 1W9AA 1WGBA 2GJGA 2VPAA 2D37A 1XXOA 4YWNA 2X1JA 4N7RC 3CB0A 2Q9KA 4Y9IA 1WV4A 3DMBA 1CI0A 3DNHA 3KYGA 2R6VA 3HMZA 1XHNA 3FGEA 3AMFA 1USCA 3KYFA 2NR4A 2PTFA 4Z85A 4HMVA 1YLNA 1Y30A 2R0XA 4ZKYA 3U0IA 2I51A 1AXJA 3RH7A 3U5WA 1WLIA 3A20A 2OU5A 3ZOFA 3FKHA 3ZODA 3K86A 3BA3A 1USFA 2ED4A 2HQ9A 2FG9A 2HTIA 1NRGA 1DNLA 5ESCA 3EC6A
chains in the Genus database with same CATH superfamily
4YJ2E 2CHOA 2X1KA 2LSIA 3ZN1B 3O9XA 3I0QA 4PK4A 3ONLC 3P4SA 2WWVA 3AB3B 3U78A 2XQ4A 4YTMA 1XZYA 2JRKA 3AEDA 4U7YA 3U35A 3J9X1 3LK42 4IIJE 4CQIA 4ILUA 2BS3A 3NFWA 1NWMX 2C5JA 5L3BB 3AECA 4JI2T 3DTOA 4XJ2A 3VHLA 3KBTA 2A9UA 4UV8B 3FXDB 2DL1A 3N2GE 1T9MA 5LA6E 2UUBT 5HYAA 1OEDA 3R5WA 4LF8T 4U74A 2JQ9A 3RYIE 1JNRA 5ABHA 4YBNA 3AXJB 4XHYA 2C0SA 1KFYA 3AEEA 2FBWA 1MMDA 2BG9B 5CA1E 2BDEA 1N34T 3LBXB 4FJOA 2BG9E 5C2TA 5FY7A 3IA3A 2CHNA 5JRCA 4CN6A 2HN2A 2DWKA 2UU9T 2LSYA 1YLNA 3ZYKA 2X51A 4NIQA 4HFHA 5AQSB 3ZT7A 3FKHA 2D5UA 2Q9QC 2ZM6T 3K1SA 1USFA 2V26A 2Q9QA 5JDLA 2CEAA 2HTIA 5J2UE 5JR9C 2V5CA 3A6RA 3ZMTB 5FXVA 2SPCA 2H3RA 4CN1A 3CMLA 3UU3A 5LBMA 2C5KT 3RIUC 3C4ZA 4O4IE 4EZ4A 1VRBA 4U2YA 2DNXA 4JEHB 3RIFA 4EOZB 5HEGA 4Q25A 4UEMA 3I9YA 2WQYA 4QH4A 4UVBB 2H7VC 3TLUA 4EEBA 4ILCA 3O1IA 5LG3A 2JPFA 3RYFE 4ZZBA 4JI0T 1X79A 1SA0E 2F4VT 3OPCA 2H7OA 3RQUA 5L4EA 3RI5A 2VVNA 1W3RA 2BBJA 3H37A 4EXTA 3BQKA 4CI2B 2ECRA 1X9BA 4WW0A 2X9HA 2UUCT 4PW8A 2EHOD 1V9DA 3QK6A 2VASA 3NBXX 4IDOA 3AEAA 2D37A 2KMFA 4B3RT 5KDMC 2KWHA 5HCMA 4GKKT 2LRKA 4TV8E 3PUXF 3A5XA 1YXRA 2D0UA 3E08A 1NRGA 3EC6A 3ZSSA 1ZOYA 4YSYA 3AVSA 3N9NA 2UUAT 1ZHCA 2XQ3A 3Q5DA 4DV5T 2J47A 3DJBA 3N9QA 2WDRA 4TNVA 2WM9A 3ZT6A 3LK2B 4ZI3D 4COFA 2KZ7B 2V7JA 2VKHA 2ODUA 1J5WA 3P50A 2D36A 4HMUA 1CUNA 2LKHA 4P1NA 3TLWA 2XASB 1I94T 1WRDA 1IBMT 1D1CA 4O2BE 3AEBA 1I0SA 3F31A 3SFEA 5L3EB 4IREA 2I6HA 3VKGA 4UV9B 2E9XB 3R5YA 3N9MA 4I4TE 4KMCA 3R5RA 3C4WA 1W3OA 2KINB 2WDQA 2N9DA 3PV0F 1W9AA 1XMOT 3W15B 3ZT5A 4TUYE 5H6QB 2FUPA 4DV4T 5J0ZA 4GIWA 3ESLA 5CA0E 4X1IE 3HR0A 2KXPB 2BS2A 2LM9A 4Z91A 2YKSA 5HXCA 5BR8T 3RQWA 3MK7C 3PUSA 1H7CA 2VVSA 2OA5A 3MJXA 3L8RA 4F8HA 4JI8T 2LSKA 1FLMA 1M62A 2C5IT 4A56A 4LF4T 3OYXA 2V6YB 4U3CA 2WMNA 3UQ4A 3PUYF 2DI4A 2A3DA 1T72A 2X68A 3AXJA 1YOAA 1FMVA 3FB2A 3ZCJA 2BBHA 3RLFF 4P0BA 3HY8A 2IMLA 1IJ6A 5DQVA 5FY1A 3ZKRA 4I43B 1OWAA 1VL7A 2WMOA 2DLRA 4QX7B 1O3XA 5LGTB 2P5ZX 4TV4A 2KWIB 5JABA 2FJEA 4HGAA 5HCJA 1BR4A 2E8IA 2HHZA 1J5ET 3UU4A 2VURA 1VOMA 5JDGA 3CVRA 3SFDA 4PJMA 4GYSA 4UF0B 4BJMA 4DR2T 1KNZA 4YFSA 4EYUA 5ADXL 4B3ST 4X20E 4KHPT 4TZ4C 4YLHA 3ZOCA 2CXDA 1MMNA 4NXMT 2LM2A 3OTOT 2Q9KA 4X64T 2CBJA 3PUVF 4OFZA 2DCFA 5AQVB 1E1HB 2AXDS 3AMFA 5BMVE 1T8BA 3LK3B 1HS7A 4DV7T 1HX1B 2BKOA 5GONE 1LVFA 2OLTA 5FXXA 1LRZA 5LNKA 3BK9A 3K86A 2FG9A 3ZOEA 5LMUT 1RFEA 5JR9A 2UXBT 3H96A 4QXCB 4HMSA 2XY8B 3IF8B 1MMAA 1KF6A 2ECUA 3UU6A 3GA8A 1W3QA 1FMWA 1AJ3A 2IW5B 2WSSV 3FBZA 3S4UA 5ABFA 5ABFB 5AQJB 2XAHB 3RRCA 5J2TE 4DV2T 1WLXA 3FZFB 3AE2A 3AE8A 4JI3T 4QVBA 1G78A 4QXHB 1D1BA 3LBXA 3C64A 5IUXA 4DVDA 4AISA 5DJQC 2B1EA 2WCAA 3EI0A 5JH7E 4LFBT 3FZMB 3BQLA 2KNDA 5ETWA 1N32T 4UVCB 2XQ6A 1D0ZA 4HFCA 5KMGP 1FJGT 1FIOA 5KX5E 5IYZE 5M4YA 3ZEFB 2GJGA 2JJ9A 2A2FX 1WCRA 4CI1B 4IE0A 2H89A 1WV4A 3DMBA 3PURA 2NR4A 1MNEA 3AAAB 1Y30A 2ZLYA 1EZ3A 3PUWF 4DR5T 1NAFA 2XPKA 5LXTE 5AQKB 2ED4A 1QUUA 1D0XA 1US7B 2LHRA 3MZKB 3NWIA 3VYAA 2XAQB 3RF1A 5JDQA 3AAEB 4OHFA 2IG6A 4NXNT 1YQ3A 5F3JA 4A97A 3KBUA 5A1LA 2X9WA 4PJLA 3R84B 4IE6A 2ACZA 3VRBA 1UCUA 3JCFA 