2NR4A

Crystal structure of fmn-bound protein mm1853 from methanosarcina mazei, pfam duf447
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
192
structure length
191
Chain Sequence
DLSSFGIREGISEIIASTGFEHPNAAPIGIVMKGERPFVRLFKGSHTWENVLKEKCLASNVVYDPILFVRSTFSDLVPSEFEYVDGEFKFPVLKEAIAWVVFECINLRNTDQSLVADLVPLNAGFNERNIKELPVPNRGFNAVLEATVHATRYQLTGEEKYLELIRHYESLASKCGGDAEKKAMKLIYEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved hypothetical protein
publication title Crystal structure of conserved FMN bound hypothetical protein from Methanosarcina mazei
rcsb
source organism Methanosarcina mazei
molecule tags Structural genomics, unknown function
total genus 54
structure length 191
sequence length 192
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04289 DUF447 Protein of unknown function (DUF447)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.290 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical membrane protein ta0354_69_121. 2nr4A02
2.30.110.10 Mainly Beta Roll Pnp Oxidase; Chain A Electron Transport, Fmn-binding Protein; Chain A 2nr4A01
1W3OA 2ARZA 4Y9IA 2FG9A 1W3QA 4ZKYA 1USCA 3R5PA 1WV4A 4HX6A 2VPAA 3U35A 3BNKA 3AMFA 3FKHA 1X9BA 2FURA 3DB0A 1RFEA 3F7EA 4HMSA 2R0XA 3B5MA 3E4VA 3RH7A 3PFTA 1YLNA 4L82A 4F07A 1I0RA 1W3PA 2IMLA 3R5LA 3U0IA 2RDEA 1RZ1A 3TGVA 1EJEA 2IABA 3R5WA 2I51A 1AXJA 2X1KA 2Q9KA 2GJGA 2A2JA 4XJ2A 3R5RA 3A6RA 2FHQA 3DNHA 3GASA 1G77A 5BNCA 2AQ6A 3ZODA 1T9MA 2NR4A 1Y30A 2E83A 3K87A 3VY2A 4XHYA 3VYAA 3R5ZA 4HMTA 3HMZA 2D37A 4Z85A 2ED4A 3VY5A 3ZOFA 4HMVA 1XXOA 3A20A 4N7RC 2HTIA 3ZOGA 1FLMA 3U5WA 1G78A 3CP3A 1JNWA 3ZOEA 2HQ7A 2QCKA 2D36A 1WLIA 3IN6A 5ESCA 2D5MA 2ASFA 2HHZA 2OL5A 4R82A 1G79A 1YOAA 3HY8A 4YWNA 3A6QA 1G76A 2QEAA 3FGEA 1NRGA 1W3RA 5JABA 2RE7A 3K86A 1DNLA 3BA3A 3CB0A 3U34A 3SWJA 3AWHA 2R6VA 1RZ0A 2IG6A 2X1JA 1I0SA 2ECRA 3R5YA 2HTDA 1XHNA 3H96A 4IRAA 5CHOA 1VL7A 3EC6A 3KYGA 3ZOHA 2OU5A 2ECUA 4HMXA 3K88A 1TY9A 2I02A 4HMWA 1WGBA 3NFWA 3BPKA 2HQ9A 2D38A 1WLKA 4HMUA 3ZOCA 3DMBA 5CHEC 1CI0A 1USFA 1W9AA 4YBNA 3KYFA 2PTFA 4QVBA
chains in the Genus database with same CATH superfamily