3ZMSB 2V6YA 5J1GA 2W63A 1WYCA 1SE7A 5FL0A 2AE9A 2NTYA 3K87A 2J1DG 2OL5A 4YT0A 3N2KE 2BG9A 3B5MA 1WLKA 4ISTA 1RZ1A 2HPLA 2BG9C 2UXNB 3UQ7A 3BPKA 3OYZA 3OBVE 1I0RA 2PJQA 1JNZA 2HPJA 5L47A 4ZI2C 3TLTA 2XSAA 5HWXA 2X67A 2RDEA 3RC8A 2LJLA 3M3ZB 4MALA 2JQKA 1IBLT 3RH3A 3L09A 2IDOB 4E7ZA 4N7RC 1LKXA 3RKOA 5L3GB 3HMZA 3JAFA 3MXZA 2XQYA 4LF6T 2JMHA 5HXSA 4H63V 5AQFB 3ZMUB 3A20A 5LCYA 3AVRA 2PBIA 2X0HA 2XM1A 1YKHB 2VK9A 4LFAT 2Z6EA 3UUXB 4BJNA 5FP3A 1Y12A 1G76A 4AI6A 1HNWT 4EB6E 4ZS3A 3OJAA 1XMQT 3CQCB 1Y01A 3HE1A 3BNKA 4YSZA 2MAWA 2HH7A 3B13A 1T98A 3EUHA 5ABGA 3AE1A 1YQ4A 4QWNB 3AE4A 5LGUB 3ETVA 1LVKA 3O1HA 4HN9A 4AKGA 4LF5T 3WAJA 4YXDA 3ZJ2A 3RYCE 4DO0A 2VKDA 2GK9A 4X1KE 4KUMB 4OK0A 5F5WA 4TWHA 4H9OC 4AQFA 5KXJA 2EHOA 5BNCA 2VKJA 2EHOB 2CXLA 3T8OA 4JI1T 3SS1A 3FXEB 2E9XC 2VPAA 1XXOA 2IIUA 2RPAA 4QKNA 5EK2A 4EAHA 2CM0A 1S35A 4IDQA 4I50E 4YY3T 2YEVC 5LP6E 3Q5XA 3ZSTA 4IDZA 3PUAA 2PG8A 2IUBA 1WLIA 2L1TA 2XQ9A 3BA3A 5CGMA 4JI7T 3ZPOA 2NW8A 2Q9QD 2HHHT 5AQNB 2QCKA 3QC9A 4JUYA 3QB5A 2YN6A 3VY5A 2Y6XA 4IHJE 3RX6A 2KT9A 4A5XA 2W62A 4I0UA 3ZOHA 3N9PA 3OVUA 4ZOLE 2WAUA 4IT4A 2W00A 3KINB 5HXHA 3CWZB 4DIDB 2PFVA 4HMXA 1I6ZA 3P7IA 4MHCA 2WBLA 1QSDA 4HMWA 3QUJA 2V8SV 3IEEA 1Z0PA 4HKAA 3NRYA 4EYYR 2V6XA 5CHOA 4XZCA 5IWAT 5AQTB 2YDQA 4O4HE 4AQGA 3PFTA 2BVLA 3ZMZB 2K48A 2YDRA 2A2JA 5LJNA 3CQXC 3SWHA 4L0RA 5DABA 3O1JA 4LMLA 2XAFB 2W4XA 2LLYA 2ZM8A 2CWYA 4UELA 3CIRA 2D2SA 4HTEA 4ADZA 1UGOA 4PFOA 3KVBA 3ONXA 4UXNB 3RGLA 3KYFA 1UUSA 4PK5A 1GQEA 4EV6A 3P4QA 4AIUA 5LYJE 3R6NA 5LHGB 2N2NA 4NPPA 4OYKA 4UVAB 5LOVE 3EVYA 1W9RA 2WU2A 2L3LA 4M1PA 2CLYB 3NVOA 2L9QA 2WDVA 5FVKA 2ZMAA 2LKGA 2WWUA 5H6RB 3IN6A 3VY2A 2WS3A 1U4QA 2J4GA 3CQGB 3SRZA 2YDSA 2VB6A 3T1YT 4ZHQE 3PU3A 4AKIA 1HTJF 2LE8A 4HWHA 2UXXB 2K5BB 5CFBA 4HFBA 2ZM0A 2MBGA 2WZIA 4LF9T 3C98B 3LG7A 3AEGA 3AEFA 2WB5A 3TKLB 2XQAA 4MLKA 4HE8A 4WBOA 2ODVA 3Q9DA 1WR6A 3HA4A 3FZLB 4IGUA 5HEOA 1ZP0A 4DV0T 2DHRA 2AQ6A 2RA1A 3MACA 4L9IA 3ZJ1A 3Q5WA 3KV9A 5LMNT 1UX5A 4CXYA 3JC6D 4EGWA 5FNVE 5LJMA 4EEDA 3AA1B 5JVDE 4PJNA 4L5GA 1R8IA 2E9XA 3O4XE 2J62A 3I0OA 1N36T 2V7LA 3A7MA 4DNDA 3PUZF 5EZYE 5FKYA 4CI3B 2BKNA 3ZODA 2M6BA 1FEWA 1DNLA 3ZOGA 3EDVA 2NTXA 5L2LA 1MIVA 2IHR1 3ETUA 3EHZA 1KNRA 4TNWA 4TWDA 3V4HA 2QYWA 2I0MA 4UHVA 2XSBA 5JDNA 2D38A 2NWBA 5FL1A 3TGVA 3EDUA 2A72A 2K3WA 3NZQA 5FXWA 3AE6A 4IRAA 5HEJA 3PJAA 4JEUB 3U3IA 2UXCT 4KP3C 3K88A 4IE7A 3UULA 1YD8G 4E7SA 2JQQA 4PAGA 1KK7A 5FXZA 2BS4A 3ONJA 4DR7T 2K4QA 5AQGB 3RRWA 2JQHA 3RIUA 4X5TA 5AQMB 3AWHA 3RKGA 2LOPA 3RC3A 3Q5EA 1MNDA 3E4VA 2LSGA 2W61A 4YSXA 2MYSA 3C51A 2X1JA 3CB0A 4ZEYA 3KYGA 5L3CB 4H9QC 5TAOA 3ZLIA 1HFAA 5LHIB 2YU1A 3B57A 1MMGA 3TLSA 2V5DA 1HNZT 1AXJA 3P4RA 5L4HA 4WYVA 1OXZA 2K9AA 3AAIA 4U72A 2VL0A 2FJDA 2CPTA 4J2CA 5HXRA 3ZC0A 1HCIA 5CHEC 1XNRT 4ILAA 4KHZF 4QX8B 3ANWA 4DMVA 4JI6T 4DV3T 3VR9A 2CBIA 3GMIA 5FVLA 4U7IA 4N78D 4CN4A 1HNXT 2ARZA 1G73A 4WBNE 4ISSA 2CRBA 5HXEA 3C50A 3CKDA 1J1JA 3A6QA 3VR8A 3K8PC 1SHZC 3KV5A 2HN1A 3OKQA 4TN7B 1WR0A 3GN5A 3EAAA 3I1AA 3E22E 5L3DB 4U33A 3QNUA 4YJ3E 4ERRA 3F2EA 2IABA 4ZI3C 4X65T 2P9BA 4TV9E 2MOZA 4EZHA 3MKDA 3CX6B 3N2OA 5JRCB 1ZV4X 3KDSE 1XDPA 2NOXA 5FYMA 2QRXA 4QH1A 4HKHA 4TX5A 4IDNA 2NW7A 3N9OA 2CA5A 2X0LB 2Y8DA 2IC9A 1HG2A 4H9NC 3DNHA 2VL8A 3AA6B 5C8YE 5C3JA 2R6VA 5AQPB 4HWFA 3AE9A 1USCA 5E0OA 3CX8B 3RIAA 4JLEA 5AFUL 1OEDB 4TWFA 3ZOFA 4DR3T 5CB4E 4JI4T 4G63A 1IAPA 1W0BA 4O8SA 2D5MA 2LHNA 4QHOA 5EK3A 4AXPA 5AQUB 1Y64B 5FMNA 2LSJA 4HFDA 1IJ5A 2X9XA 3FZKB 1M7KA 1QLBA 2R6GF 4HFVA 4WNKA 4H9SE 2QA7A 2KLQA 4P09A 4JI5T 5HAXA 2XQ8A 3PTRB 3F7EA 2IAKA 5ABEA 4AKLA 1T7SA 3GASA 2KSRA 4U2ZA 2V7KA 5AQLB 4KI0F 3QB5K 5AQIB 4DUYT 1IBKT 2D9DA 5HEUA 1UX4A 2JIWA 2EHOC 4DBQA 3H3MA 5AQQB 2WP9A 2WU5A 1CI0A 1D1AA 1XHNA 4AKHA 4AKRB 3V5UA 4GYRA 1IZNB 4HMVA 4KX6A 3U0IA 2FJBA 2I51A 2V7IA 5HEHA 3ZYLA 4CXXA 2V7MA 1VCTA 4GKJT 2D0TA 4ZXLA 4GK5E 3X1DA 3JAEA 3KFWX 2ZM2A 4DUZT 5EK4A 2VWAA 2Y48B 2I59A 1KNPA 2XAGB 2FHQA 4MFRA 2X66A 1G77A 3GWHA 2XAJB 4H9RC 2M6IA 3KVAA 2LRLA 3VU7H 5LGNB 4UF0A 3HKCE 3FZHB 1OEDE 3LFMA 4IL4A 2W0GA 5AQRB 1L0VA 2JMKA 4YHHT 1NENA 2FJAA 2NP9A 3N9LA 1U5PA 2CWOA 5LG4A 3ZCIA 4ZI2D 5F8PA 3UU8A 3Q2MA 1KEYA 4H9PC 4DBRA 4K0UA 1TY9A 3CX7B 4CXWA 3PJAJ 2DWGA 3BQIA 3HI2A 3UTKA 3ZMVB 2QEAA 1W3PA 1N33T 4X62T 1BR2A 4Z90A 2XHEB 3QOFA 2VKOA 4Y9IA 3KV4A 4ASKA 3C4XA 1XNQT 5LB7B 2BVMA 4C90A 4Z85A 2Q9QB 4Z8XA 3IHRA 4IE5A 2VQET 3N5LA 3AE7A 2CCQA 3PDYA 1ZEEA 5ESCA 2MTQA 3JC6C 3UFGA 1MIWA 4IE4A 2BZBA 1MIYA 4L82A 2WZHA 5JREA 2XM2A 3UUNA 4R82A 3R5PA 3UFEA 2LT3A 2XJ7A 4GK0E 4OX9T 3ABVA 3PU8A 2X9YA 2CLYC 2YK0A 5LBQB 5FY0A 3SOLA 5AQHB 3F57A 1UK5A 3G06A 3NRXA 2E5LT 4AQFC 2XQ7A 4XBFB 3WAKA 3FBLA 2HTDA 3HKBE 3NZPA 1VCSA 4YTPA 4ZI7E 5JTGA 4MTKA 4MBQA 2E83A 2OV9A 3DB0A 2RE7A 4ANJA 1ZKEA 3PE0A 5HWYA 4UR9A 2I02A 1E2AA 4DV6T 1EJEA 3UT5E 2K24A 4G2AA 2NW9A 4K0KT 3UUMA 4IL9A 2M67A 1WYBA 4JYAT 2ASFA 2E9XD 4YHJA 3J7Yq 2VQFT 2YINA 3P4WA 1WGBA 3PUGA 3FHNA 4ZS2A 4I55E 4YWNA 4BA9A 3FGEA 2V1DB 5JDHA 1S94A 2XUEA 2UXDT 3U5WA 3K3QC 4IDPA 1HF8A 3HKDE 2E2AA 5JDFA 3HL6A 1XDOA 3SWJA 2B76A 2WY2A 1BR0A 3R5ZA 3GN5B 2FURA 1YKEB 1W09A 4OYJA 5AQOB 2H88A 2G0UA 3U34A 4NUVA 1UURA 1RZ0A 1SUMB 4F6RC 3R5LA 3HKEE 3UU5A 4GOUA 4ZZCA 2N1GA 3P4PA 3AE3A 3L39A 3A8YC 2QVAA 3WI3A 2L8KA 2HQ7A 3EAMA 3CP3A 3K3OA 3CK6A 4WZXA 4HX6A 1G79A 2CMRA 4PK6A 3VKHA 4NUUA 1JNWA 3P8CD 4DMWA 3EABA 4ILBA 4DV1T 2W67A 5JDMA 4HMTA 1W0AA 4HWIB 5LHHB 2YOEA 4YTNA 1XWMA 4B3MT 2XTLA 4LFCT 2ACXA 5CJ5A 2X0YA 2MPKA 3AE5A 4V1Av 4AQYT 2XQ5A 4DR4T 3AA7B 3VRAA 4HFIA 1HX8A 4KBMB 2BKPA 4QXBB 4JBWF 2CE7A 5JR9B 3RH7A 4LMJA 2RP4A 3TLVA 4LMKA 1OEDC 4PJJA 3UUBA 1NEKA 4C91A 1B7TA 3K3NA 4BAYB 3NKZA 4CZZB 4X66T 4H63H 1HR0T 2W66A 4XAXB 4DR1T 3I9WA 1DU2A 4HEAA 4DR6T 1WFDA 2W2UA 1HG5A 1E7PA 3ZN0B 2XZEA 4QH5A 3RHWA 4FI5A 3LJCA 3AA0B 4F07A 3JADA 3H3AA 3ANWB 2YU2A 3KV6A 4W64A 4O2AE 2GUJA 1CHUA 4HWCA 4X1YE 3IBPA 2LOSA 4HWDA 3T1HT 3LDQB 2IC6A 4JV5T 1D0YA 1Z8UA 3PUQA 4U31A 2CXFA 3RPUA 3V5SA 4O4JE 3E0ZA 3MA9A 4EIWA 3ZC1A 5IHYA 5DQWA 5L3FB 3DP7A 3CPZA 3RYHE 4B3TT 4A98A 4HFEA 4UIGA 3ZYMA 3L3PA 4PNIA 1G8XA 3D0TA 3M65A 4PFPA 2LEHA 4LF7T 1YW0A 2PTFA 2QGSA 2R0XA 4ZKYA 2ES0A 1BR1A 2E5VA 2OU5A 3LSVA 4P0AA 4B6XA 2HQ9A 5JQGE 4O4LE
chains in the Genus database with same CATH topology
2X1KA 3VYAA 5CHEC 3ZOEA 2QCKA 3SWJA 1FLMA 1RFEA 4L82A 4R82A 3R5PA 3R5ZA 3H96A 3A6RA 2IG6A 2D5MA 4HMSA 2FURA 2ECUA 1G76A 3VY5A 3IN6A 3VY2A 1W3QA 2D38A 3U34A 2FHQA 3ZOHA 1G77A 3TGVA 3U35A 1RZ0A 1YOAA 3R5LA 3ZOGA 3NFWA 3BNKA 2ARZA 3HY8A 2IMLA 3K87A 4IRAA 2OL5A 4F07A 2D36A 4HMUA 4XJ2A 1WLKA 3B5MA 3K88A 3A6QA 4HMXA 4QVBA 1VL7A 2HTDA 1RZ1A 1G78A 2HQ7A 3BPKA 4HMWA 3CP3A 1I0RA 5JABA 3F7EA 2E83A 4HX6A 3DB0A 5CHOA 2HHZA 2RE7A 1T9MA 2IABA 1I0SA 3PFTA 2I02A 3R5WA 1G79A 1EJEA 3GASA 1W3RA 1JNWA 2A2JA 5BNCA 2RDEA 3R5YA 2ECRA 3AWHA 4HMTA 1TY9A 1X9BA 3R5RA 1W3OA 3E4VA 2AQ6A 4YBNA 4XHYA 2ASFA 2QEAA 1W3PA 3ZOCA 1W9AA 1WGBA 2GJGA 2VPAA 2D37A 1XXOA 4YWNA 