2VB6A 3R5PA 2VPAA 1UK5A 2XQ5A 3AMFA 3AA0B 1OWAA 3I1AA 3I9WA 3I9YA 3E4VA 1W3PA 3U0IA 2V5CA 2WP9A 4ZZCA 1IBMT 2WZHA 2FUPA 4A56A 4U2YA 3UUBA 4QXBB 2H7VC 1D0YA 3CK6A 2XY8B 3ZN0B 3RGLA 4JYAT 1JNZA 2KXPB 5FVLA 4YSYA 1JNWA 2MOZA 3L8RA 4NUVA 4QX8B 2E2AA 2CEAA 3N9PA 3Q5XA 3FZKB 1FMVA 4PNIA 4BJMA 3I0QA 4UV9B 2JQ9A 5LG3A 3RC3A 2D5UA 5FY0A 1XDOA 1MMNA 5AQKB 2NTXA 4PJJA 4K0UA 4BAYB 2D2SA 1SA0E 5HXSA 3CMLA 3RLFF 4XBFB 3AA7B 4UXNB 2L3LA 2XQ4A 1VCSA 3ZYMA 4IREA 5CB4E 2ECUA 4FI5A 3BPKA 2XUEA 5HEHA 5L3FB 5LBQB 4EZ4A 4LFCT 3DTOA 4JUYA 4CI2B 4PFOA 1W3QA 3RYFE 2ODVA 3K3QC 2KT9A 2NW8A 2XQYA 3ETUA 5FP3A 3RC8A 2EHOC 3KV5A 5IYZE 1LVKA 2RDEA 1EJEA 3SOLA 1VRBA 3GA8A 3P7IA 5CA0E 4EOZB 3O1HA 1G77A 2ZM6T 4CZZB 4U2ZA 2R6GF 2H88A 2VVNA 4JLEA 3PTRB 5HAXA 5LHGB 5ABGA 3KDSE 4HMVA 4I4TE 2HTIA 5HXEA 4YLHA 1W09A 2BKNA 4L5GA 4EEDA 1D0XA 2D5MA 2LT3A 3LFMA 2UXDT 1UURA 5LYJE 4AIUA 3G06A 2E9XC 2XQAA 3MZKB 3MACA 1HR0T 1W0AA 1NRGA 3JC6C 4IDQA 1UGOA 3K3OA 5KMGP 5ABFB 5HCMA 2IG6A 5LGTB 3FZMB 1NWMX 3VR9A 4OYKA 4HFVA 3TLUA 3CX8B 2W67A 4IDZA 2XASB 4TUYE 1CUNA 1T7SA 3EDVA 5HEOA 1XNQT 1KF6A 3EUHA 2K9AA 5CHEC 4LF6T 1CI0A 1U5PA 1W9AA 2DCFA 4UV8B 2LSGA 3I0OA 4O2BE 2FG9A 4GYSA 5JR9B 3GWHA 4MALA 4LF9T 4QXHB 1RFEA 4YTPA 4A5XA 3ZPOA 4YTNA 2E8IA 1I6ZA 4EB6E 4AQGA 3ZMSB 2LLYA 5FYMA 2LHNA 3AVSA 1AXJA 3AE1A 2X1KA 4TWHA 4GYRA 1SUMB 1H7CA 1W9RA 4X1YE 2UXNB 2WWUA 4NXMT 3GASA 5JDLA 2JMKA 3PUQA 2XPKA 2P9BA 4P1NA 3TLSA 3T1HT 1E1HB 4HN9A 5JR9A 4EEBA 4ZI3C 3GN5B 5LJMA 5DABA 4IIJE 3LDQB 1XWMA 3OVUA 1CHUA 3KVBA 4XZCA 4AQFA 2JQQA 4AKRB 4I0UA 2KWHA 4YWNA 1T98A 2B1EA 4PAGA 2Q9QC 2DLRA 2LHRA 3GN5A 4DBRA 1B7TA 4YSXA 2CMRA 1V9DA 3MKDA 4HWHA 5AQJB 3RRWA 2WB5A 5CFBA 4QWNB 3U34A 1N32T 4EYYR 3AE7A 1SHZC 2J1DG 4ZS2A 2G0UA 3B13A 3F2EA 4TNWA 4I43B 1FMWA 5HCJA 3HE1A 4ERRA 3ZOHA 4IHJE 2Y48B 2IIUA 4DR3T 1MMDA 3F31A 5IWAT 4BJNA 3EABA 2FJAA 5L47A 1Z0PA 3ZKRA 3WAJA 1FJGT 4ZI2D 4IE0A 4WBNE 4TN7B 2GUJA 2XM2A 3ZJ1A 2BG9E 3T1YT 3X1DA 4DUZT 3JAFA 4UVCB 4U7YA 3P4RA 3RYHE 2XAQB 2Q9QB 3UFEA 4CN1A 1Y30A 5FNVE 5LMNT 4X1KE 2X51A 4TNVA 1UX4A 3M65A 4LF8T 4Z8XA 4W64A 2H89A 3AEBA 5H6QB 3AA1B 2VKHA 4ISSA 3EAAA 2IC6A 3LBXA 2IDOB 3ZOEA 4HWDA 3UU4A 3RYCE 5BMVE 5CJ5A 2YDSA 1HNZT 1UUSA 3RQUA 4X66T 1GQEA 5AQVB 1WLXA 3VKGA 1XMOT 5HEJA 2CHNA 2QRXA 2YU2A 3P50A 4HFCA 2ZM2A 3RH3A 4DIDB 5JDMA 1I0SA 3AE6A 4ZZBA 1XHNA 4IE5A 4CXYA 4DNDA 5CHOA 4KI0F 1QUUA 1XDPA 5HYAA 2HH7A 3RYIE 1I94T 4JI3T 1WGBA 2HQ9A 4DO0A 2K24A 4QHOA 1ZP0A 3R6NA 3KINB 3IF8B 2CXFA 3D0TA 2XAJB 4YBNA 5LBMA 3SFEA 2WS3A 3QOFA 4HMSA 2R0XA 1UX5A 4M1PA 3C4ZA 1YLNA 2VASA 4F07A 4WW0A 2WU2A 4HFDA 4EZHA 1G8XA 2V7MA 4HWIB 5E0OA 1WRDA 3AEEA 3UQ7A 2RPAA 3N9NA 3O1JA 1MMGA 2F4VT 4ILBA 2NR4A 3HKDE 