2X1JA 4N7RC 3CB0A 2Q9KA 4Y9IA 1WV4A 3DMBA 1CI0A 3DNHA 3KYGA 2R6VA 3HMZA 1XHNA 3FGEA 3AMFA 1USCA 3KYFA 2NR4A 2PTFA 4Z85A 4HMVA 1YLNA 1Y30A 2R0XA 4ZKYA 3U0IA 2I51A 1AXJA 3RH7A 3U5WA 1WLIA 3A20A 2OU5A 3ZOFA 3FKHA 3ZODA 3K86A 3BA3A 1USFA 2ED4A 2HQ9A 2FG9A 2HTIA 1NRGA 1DNLA 5ESCA 3EC6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X1K A;  3VYA A;  5CHE C;  3ZOE A;  2QCK A;  3SWJ A;  1FLM A;  1RFE A;  4L82 A;  4R82 A;  3R5P A;  3R5Z A;  3H96 A;  3A6R A;  2IG6 A;  2D5M A;  4HMS A;  2FUR A;  2ECU A;  1G76 A;  3VY5 A;  3IN6 A;  3VY2 A;  1W3Q A;  2D38 A;  3U34 A;  2FHQ A;  3ZOH A;  1G77 A;  3TGV A;  3U35 A;  1RZ0 A;  1YOA A;  3R5L A;  3ZOG A;  3NFW A;  3BNK A;  2ARZ A;  3HY8 A;  2IML A;  3K87 A;  4IRA A;  2OL5 A;  4F07 A;  2D36 A;  4HMU A;  4XJ2 A;  1WLK A;  3B5M A;  3K88 A;  3A6Q A;  4HMX A;  4QVB A;  1VL7 A;  2HTD A;  1RZ1 A;  1G78 A;  2HQ7 A;  3BPK A;  4HMW A;  3CP3 A;  1I0R A;  5JAB A;  3F7E A;  2E83 A;  4HX6 A;  3DB0 A;  5CHO A;  2HHZ A;  2RE7 A;  1T9M A;  2IAB A;  1I0S A;  3PFT A;  2I02 A;  3R5W A;  1G79 A;  1EJE A;  3GAS A;  1W3R A;  1JNW A;  2A2J A;  5BNC A;  2RDE A;  3R5Y A;  2ECR A;  3AWH A;  4HMT A;  1TY9 A;  1X9B A;  3R5R A;  1W3O A;  3E4V A;  2AQ6 A;  4YBN A;  4XHY A;  2ASF A;  2QEA A;  1W3P A;  3ZOC A;  1W9A A;  1WGB A;  2GJG A;  2VPA A;  2D37 A;  1XXO A;  4YWN A;  2X1J A;  4N7R C;  3CB0 A;  2Q9K A;  4Y9I A;  1WV4 A;  3DMB A;  1CI0 A;  3DNH A;  3KYG A;  2R6V A;  3HMZ A;  1XHN A;  3FGE A;  3AMF A;  1USC A;  3KYF A;  2NR4 A;  2PTF A;  4Z85 A;  4HMV A;  1YLN A;  1Y30 A;  2R0X A;  4ZKY A;  3U0I A;  2I51 A;  1AXJ A;  3RH7 A;  3U5W A;  1WLI A;  3A20 A;  2OU5 A;  3ZOF A;  3FKH A;  3ZOD A;  3K86 A;  3BA3 A;  1USF A;  2ED4 A;  2HQ9 A;  2FG9 A;  2HTI A;  1NRG A;  1DNL A;  5ESC A;  3EC6 A; 
#chains in the Genus database with same CATH topology
 4YJ2 E;  2CHO A;  2X1K A;  2LSI A;  3ZN1 B;  3O9X A;  3I0Q A;  4PK4 A;  3ONL C;  3P4S A;  2WWV A;  3AB3 B;  3U78 A;  2XQ4 A;  4YTM A;  1XZY A;  2JRK A;  3AED A;  4U7Y A;  3U35 A;  3J9X 1;  3LK4 2;  4IIJ E;  4CQI A;  4ILU A;  2BS3 A;  3NFW A;  1NWM X;  2C5J A;  5L3B B;  3AEC A;  4JI2 T;  3DTO A;  4XJ2 A;  3VHL A;  3KBT A;  2A9U A;  4UV8 B;  3FXD B;  2DL1 A;  3N2G E;  1T9M A;  5LA6 E;  2UUB T;  5HYA A;  1OED A;  3R5W A;  4LF8 T;  4U74 A;  2JQ9 A;  3RYI E;  1JNR A;  5ABH A;  4YBN A;  3AXJ B;  4XHY A;  2C0S A;  1KFY A;  3AEE A;  2FBW A;  1MMD A;  2BG9 B;  5CA1 E;  2BDE A;  1N34 T;  3LBX B;  4FJO A;  2BG9 E;  5C2T A;  5FY7 A;  3IA3 A;  2CHN A;  5JRC A;  4CN6 A;  2HN2 A;  2DWK A;  2UU9 T;  2LSY A;  1YLN A;  3ZYK A;  2X51 A;  4NIQ A;  4HFH A;  5AQS B;  3ZT7 A;  3FKH A;  2D5U A;  2Q9Q C;  2ZM6 T;  3K1S A;  1USF A;  2V26 A;  2Q9Q A;  5JDL A;  2CEA A;  2HTI A;  5J2U E;  5JR9 C;  2V5C A;  3A6R A;  3ZMT B;  5FXV A;  2SPC A;  2H3R A;  4CN1 A;  3CML A;  3UU3 A;  5LBM A;  2C5K T;  3RIU C;  3C4Z A;  4O4I E;  4EZ4 A;  1VRB A;  4U2Y A;  2DNX A;  4JEH B;  3RIF A;  4EOZ B;  5HEG A;  4Q25 A;  4UEM A;  3I9Y A;  2WQY A;  4QH4 A;  4UVB B;  2H7V C;  3TLU A;  4EEB A;  4ILC A;  3O1I A;  5LG3 A;  2JPF A;  3RYF E;  4ZZB A;  4JI0 T;  1X79 A;  1SA0 E;  2F4V T;  3OPC A;  2H7O A;  3RQU A;  5L4E A;  3RI5 A;  2VVN A;  1W3R A;  2BBJ A;  3H37 A;  4EXT A;  3BQK A;  4CI2 B;  2ECR A;  1X9B A;  4WW0 A;  2X9H A;  2UUC T;  4PW8 A;  2EHO D;  1V9D A;  3QK6 A;  2VAS A;  3NBX X;  4IDO A;  3AEA A;  2D37 A;  2KMF A;  4B3R T;  5KDM C;  2KWH A;  5HCM A;  4GKK T;  2LRK A;  4TV8 E;  3PUX F;  3A5X A;  1YXR A;  2D0U A;  3E08 A;  1NRG A;  3EC6 A;  3ZSS A;  1ZOY A;  4YSY A;  3AVS A;  3N9N A;  2UUA T;  1ZHC A;  2XQ3 A;  3Q5D A;  4DV5 T;  2J47 A;  3DJB A;  3N9Q A;  2WDR A;  4TNV A;  2WM9 A;  3ZT6 A;  3LK2 B;  4ZI3 D;  4COF A;  2KZ7 B;  2V7J A;  2VKH A;  2ODU A;  1J5W A;  3P50 A;  2D36 A;  4HMU A;  1CUN A;  2LKH A;  4P1N A;  3TLW A;  2XAS B;  1I94 T;  1WRD A;  1IBM T;  1D1C A;  4O2B E;  3AEB A;  1I0S A;  3F31 A;  3SFE A;  5L3E B;  4IRE A;  2I6H A;  3VKG A;  4UV9 B;  2E9X B;  3R5Y A;  3N9M A;  4I4T E;  4KMC A;  3R5R A;  3C4W A;  1W3O A;  2KIN B;  2WDQ A;  2N9D A;  3PV0 F;  1W9A A;  1XMO T;  3W15 B;  3ZT5 A;  4TUY E;  5H6Q B;  2FUP A;  4DV4 T;  5J0Z A;  4GIW A;  3ESL A;  5CA0 E;  4X1I E;  3HR0 A;  2KXP B;  2BS2 A;  2LM9 A;  4Z91 A;  2YKS A;  5HXC A;  5BR8 T;  3RQW A;  3MK7 C;  3PUS A;  1H7C A;  2VVS A;  2OA5 A;  3MJX A;  3L8R A;  4F8H A;  4JI8 T;  2LSK A;  1FLM A;  1M62 A;  2C5I T;  4A56 A;  4LF4 T;  3OYX A;  2V6Y B;  4U3C A;  2WMN A;  3UQ4 A;  3PUY F;  2DI4 A;  2A3D A;  1T72 A;  2X68 A;  3AXJ A;  1YOA A;  1FMV A;  3FB2 A;  3ZCJ A;  2BBH A;  3RLF F;  4P0B A;  3HY8 A;  2IML A;  1IJ6 A;  5DQV A;  5FY1 A;  3ZKR A;  4I43 B;  1OWA A;  1VL7 A;  2WMO A;  2DLR A;  4QX7 B;  1O3X A;  5LGT B;  2P5Z X;  4TV4 A;  2KWI B;  5JAB A;  2FJE A;  4HGA A;  5HCJ A;  1BR4 A;  2E8I A;  2HHZ A;  1J5E T;  3UU4 A;  2VUR A;  1VOM A;  5JDG A;  3CVR A;  3SFD A;  4PJM A;  4GYS A;  4UF0 B;  4BJM A;  4DR2 T;  1KNZ A;  4YFS A;  4EYU A;  5ADX L;  4B3S T;  4X20 E;  4KHP T;  4TZ4 C;  4YLH A;  3ZOC A;  2CXD A;  1MMN A;  4NXM T;  2LM2 A;  3OTO T;  2Q9K A;  4X64 T;  2CBJ A;  3PUV F;  4OFZ A;  2DCF A;  5AQV B;  1E1H B;  2AXD S;  3AMF A;  5BMV E;  1T8B A;  3LK3 B;  1HS7 A;  4DV7 T;  1HX1 B;  2BKO A;  5GON E;  1LVF A;  2OLT A;  5FXX A;  1LRZ A;  5LNK A;  3BK9 A;  3K86 A;  2FG9 A;  3ZOE A;  5LMU T;  1RFE A;  5JR9 A;  2UXB T;  3H96 A;  4QXC B;  4HMS A;  2XY8 B;  3IF8 B;  1MMA A;  1KF6 A;  2ECU A;  3UU6 A;  3GA8 A;  1W3Q A;  1FMW A;  1AJ3 A;  2IW5 B;  2WSS V;  3FBZ A;  3S4U A;  5ABF A;  5ABF B;  5AQJ B;  2XAH B;  3RRC A;  5J2T E;  4DV2 T;  1WLX A;  3FZF B;  3AE2 A;  3AE8 A;  4JI3 T;  4QVB A;  1G78 A;  4QXH B;  1D1B A;  3LBX A;  3C64 A;  5IUX A;  4DVD A;  4AIS A;  5DJQ C;  2B1E A;  2WCA A;  3EI0 A;  5JH7 E;  4LFB T;  3FZM B;  3BQL A;  2KND A;  5ETW A;  1N32 T;  4UVC B;  2XQ6 A;  1D0Z A;  4HFC A;  5KMG P;  1FJG T;  1FIO A;  5KX5 E;  5IYZ E;  5M4Y A;  3ZEF B;  2GJG A;  2JJ9 A;  2A2F X;  1WCR A;  4CI1 B;  4IE0 A;  2H89 A;  1WV4 A;  3DMB A;  3PUR A;  2NR4 A;  1MNE A;  3AAA B;  1Y30 A;  2ZLY A;  1EZ3 A;  3PUW F;  4DR5 T;  1NAF A;  2XPK A;  5LXT E;  5AQK B;  2ED4 A;  1QUU A;  1D0X A;  1US7 B;  2LHR A;  3MZK B;  3NWI A;  3VYA A;  2XAQ B;  3RF1 A;  5JDQ A;  3AAE B;  4OHF A;  2IG6 A;  4NXN T;  1YQ3 A;  5F3J A;  4A97 A;  3KBU A;  5A1L A;  2X9W A;  4PJL A;  3R84 B;  4IE6 A;  2ACZ A;  3VRB A;  1UCU A;  3JCF A;  3ZMS B;  2V6Y A;  5J1G A;  2W63 A;  1WYC A;  1SE7 A;  5FL0 A;  2AE9 A;  2NTY A;  3K87 A;  2J1D G;  2OL5 A;  4YT0 A;  3N2K E;  2BG9 A;  3B5M A;  1WLK A;  4IST A;  1RZ1 A;  2HPL A;  2BG9 C;  2UXN B;  3UQ7 A;  3BPK A;  3OYZ A;  3OBV E;  1I0R A;  2PJQ A;  1JNZ A;  2HPJ A;  5L47 A;  4ZI2 C;  3TLT A;  2XSA A;  5HWX A;  2X67 A;  2RDE A;  3RC8 A;  2LJL A;  3M3Z B;  4MAL A;  2JQK A;  1IBL T;  3RH3 A;  3L09 A;  2IDO B;  4E7Z A;  4N7R C;  1LKX A;  3RKO A;  