2BZBA 4YJ2E 2D37A 1DU2A 4P09A 3NVOA 4LMKA 4X62T 4HFHA 1HTJF 1WLIA 1G73A 4JI4T 3C4WA 2AXDS 5DQVA 4QX7B 4X20E 3ZYKA 2KMFA 3OKQA 2XJ7A 5JABA 4H9PC 4EIWA 4X1IE 4U3CA 1DNLA 3M3ZB 3V5SA 3SWJA 1T8BA 5AQTB 2HN2A 5LP6E 2DI4A 3QB5K 4HFBA 4H9RC 2ZM0A 2YKSA 4KHPT 5LCYA 1U4QA 4HMXA 2I6HA 4UVBB 3FZLB 1HNXT 3NWIA 2LSJA 3AXJB 4U33A 2UXCT 2H3RA 1XMQT 2X9HA 2CXLA 4ZKYA 4DR6T 2YU1A 3N5LA 1T72A 4PJNA 4YHHT 3B5MA 3RH7A 3U78A 2BS2A 5LMUT 2JQHA 1HNWT 3EI0A 1Y12A 3TLVA 3ZC1A 4QH5A 3LK2B 5LHIB 5JDHA 4C91A 2C5IT 3K87A 4DV1T 3CQXC 2HPLA 5AQSB 4EAHA 1YXRA 3ZLIA 1MNEA 1SE7A 4XAXB 2HPJA 3R84B 2W63A 3FXDB 4IT4A 2X0HA 5AQPB 2WY2A 3CPZA 4H9NC 5AQLB 4MHCA 4AQYT 2JJ9A 4TX5A 3A6QA 1YW0A 4IE6A 4GK5E 4AKLA 5JDQA 3KVAA 4LF5T 3HL6A 1KEYA 3N2GE 4CXWA 1UCUA 4CI3B 3VRAA 3PUWF 4B3ST 2NOXA 3C4XA 4IRAA 5AFUL 2D38A 1QLBA 5L3BB 2X68A 2KSRA 2N1GA 5ABHA 4QVBA 4DV2T 1W3OA 3U35A 4JI8T 4YJ3E 3BNKA 3VR8A 2DWGA 2V7IA 4PJMA 3PFTA 3QB5A 4IL9A 3AE8A 3FBLA 4HWCA 5LXTE 2YK0A 2K5BB 2I51A 3Q2MA 2K4QA 5J2TE 1YKHB 4Z90A 2A9UA 4HMTA 3P8CD 2CBIA 3L39A 3ZOFA 3RPUA 2UUCT 5L2LA 2HHHT 3RRCA 3MK7C 2ASFA 4EGWA 3P4PA 3QK6A 1M7KA 4LFAT 5JVDE 2NP9A 3VHLA 2JRKA 4I55E 5JR9C 3AAEB 4MLKA 4HEAA 4DR7T 3LSVA 3ONLC 4FJOA 1HF8A 2L8KA 4U7IA 2Y6XA 2LSIA 1HS7A 3EC6A 2OU5A 5BR8T 4DV6T 2W62A 4AQFC 4KMCA 1N34T 2ZM8A 4ZI2C 2WZIA 3KV9A 2IUBA 3O9XA 4G63A 5DQWA 1L0VA 4PK4A 1KNZA 2IW5B 4TV9E 5ETWA 3DB0A 2RP4A 1US7B 3H3AA 3OBVE 2E5LT 4QH1A 2XHEB 4IDNA 3UUMA 4TV4A 5JTGA 1BR2A 4HGAA 2A2JA 3ABVA 3ZODA 2KLQA 5C2TA 4JEUB 4XHYA 3EVYA 4IE7A 4C90A 3UUNA 3BQIA 3LG7A 5JH7E 4X65T 4YXDA 1OEDB 4GKJT 2A2FX 4QXCB 4AKIA 2V7JA 1G78A 5L4EA 2V6XA 4AXPA 1KNPA 2WU5A 5FL0A 3IN6A 2WAUA 1LRZA 4QH4A 3ZJ2A 3OTOT 4UELA 4HWFA 1G79A 4B3TT 4Q25A 1LKXA 4OK0A 2XQ9A 5JDGA 2W66A 4KUMB 2NW9A 5EZYE 1OEDA 5F8PA 4LF4T 4A98A 3A7MA 3MA9A 3UULA 2FBWA 3CB0A 3AWHA 3ZT5A 4JI7T 5L3CB 5L3EB 4TV8E 4NUUA 2BBJA 3ZMTB 3WI3A 3AA6B 2VKJA 5FKYA 3JCFA 3ZSSA 2X66A 5AQIB 2KWIB 3PUVF 2I02A 5LB7B 4K0KT 4JI2T 3IHRA 2EHOD 4ILAA 2LKHA 4Y9IA 5AQRB 1MNDA 1X9BA 2VKOA 5EK4A 1I0RA 3UU5A 4U74A 2IAKA 2LEHA 5C8YE 2BBHA 2CHOA 5LG4A 5BNCA 1BR1A 2CE7A 3K8PC 4IDOA 2D0UA 1HX1B 3PUAA 4WYVA 1Y01A 2E9XD 4NPPA 2QVAA 3LBXB 2DNXA 2N2NA 1KFYA 2D36A 5AQQB 4DMVA 3W15B 2W4XA 4UHVA 2LSYA 3JADA 4R82A 4A97A 3AB3B 4UVAB 4U72A 4ZS3A 1BR4A 1NAFA 2MAWA 3PU3A 2QA7A 3Q5EA 2V5DA 2UUBT 2HN1A 2PG8A 2SPCA 3NRXA 4CN6A 2UU9T 4JV5T 4OFZA 1D1AA 2XM1A 2WDVA 4CXXA 1J1JA 