5L3G B;  3HMZ A;  3JAF A;  3MXZ A;  2XQY A;  4LF6 T;  2JMH A;  5HXS A;  4H63 V;  5AQF B;  3ZMU B;  3A20 A;  5LCY A;  3AVR A;  2PBI A;  2X0H A;  2XM1 A;  1YKH B;  2VK9 A;  4LFA T;  2Z6E A;  3UUX B;  4BJN A;  5FP3 A;  1Y12 A;  1G76 A;  4AI6 A;  1HNW T;  4EB6 E;  4ZS3 A;  3OJA A;  1XMQ T;  3CQC B;  1Y01 A;  3HE1 A;  3BNK A;  4YSZ A;  2MAW A;  2HH7 A;  3B13 A;  1T98 A;  3EUH A;  5ABG A;  3AE1 A;  1YQ4 A;  4QWN B;  3AE4 A;  5LGU B;  3ETV A;  1LVK A;  3O1H A;  4HN9 A;  4AKG A;  4LF5 T;  3WAJ A;  4YXD A;  3ZJ2 A;  3RYC E;  4DO0 A;  2VKD A;  2GK9 A;  4X1K E;  4KUM B;  4OK0 A;  5F5W A;  4TWH A;  4H9O C;  4AQF A;  5KXJ A;  2EHO A;  5BNC A;  2VKJ A;  2EHO B;  2CXL A;  3T8O A;  4JI1 T;  3SS1 A;  3FXE B;  2E9X C;  2VPA A;  1XXO A;  2IIU A;  2RPA A;  4QKN A;  5EK2 A;  4EAH A;  2CM0 A;  1S35 A;  4IDQ A;  4I50 E;  4YY3 T;  2YEV C;  5LP6 E;  3Q5X A;  3ZST A;  4IDZ A;  3PUA A;  2PG8 A;  2IUB A;  1WLI A;  2L1T A;  2XQ9 A;  3BA3 A;  5CGM A;  4JI7 T;  3ZPO A;  2NW8 A;  2Q9Q D;  2HHH T;  5AQN B;  2QCK A;  3QC9 A;  4JUY A;  3QB5 A;  2YN6 A;  3VY5 A;  2Y6X A;  4IHJ E;  3RX6 A;  2KT9 A;  4A5X A;  2W62 A;  4I0U A;  3ZOH A;  3N9P A;  3OVU A;  4ZOL E;  2WAU A;  4IT4 A;  2W00 A;  3KIN B;  5HXH A;  3CWZ B;  4DID B;  2PFV A;  4HMX A;  1I6Z A;  3P7I A;  4MHC A;  2WBL A;  1QSD A;  4HMW A;  3QUJ A;  2V8S V;  3IEE A;  1Z0P A;  4HKA A;  3NRY A;  4EYY R;  2V6X A;  5CHO A;  4XZC A;  5IWA T;  5AQT B;  2YDQ A;  4O4H E;  4AQG A;  3PFT A;  2BVL A;  3ZMZ B;  2K48 A;  2YDR A;  2A2J A;  5LJN A;  3CQX C;  3SWH A;  4L0R A;  5DAB A;  3O1J A;  4LML A;  2XAF B;  2W4X A;  2LLY A;  2ZM8 A;  2CWY A;  4UEL A;  3CIR A;  2D2S A;  4HTE A;  4ADZ A;  1UGO A;  4PFO A;  3KVB A;  3ONX A;  4UXN B;  3RGL A;  3KYF A;  1UUS A;  4PK5 A;  1GQE A;  4EV6 A;  3P4Q A;  4AIU A;  5LYJ E;  3R6N A;  5LHG B;  2N2N A;  4NPP A;  4OYK A;  4UVA B;  5LOV E;  3EVY A;  1W9R A;  2WU2 A;  2L3L A;  4M1P A;  2CLY B;  3NVO A;  2L9Q A;  2WDV A;  5FVK A;  2ZMA A;  2LKG A;  2WWU A;  5H6R B;  3IN6 A;  3VY2 A;  2WS3 A;  1U4Q A;  2J4G A;  3CQG B;  3SRZ A;  2YDS A;  2VB6 A;  3T1Y T;  4ZHQ E;  3PU3 A;  4AKI A;  1HTJ F;  2LE8 A;  4HWH A;  2UXX B;  2K5B B;  5CFB A;  4HFB A;  2ZM0 A;  2MBG A;  2WZI A;  4LF9 T;  3C98 B;  3LG7 A;  3AEG A;  3AEF A;  2WB5 A;  3TKL B;  2XQA A;  4MLK A;  4HE8 A;  4WBO A;  2ODV A;  3Q9D A;  1WR6 A;  3HA4 A;  3FZL B;  4IGU A;  5HEO A;  1ZP0 A;  4DV0 T;  2DHR A;  2AQ6 A;  2RA1 A;  3MAC A;  4L9I A;  3ZJ1 A;  3Q5W A;  3KV9 A;  5LMN T;  1UX5 A;  4CXY A;  3JC6 D;  4EGW A;  5FNV E;  5LJM A;  4EED A;  3AA1 B;  5JVD E;  4PJN A;  4L5G A;  1R8I A;  2E9X A;  3O4X E;  2J62 A;  3I0O A;  1N36 T;  2V7L A;  3A7M A;  4DND A;  3PUZ F;  5EZY E;  5FKY A;  4CI3 B;  2BKN A;  3ZOD A;  2M6B A;  1FEW A;  1DNL A;  3ZOG A;  3EDV A;  2NTX A;  5L2L A;  1MIV A;  2IHR 1;  3ETU A;  3EHZ A;  1KNR A;  4TNW A;  4TWD A;  3V4H A;  2QYW A;  2I0M A;  4UHV A;  2XSB A;  5JDN A;  2D38 A;  2NWB A;  5FL1 A;  3TGV A;  3EDU A;  2A72 A;  2K3W A;  3NZQ A;  5FXW A;  3AE6 A;  4IRA A;  5HEJ A;  3PJA A;  4JEU B;  3U3I A;  2UXC T;  4KP3 C;  3K88 A;  4IE7 A;  3UUL A;  1YD8 G;  4E7S A;  2JQQ A;  4PAG A;  1KK7 A;  5FXZ A;  2BS4 A;  3ONJ A;  4DR7 T;  2K4Q A;  5AQG B;  3RRW A;  2JQH A;  3RIU A;  4X5T A;  5AQM B;  3AWH A;  3RKG A;  2LOP A;  3RC3 A;  3Q5E A;  1MND A;  3E4V A;  2LSG A;  2W61 A;  4YSX A;  2MYS A;  3C51 A;  2X1J A;  3CB0 A;  4ZEY A;  3KYG A;  5L3C B;  4H9Q C;  5TAO A;  3ZLI A;  1HFA A;  5LHI B;  2YU1 A;  3B57 A;  1MMG A;  3TLS A;  2V5D A;  1HNZ T;  1AXJ A;  3P4R A;  5L4H A;  4WYV A;  1OXZ A;  2K9A A;  3AAI A;  4U72 A;  2VL0 A;  2FJD A;  2CPT A;  4J2C A;  5HXR A;  3ZC0 A;  1HCI A;  5CHE C;  1XNR T;  4ILA A;  4KHZ F;  4QX8 B;  3ANW A;  4DMV A;  4JI6 T;  4DV3 T;  3VR9 A;  2CBI A;  3GMI A;  5FVL A;  4U7I A;  4N78 D;  4CN4 A;  1HNX T;  2ARZ A;  1G73 A;  4WBN E;  4ISS A;  2CRB A;  5HXE A;  3C50 A;  3CKD A;  1J1J A;  3A6Q A;  3VR8 A;  3K8P C;  1SHZ C;  3KV5 A;  2HN1 A;  3OKQ A;  4TN7 B;  1WR0 A;  3GN5 A;  3EAA A;  3I1A A;  3E22 E;  5L3D B;  4U33 A;  3QNU A;  4YJ3 E;  4ERR A;  3F2E A;  2IAB A;  4ZI3 C;  4X65 T;  2P9B A;  4TV9 E;  2MOZ A;  4EZH A;  3MKD A;  3CX6 B;  3N2O A;  5JRC B;  1ZV4 X;  3KDS E;  1XDP A;  2NOX A;  5FYM A;  2QRX A;  4QH1 A;  4HKH A;  4TX5 A;  4IDN A;  2NW7 A;  3N9O A;  2CA5 A;  2X0L B;  2Y8D A;  2IC9 A;  1HG2 A;  4H9N C;  3DNH A;  2VL8 A;  3AA6 B;  5C8Y E;  5C3J A;  2R6V A;  5AQP B;  4HWF A;  3AE9 A;  1USC A;  5E0O A;  3CX8 B;  3RIA A;  4JLE A;  5AFU L;  1OED B;  4TWF A;  3ZOF A;  4DR3 T;  5CB4 E;  4JI4 T;  4G63 A;  1IAP A;  1W0B A;  4O8S A;  2D5M A;  2LHN A;  4QHO A;  5EK3 A;  4AXP A;  5AQU B;  1Y64 B;  5FMN A;  2LSJ A;  4HFD A;  1IJ5 A;  2X9X A;  3FZK B;  1M7K A;  1QLB A;  2R6G F;  4HFV A;  4WNK A;  4H9S E;  2QA7 A;  2KLQ A;  4P09 A;  4JI5 T;  5HAX A;  2XQ8 A;  3PTR B;  3F7E A;  2IAK A;  5ABE A;  4AKL A;  1T7S A;  3GAS A;  2KSR A;  4U2Z A;  2V7K A;  5AQL B;  4KI0 F;  3QB5 K;  5AQI B;  4DUY T;  1IBK T;  2D9D A;  5HEU A;  1UX4 A;  2JIW A;  2EHO C;  4DBQ A;  3H3M A;  5AQQ B;  2WP9 A;  2WU5 A;  1CI0 A;  1D1A A;  1XHN A;  4AKH A;  4AKR B;  3V5U A;  4GYR A;  1IZN B;  4HMV A;  4KX6 A;  3U0I A;  2FJB A;  2I51 A;  2V7I A;  5HEH A;  3ZYL A;  4CXX A;  2V7M A;  1VCT A;  4GKJ T;  2D0T A;  4ZXL A;  4GK5 E;  3X1D A;  3JAE A;  3KFW X;  2ZM2 A;  4DUZ T;  5EK4 A;  2VWA A;  2Y48 B;  2I59 A;  1KNP A;  2XAG B;  2FHQ A;  4MFR A;  2X66 A;  1G77 A;  3GWH A;  2XAJ B;  4H9R C;  2M6I A;  3KVA A;  2LRL A;  3VU7 H;  5LGN B;  4UF0 A;  3HKC E;  3FZH B;  1OED E;  3LFM A;  4IL4 A;  2W0G A;  5AQR B;  1L0V A;  2JMK A;  4YHH T;  1NEN A;  2FJA A;  2NP9 A;  3N9L A;  1U5P A;  2CWO A;  5LG4 A;  3ZCI A;  4ZI2 D;  5F8P A;  3UU8 A;  3Q2M A;  1KEY A;  4H9P C;  4DBR A;  4K0U A;  1TY9 A;  3CX7 B;  4CXW A;  3PJA J;  2DWG A;  3BQI A;  3HI2 A;  3UTK A;  3ZMV B;  2QEA A;  1W3P A;  1N33 T;  4X62 T;  1BR2 A;  4Z90 A;  2XHE B;  3QOF A;  2VKO A;  4Y9I A;  3KV4 A;  4ASK A;  3C4X A;  1XNQ T;  5LB7 B;  2BVM A;  4C90 A;  4Z85 A;  2Q9Q B;  4Z8X A;  3IHR A;  4IE5 A;  2VQE T;  3N5L A;  3AE7 A;  2CCQ A;  3PDY A;  1ZEE A;  5ESC A;  2MTQ A;  3JC6 C;  3UFG A;  1MIW A;  4IE4 A;  2BZB A;  1MIY A;  4L82 A;  2WZH A;  5JRE A;  2XM2 A;  3UUN A;  4R82 A;  3R5P A;  3UFE A;  2LT3 A;  2XJ7 A;  4GK0 E;  4OX9 T;  3ABV A;  3PU8 A;  2X9Y A;  2CLY C;  2YK0 A;  5LBQ B;  5FY0 A;  3SOL A;  5AQH B;  3F57 A;  1UK5 A;  3G06 A;  3NRX A;  2E5L T;  4AQF C;  2XQ7 A;  4XBF B;  3WAK A;  3FBL A;  2HTD A;  3HKB E;  3NZP A;  1VCS A;  4YTP A;  4ZI7 E;  5JTG A;  4MTK A;  4MBQ A;  2E83 A;  2OV9 A;  3DB0 A;  2RE7 A;  4ANJ A;  1ZKE A;  3PE0 A;  5HWY A;  4UR9 A;  2I02 A;  1E2A A;  4DV6 T;  1EJE A;  3UT5 E;  2K24 A;  4G2A A;  2NW9 A;  4K0K T;  3UUM A;  4IL9 A;  2M67 A;  1WYB A;  4JYA T;  2ASF A;  2E9X D;  4YHJ A;  3J7Y q;  2VQF T;  2YIN A;  3P4W A;  1WGB A;  3PUG A;  3FHN A;  