4AKHA 3NFWA 2CRBA 1LVFA 2L1TA 5HEUA 1EZ3A 1MMAA 1MIYA 2WQYA 2FJEA 2UUAT 3C98B 4TZ4C 2K48A 1FEWA 4PW8A 1VOMA 3ZCIA 4WZXA 4UIGA 4H63H 2FJBA 3J7Yq 4ZI3D 4GK0E 2IABA 3R5WA 1D1BA 4UF0A 3SS1A 5M4YA 4LFBT 2YEVC 5CGMA 3RHWA 2XAHB 3AEFA 2FHQA 2LM2A 1WR0A 3RKOA 3H3MA 1T9MA 1Y64B 2VKDA 1QSDA 3UTKA 2XQ7A 3VU7H 2V7LA 1X79A 4L9IA 2H7OA 3ZOGA 4DR4T 3P4SA 2BVLA 3TLWA 5JDFA 3NZQA 4ISTA 4TWFA 5AQOB 5AQNB 3BK9A 4NIQA 5ESCA 2MTQA 2XAGB 2V7KA 1KK7A 2OL5A 5KDMC 1FIOA 2VK9A 4IDPA 4H63V 4YTMA 2VQFT 1HCIA 2M6IA 4HE8A 3NZPA 4DV0T 1J5WA 4AI6A 4OYJA 3PUSA 1JNRA 2CPTA 3P4QA 2WBLA 2YOEA 5IUXA 3KV4A 5ADXL 2LOPA 4DUYT 2OA5A 3DP7A 4JEHB 4GIWA 3UU3A 3DMBA 2BS4A 5LGUB 2VURA 4DR2T 2WMOA 2YN6A 4O8SA 3KBTA 3PU8A 2K3WA 1W0BA 1WCRA 4B6XA 1D1CA 4JI6T 5ABEA 1N33T 2I0MA 3ANWB 3UU8A 2BKOA 3PUGA 5C3JA 2CA5A 3SRZA 2IMLA 3PV0F 4KBMB 1XNRT 3AE3A 2Z6EA 5GONE 4LMJA 3N2KE 3Q5DA 1YQ3A 2VL8A 3FB2A 2AQ6A 1O3XA 3UU6A 2E83A 2J62A 3NRYA 2KINB 3EDUA 5AQUB 4ADZA 3ANWA 3PURA 4Z85A 4O2AE 3HA4A 2UXBT 2DHRA 3N9MA 1ZHCA 3MXZA 3CP3A 3C64A 3OYXA 2QCKA 3MJXA 2WDQA 1D0ZA 1XZYA 2XSAA 3HKBE 3K1SA 3KFWX 2MPKA 4ANJA 5AQGB 4DMWA 1RZ0A 4Z91A 2NW7A 3R5YA 2W61A 3B57A 3FBZA 2V6YA 3KYGA 3FHNA 1WYCA 2E5VA 5L3GB 3Q9DA 5L3DB 1HG5A 3RIUA 5LA6E 5J1GA 2YINA 4PK6A 2ARZA 4ZEYA 4JI0T 2X9XA 3AE9A 4B3RT 2FURA 3K3NA 3F7EA 4HFEA 5H6RB 3C51A 3CQCB 4CN4A 2XZEA 3PJAJ 3RIAA 5EK2A 2D9DA 3TGVA 1OXZA 3E22E 2GJGA 4YT0A 2KZ7B 2WCAA 1ZKEA 1MIVA 3CX7B 3VYAA 2LSKA 2XQ3A 5JDNA 3PUYF 4N7RC 2VQET 3BQLA 4WNKA 2X0YA 2ODUA 2FJDA 5FY1A 2BS3A 3QUJA 2LRKA 1ZV4X 4YFSA 4HKHA 3P4WA 4HKAA 1G76A 3RIFA 1IBLT 3RKGA 3AEAA 3AECA 2C5KT 3C50A 4GKKT 5HXCA 4LF7T 2X1JA 3CVRA 5KXJA 5IHYA 3SFDA 4JI5T 3H96A 2ACZA 5FMNA 1S35A 5J2UE 3S4UA 2X9YA 3K88A 1TY9A 5KX5E 1WLKA 4IE4A 5CA1E 5LNKA 5F5WA 2W0GA 2N9DA 5JQGE 1IJ6A 1OEDC 3O4XE 1WV4A 1YQ4A 3QC9A 3AE5A 2X9WA 3LJCA 2JPFA 4L82A 3RF1A 4PK5A 1YD8G 4ZOLE 4XJ2A 4IL4A 3A6RA 4P0AA 4DR1T 2JQKA 2MBGA 3HMZA 2GK9A 4MBQA 3VY5A 1IZNB 1Z8UA 4TWDA 1WR6A 2JIWA 3U5WA 2BVMA 2CBJA 1AJ3A 3HKEE 3HKCE 3AVRA 2DWKA 2EHOB 1R8IA 2HHZA 3CX6B 2W2UA 3ZEFB 1E2AA 5HWXA 1ZEEA 4X5TA 3CIRA 4DV7T 2VL0A 3PJAA 4COFA 3ZC0A 4EYUA 3K86A 4JI1T 5ABFA 3ZN1B 3L3PA 4YSZA 2C0SA 2CM0A 2EHOA 3H37A 1VL7A 4HTEA 5AQHB 3JAEA 5LGNB 2V8SV 3U3IA 3GMIA 2BG9C 4AKGA 1OEDE 2LE8A 5LJNA 1VCTA 3VRBA 2E9XB 2PTFA 2NTYA 3V4HA 2RA1A 2C5JA 2ZLYA 2P5ZX 4DV4T 4HX6A 3NKZA 4F8HA 2ZMAA 3KV6A 2PBIA 3RQWA 3EAMA 5FY7A 4UEMA 4KX6A 2A3DA 4ILUA 5FL1A 2Q9KA 3OJAA 3LK42 3PUZF 3R5RA 2E9XA 4B3MT 1IAPA 2D0TA 3ZMUB 2KNDA 4BA9A 4EXTA 2YDQA 2A72A 4MFRA 4ILCA 4ZI7E 2V1DB 4WBOA 1M62A 3NBXX 5AQFB 2QYWA 3ESLA 3WAKA 3FZHB 3ZMVB 4HFIA 2BG9B 5FVKA 2CCQA 1YOAA 2YDRA 4DV3T 3KBUA 2OV9A 4DVDA 2QEAA 3IBPA 4G2AA 2V26A 3Q5WA 4E7ZA 1W3RA 2QGSA 4OX9T 4L0RA 3JC6D 3N9QA 1HX8A 4E7SA 2WDRA 2ES0A 2BG9A 2WWVA 2XAFB 2WM9A 4IGUA 3PDYA 3O1IA 4LMLA 2ACXA 3EHZA 5DJQC 4N78D 4I50E 2WSSV 3AEGA 2IHR1 3KYFA 3ZT6A 3UT5E 3IA3A 4O4IE 4DR5T 3SWHA 3OYZA 3AE2A 2X67A 2J47A 3A8YC 2LJLA 1WFDA 3R5LA 5F3JA 2BKPA 4UF0B 4H9QC 3ETVA 4ZXLA 1IBKT 3FXEB 5HXRA 4ZHQE 5LHHB 2XQ6A 4H9SE 3J9X1 3DNHA 2Q9QA 4O4HE 5HWYA 3OPCA 3T8OA 5HXHA 2LOSA 5FXVA 5L4HA 3A5XA 2ED4A 3ZT7A 1BR0A 2PJQA 2UXXB 1XXOA 3A20A 1NENA 4V1Av 2CWYA 5JREA 3IEEA 3TKLB 4NXNT 2M6BA 2VVSA 3UFGA 3DJBA 4EV6A 2IC9A 5EK3A 5FXWA 2XTLA 2XSBA 3FGEA 4CI1B 2Q9QD 3RI5A 4O4LE 3ZCJA 3BA3A 3PUXF 4U31A 4DBQA 3AAIA 2R6VA 3UQ4A 2ECRA 5JRCB 3N9LA 3ONJA 3QNUA 3CQGB 5J0ZA 2CLYC 2MYSA 4KP3C 4J2CA 2WMNA 2J4GA 4H9OC 1KNRA 2BDEA 3LK3B 3ZMZB 2PFVA 2LRLA 4MTKA 4AISA 2CXDA 3E08A 1USCA 4PFPA 4KHZF 5JRCA 3FKHA 2X0LB 4P0BA 5AQMB 2CWOA 1HG2A 4OHFA 3TLTA 3PE0A 3ZSTA 4PJLA 2AE9A 3HR0A 5A1LA 4ASKA 1RZ1A 2VWAA 5FXZA 4X64T 4CQIA 2I59A 1MIWA 3ONXA 3RIUC 3F57A 3VY2A 3R5ZA 3ZYLA 3UUXB 1S94A 2NWBA 1E7PA 2LKGA 1N36T 2DL1A 3CWZB 2L9QA 4F6RC 2CLYB 1FLMA 3N9OA 3N2OA 3AEDA 3AAAB 3HI2A 2HQ7A 4O4JE 3RX6A 2Y8DA 1YKEB 2W00A 3VKHA 4JBWF 1ZOYA 4YHJA 3HY8A 3AE4A 4YY3T 2OLTA 1HFAA 5FXXA 3FZFB 3E0ZA 2RE7A 1IJ5A 4QKNA 3V5UA 1J5ET 2JMHA 4GOUA 3L09A 2HTDA 2V6YB 5TAOA 5HEGA 4UR9A 3CKDA 4HMWA 2B76A 4DV5T 4HMUA 5LOVE 3ZOCA 1WYBA 2M67A 2LM9A 2XQ8A 3AXJA 1USFA 1NEKA 3BQKA
chains in the Genus database with same CATH topology
1W3OA 2ARZA 4Y9IA 2FG9A 1W3QA 4ZKYA 1USCA 3R5PA 1WV4A 4HX6A 2VPAA 3U35A 3BNKA 3AMFA 3FKHA 1X9BA 2FURA 3DB0A 1RFEA 3F7EA 4HMSA 2R0XA 3B5MA 3E4VA 3RH7A 3PFTA 1YLNA 4L82A 4F07A 1I0RA 1W3PA 2IMLA 3R5LA 3U0IA 2RDEA 1RZ1A 3TGVA 1EJEA 2IABA 3R5WA 2I51A 1AXJA 2X1KA 2Q9KA 2GJGA 2A2JA 4XJ2A 3R5RA 3A6RA 2FHQA 3DNHA 3GASA 1G77A 5BNCA 2AQ6A 3ZODA 1T9MA 2NR4A 1Y30A 2E83A 3K87A 3VY2A 4XHYA 3VYAA 3R5ZA 4HMTA 3HMZA 2D37A 4Z85A 2ED4A 3VY5A 3ZOFA 4HMVA 1XXOA 3A20A 4N7RC 2HTIA 3ZOGA 1FLMA 3U5WA 1G78A 3CP3A 1JNWA 3ZOEA 2HQ7A 2QCKA 2D36A 1WLIA 3IN6A 5ESCA 2D5MA 2ASFA 2HHZA 2OL5A 4R82A 1G79A 1YOAA 3HY8A 4YWNA 3A6QA 1G76A 2QEAA 3FGEA 1NRGA 1W3RA 5JABA 2RE7A 3K86A 