4ZS2 A;  4I55 E;  4YWN A;  4BA9 A;  3FGE A;  2V1D B;  5JDH A;  1S94 A;  2XUE A;  2UXD T;  3U5W A;  3K3Q C;  4IDP A;  1HF8 A;  3HKD E;  2E2A A;  5JDF A;  3HL6 A;  1XDO A;  3SWJ A;  2B76 A;  2WY2 A;  1BR0 A;  3R5Z A;  3GN5 B;  2FUR A;  1YKE B;  1W09 A;  4OYJ A;  5AQO B;  2H88 A;  2G0U A;  3U34 A;  4NUV A;  1UUR A;  1RZ0 A;  1SUM B;  4F6R C;  3R5L A;  3HKE E;  3UU5 A;  4GOU A;  4ZZC A;  2N1G A;  3P4P A;  3AE3 A;  3L39 A;  3A8Y C;  2QVA A;  3WI3 A;  2L8K A;  2HQ7 A;  3EAM A;  3CP3 A;  3K3O A;  3CK6 A;  4WZX A;  4HX6 A;  1G79 A;  2CMR A;  4PK6 A;  3VKH A;  4NUU A;  1JNW A;  3P8C D;  4DMW A;  3EAB A;  4ILB A;  4DV1 T;  2W67 A;  5JDM A;  4HMT A;  1W0A A;  4HWI B;  5LHH B;  2YOE A;  4YTN A;  1XWM A;  4B3M T;  2XTL A;  4LFC T;  2ACX A;  5CJ5 A;  2X0Y A;  2MPK A;  3AE5 A;  4V1A v;  4AQY T;  2XQ5 A;  4DR4 T;  3AA7 B;  3VRA A;  4HFI A;  1HX8 A;  4KBM B;  2BKP A;  4QXB B;  4JBW F;  2CE7 A;  5JR9 B;  3RH7 A;  4LMJ A;  2RP4 A;  3TLV A;  4LMK A;  1OED C;  4PJJ A;  3UUB A;  1NEK A;  4C91 A;  1B7T A;  3K3N A;  4BAY B;  3NKZ A;  4CZZ B;  4X66 T;  4H63 H;  1HR0 T;  2W66 A;  4XAX B;  4DR1 T;  3I9W A;  1DU2 A;  4HEA A;  4DR6 T;  1WFD A;  2W2U A;  1HG5 A;  1E7P A;  3ZN0 B;  2XZE A;  4QH5 A;  3RHW A;  4FI5 A;  3LJC A;  3AA0 B;  4F07 A;  3JAD A;  3H3A A;  3ANW B;  2YU2 A;  3KV6 A;  4W64 A;  4O2A E;  2GUJ A;  1CHU A;  4HWC A;  4X1Y E;  3IBP A;  2LOS A;  4HWD A;  3T1H T;  3LDQ B;  2IC6 A;  4JV5 T;  1D0Y A;  1Z8U A;  3PUQ A;  4U31 A;  2CXF A;  3RPU A;  3V5S A;  4O4J E;  3E0Z A;  3MA9 A;  4EIW A;  3ZC1 A;  5IHY A;  5DQW A;  5L3F B;  3DP7 A;  3CPZ A;  3RYH E;  4B3T T;  4A98 A;  4HFE A;  4UIG A;  3ZYM A;  3L3P A;  4PNI A;  1G8X A;  3D0T A;  3M65 A;  4PFP A;  2LEH A;  4LF7 T;  1YW0 A;  2PTF A;  2QGS A;  2R0X A;  4ZKY A;  2ES0 A;  1BR1 A;  2E5V A;  2OU5 A;  3LSV A;  4P0A A;  4B6X A;  2HQ9 A;  5JQG E;  4O4L E; 
#chains in the Genus database with same CATH homology
 2X1K A;  3VYA A;  5CHE C;  3ZOE A;  2QCK A;  3SWJ A;  1FLM A;  1RFE A;  4L82 A;  4R82 A;  3R5P A;  3R5Z A;  3H96 A;  3A6R A;  2IG6 A;  2D5M A;  4HMS A;  2FUR A;  2ECU A;  1G76 A;  3VY5 A;  3IN6 A;  3VY2 A;  1W3Q A;  2D38 A;  3U34 A;  2FHQ A;  3ZOH A;  1G77 A;  3TGV A;  3U35 A;  1RZ0 A;  1YOA A;  3R5L A;  3ZOG A;  3NFW A;  3BNK A;  2ARZ A;  3HY8 A;  2IML A;  3K87 A;  4IRA A;  2OL5 A;  4F07 A;  2D36 A;  4HMU A;  4XJ2 A;  1WLK A;  3B5M A;  3K88 A;  3A6Q A;  4HMX A;  4QVB A;  1VL7 A;  2HTD A;  1RZ1 A;  1G78 A;  2HQ7 A;  3BPK A;  4HMW A;  3CP3 A;  1I0R A;  5JAB A;  3F7E A;  2E83 A;  4HX6 A;  3DB0 A;  5CHO A;  2HHZ A;  2RE7 A;  1T9M A;  2IAB A;  1I0S A;  3PFT A;  2I02 A;  3R5W A;  1G79 A;  1EJE A;  3GAS A;  1W3R A;  1JNW A;  2A2J A;  5BNC A;  2RDE A;  3R5Y A;  2ECR A;  3AWH A;  4HMT A;  1TY9 A;  1X9B A;  3R5R A;  1W3O A;  3E4V A;  2AQ6 A;  4YBN A;  4XHY A;  2ASF A;  2QEA A;  1W3P A;  3ZOC A;  1W9A A;  1WGB A;  2GJG A;  2VPA A;  2D37 A;  1XXO A;  4YWN A;  2X1J A;  4N7R C;  3CB0 A;  2Q9K A;  4Y9I A;  1WV4 A;  3DMB A;  1CI0 A;  3DNH A;  3KYG A;  2R6V A;  3HMZ A;  1XHN A;  3FGE A;  3AMF A;  1USC A;  3KYF A;  2NR4 A;  2PTF A;  4Z85 A;  4HMV A;  1YLN A;  1Y30 A;  2R0X A;  4ZKY A;  3U0I A;  2I51 A;  1AXJ A;  3RH7 A;  3U5W A;  1WLI A;  3A20 A;  2OU5 A;  3ZOF A;  3FKH A;  3ZOD A;  3K86 A;  3BA3 A;  1USF A;  2ED4 A;  2HQ9 A;  2FG9 A;  2HTI A;  1NRG A;  1DNL A;  5ESC A;  3EC6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...