1DNLA 3BA3A 3CB0A 3U34A 3SWJA 3AWHA 2R6VA 1RZ0A 2IG6A 2X1JA 1I0SA 2ECRA 3R5YA 2HTDA 1XHNA 3H96A 4IRAA 5CHOA 1VL7A 3EC6A 3KYGA 3ZOHA 2OU5A 2ECUA 4HMXA 3K88A 1TY9A 2I02A 4HMWA 1WGBA 3NFWA 3BPKA 2HQ9A 2D38A 1WLKA 4HMUA 3ZOCA 3DMBA 5CHEC 1CI0A 1USFA 1W9AA 4YBNA 3KYFA 2PTFA 4QVBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W3O A;  2ARZ A;  4Y9I A;  2FG9 A;  1W3Q A;  4ZKY A;  1USC A;  3R5P A;  1WV4 A;  4HX6 A;  2VPA A;  3U35 A;  3BNK A;  3AMF A;  3FKH A;  1X9B A;  2FUR A;  3DB0 A;  1RFE A;  3F7E A;  4HMS A;  2R0X A;  3B5M A;  3E4V A;  3RH7 A;  3PFT A;  1YLN A;  4L82 A;  4F07 A;  1I0R A;  1W3P A;  2IML A;  3R5L A;  3U0I A;  2RDE A;  1RZ1 A;  3TGV A;  1EJE A;  2IAB A;  3R5W A;  2I51 A;  1AXJ A;  2X1K A;  2Q9K A;  2GJG A;  2A2J A;  4XJ2 A;  3R5R A;  3A6R A;  2FHQ A;  3DNH A;  3GAS A;  1G77 A;  5BNC A;  2AQ6 A;  3ZOD A;  1T9M A;  2NR4 A;  1Y30 A;  2E83 A;  3K87 A;  3VY2 A;  4XHY A;  3VYA A;  3R5Z A;  4HMT A;  3HMZ A;  2D37 A;  4Z85 A;  2ED4 A;  3VY5 A;  3ZOF A;  4HMV A;  1XXO A;  3A20 A;  4N7R C;  2HTI A;  3ZOG A;  1FLM A;  3U5W A;  1G78 A;  3CP3 A;  1JNW A;  3ZOE A;  2HQ7 A;  2QCK A;  2D36 A;  1WLI A;  3IN6 A;  5ESC A;  2D5M A;  2ASF A;  2HHZ A;  2OL5 A;  4R82 A;  1G79 A;  1YOA A;  3HY8 A;  4YWN A;  3A6Q A;  1G76 A;  2QEA A;  3FGE A;  1NRG A;  1W3R A;  5JAB A;  2RE7 A;  3K86 A;  1DNL A;  3BA3 A;  3CB0 A;  3U34 A;  3SWJ A;  3AWH A;  2R6V A;  1RZ0 A;  2IG6 A;  2X1J A;  1I0S A;  2ECR A;  3R5Y A;  2HTD A;  1XHN A;  3H96 A;  4IRA A;  5CHO A;  1VL7 A;  3EC6 A;  3KYG A;  3ZOH A;  2OU5 A;  2ECU A;  4HMX A;  3K88 A;  1TY9 A;  2I02 A;  4HMW A;  1WGB A;  3NFW A;  3BPK A;  2HQ9 A;  2D38 A;  1WLK A;  4HMU A;  3ZOC A;  3DMB A;  5CHE C;  1CI0 A;  1USF A;  1W9A A;  4YBN A;  3KYF A;  2PTF A;  4QVB A; 
#chains in the Genus database with same CATH topology
 2VB6 A;  3R5P A;  2VPA A;  1UK5 A;  2XQ5 A;  3AMF A;  3AA0 B;  1OWA A;  3I1A A;  3I9W A;  3I9Y A;  3E4V A;  1W3P A;  3U0I A;  2V5C A;  2WP9 A;  4ZZC A;  1IBM T;  2WZH A;  2FUP A;  4A56 A;  4U2Y A;  3UUB A;  4QXB B;  2H7V C;  1D0Y A;  3CK6 A;  2XY8 B;  3ZN0 B;  3RGL A;  4JYA T;  1JNZ A;  2KXP B;  5FVL A;  4YSY A;  1JNW A;  2MOZ A;  3L8R A;  4NUV A;  4QX8 B;  2E2A A;  2CEA A;  3N9P A;  3Q5X A;  3FZK B;  1FMV A;  4PNI A;  4BJM A;  3I0Q A;  4UV9 B;  2JQ9 A;  5LG3 A;  3RC3 A;  2D5U A;  5FY0 A;  1XDO A;  1MMN A;  5AQK B;  2NTX A;  4PJJ A;  4K0U A;  4BAY B;  2D2S A;  1SA0 E;  5HXS A;  3CML A;  3RLF F;  4XBF B;  3AA7 B;  4UXN B;  2L3L A;  2XQ4 A;  1VCS A;  3ZYM A;  4IRE A;  5CB4 E;  2ECU A;  4FI5 A;  3BPK A;  2XUE A;  5HEH A;  5L3F B;  5LBQ B;  4EZ4 A;  4LFC T;  3DTO A;  4JUY A;  4CI2 B;  4PFO A;  1W3Q A;  3RYF E;  2ODV A;  3K3Q C;  2KT9 A;  2NW8 A;  2XQY A;  3ETU A;  5FP3 A;  3RC8 A;  2EHO C;  3KV5 A;  5IYZ E;  1LVK A;  2RDE A;  1EJE A;  3SOL A;  1VRB A;  3GA8 A;  3P7I A;  5CA0 E;  4EOZ B;  3O1H A;  1G77 A;  2ZM6 T;  4CZZ B;  4U2Z A;  2R6G F;  2H88 A;  2VVN A;  4JLE A;  3PTR B;  5HAX A;  5LHG B;  5ABG A;  3KDS E;  4HMV A;  4I4T E;  2HTI A;  5HXE A;  4YLH A;  1W09 A;  2BKN A;  4L5G A;  4EED A;  1D0X A;  2D5M A;  2LT3 A;  3LFM A;  2UXD T;  1UUR A;  5LYJ E;  4AIU A;  3G06 A;  2E9X C;  2XQA A;  3MZK B;  3MAC A;  1HR0 T;  1W0A A;  1NRG A;  3JC6 C;  4IDQ A;  1UGO A;  3K3O A;  5KMG P;  5ABF B;  5HCM A;  2IG6 A;  5LGT B;  3FZM B;  1NWM X;  3VR9 A;  4OYK A;  4HFV A;  3TLU A;  3CX8 B;  2W67 A;  4IDZ A;  2XAS B;  4TUY E;  1CUN A;  1T7S A;  3EDV A;  5HEO A;  1XNQ T;  1KF6 A;  3EUH A;  2K9A A;  5CHE C;  4LF6 T;  1CI0 A;  1U5P A;  1W9A A;  2DCF A;  4UV8 B;  2LSG A;  3I0O A;  4O2B E;  2FG9 A;  4GYS A;  5JR9 B;  3GWH A;  4MAL A;  4LF9 T;  4QXH B;  1RFE A;  4YTP A;  4A5X A;  3ZPO A;  4YTN A;  2E8I A;  1I6Z A;  4EB6 E;  4AQG A;  3ZMS B;  2LLY A;  5FYM A;  2LHN A;  3AVS A;  1AXJ A;  3AE1 A;  2X1K A;  4TWH A;  4GYR A;  1SUM B;  1H7C A;  1W9R A;  4X1Y E;  2UXN B;  2WWU A;  4NXM T;  3GAS A;  5JDL A;  2JMK A;  3PUQ A;  2XPK A;  2P9B A;  4P1N A;  3TLS A;  3T1H T;  1E1H B;  4HN9 A;  5JR9 A;  4EEB A;  4ZI3 C;  3GN5 B;  5LJM A;  5DAB A;  4IIJ E;  3LDQ B;  1XWM A;  3OVU A;  1CHU A;  3KVB A;  4XZC A;  4AQF A;  2JQQ A;  4AKR B;  4I0U A;  2KWH A;  4YWN A;  1T98 A;  2B1E A;  4PAG A;  2Q9Q C;  2DLR A;  2LHR A;  3GN5 A;  4DBR A;  1B7T A;  4YSX A;  2CMR A;  1V9D A;  3MKD A;  4HWH A;  5AQJ B;  3RRW A;  2WB5 A;  5CFB A;  4QWN B;  3U34 A;  1N32 T;  4EYY R;  3AE7 A;  1SHZ C;  2J1D G;  4ZS2 A;  2G0U A;  3B13 A;  3F2E A;  4TNW A;  4I43 B;  1FMW A;  5HCJ A;  3HE1 A;  4ERR A;  3ZOH A;  4IHJ E;  2Y48 B;  2IIU A;  4DR3 T;  1MMD A;  3F31 A;  5IWA T;  4BJN A;  3EAB A;  2FJA A;  5L47 A;  1Z0P A;  3ZKR A;  3WAJ A;  1FJG T;  4ZI2 D;  4IE0 A;  4WBN E;  4TN7 B;  2GUJ A;  2XM2 A;  3ZJ1 A;  2BG9 E;  3T1Y T;  3X1D A;  4DUZ T;  3JAF A;  4UVC B;  4U7Y A;  3P4R A;  3RYH E;  2XAQ B;  2Q9Q B;  3UFE A;  4CN1 A;  1Y30 A;  5FNV E;  5LMN T;  4X1K E;  2X51 A;  4TNV A;  1UX4 A;  3M65 A;  4LF8 T;  4Z8X A;  4W64 A;  2H89 A;  3AEB A;  5H6Q B;  3AA1 B;  2VKH A;  4ISS A;  3EAA A;  2IC6 A;  3LBX A;  2IDO B;  3ZOE A;  4HWD A;  3UU4 A;  3RYC E;  5BMV E;  5CJ5 A;  2YDS A;  1HNZ T;  1UUS A;  3RQU A;  4X66 T;  1GQE A;  5AQV B;  1WLX A;  3VKG A;  1XMO T;  5HEJ A;  2CHN A;  2QRX A;  2YU2 A;  3P50 A;  4HFC A;  2ZM2 A;  3RH3 A;  4DID B;  5JDM A;  1I0S A;  3AE6 A;  4ZZB A;  1XHN A;  4IE5 A;  4CXY A;  4DND A;  5CHO A;  4KI0 F;  1QUU A;  1XDP A;  5HYA A;  2HH7 A;  3RYI E;  1I94 T;  4JI3 T;  1WGB A;  2HQ9 A;  4DO0 A;  2K24 A;  4QHO A;  1ZP0 A;  3R6N A;  3KIN B;  3IF8 B;  2CXF A;  3D0T A;  2XAJ B;  4YBN A;  5LBM A;  3SFE A;  2WS3 A;  3QOF A;  4HMS A;  2R0X A;  1UX5 A;  4M1P A;  3C4Z A;  1YLN A;  2VAS A;  4F07 A;  4WW0 A;  2WU2 A;  4HFD A;  4EZH A;  1G8X A;  2V7M A;  4HWI B;  5E0O A;  1WRD A;  3AEE A;  3UQ7 A;  2RPA A;  3N9N A;  3O1J A;  1MMG A;  2F4V T;  4ILB A;  2NR4 A;  3HKD E;  2BZB A;  4YJ2 E;  2D37 A;  1DU2 A;  4P09 A;  3NVO A;  4LMK A;  4X62 T;  4HFH A;  1HTJ F;  1WLI A;  1G73 A;  4JI4 T;  3C4W A;  2AXD S;  5DQV A;  4QX7 B;  4X20 E;  3ZYK A;  2KMF A;  3OKQ A;  2XJ7 A;  5JAB A;  4H9P C;  4EIW A;  4X1I E;  4U3C A;  1DNL A;  3M3Z B;  3V5S A;  3SWJ A;  1T8B A;  5AQT B;  2HN2 A;  5LP6 E;  2DI4 A;  3QB5 K;  4HFB A;  4H9R C;  2ZM0 A;  2YKS A;  4KHP T;  5LCY A;  1U4Q A;  4HMX A;  2I6H A;  4UVB B;  3FZL B;  1HNX T;  3NWI A;  2LSJ A;  3AXJ B;  4U33 A;  2UXC T;  2H3R A;  1XMQ T;  2X9H A;  2CXL A;  4ZKY A;  4DR6 T;  2YU1 A;  3N5L A;  1T72 A;  4PJN A;  4YHH T;  3B5M A;  3RH7 A;  3U78 A;  2BS2 A;  5LMU T;  2JQH A;  1HNW T;  3EI0 A;  1Y12 A;  3TLV A;  3ZC1 A;  4QH5 A;  3LK2 B;  5LHI B;  5JDH A;  4C91 A;  2C5I T;  3K87 A;  4DV1 T;  3CQX C;  2HPL A;  5AQS B;  4EAH A;  1YXR A;  3ZLI A;  1MNE A;  1SE7 A;  4XAX B;  2HPJ A;  3R84 B;  2W63 A;  3FXD B;  4IT4 A;  2X0H A;  5AQP B;  2WY2 A;  3CPZ A;  4H9N C;  5AQL B;  4MHC A;  4AQY T;  2JJ9 A;  4TX5 A;  3A6Q A;  1YW0 A;  4IE6 A;  4GK5 E;  4AKL A;  5JDQ A;  3KVA A;  4LF5 T;  3HL6 A;  1KEY A;  3N2G E;  4CXW A;  1UCU A;  4CI3 B;  3VRA A;  3PUW F;  4B3S T;  2NOX A;  3C4X A;  4IRA A;  5AFU L;  2D38 A;  1QLB A;  5L3B B;  2X68 A;  2KSR A;  2N1G A;  5ABH A;  4QVB A;  4DV2 T;  1W3O A;  3U35 A;  4JI8 T;  4YJ3 E;  3BNK A;  3VR8 A;  2DWG A;  2V7I A;  4PJM A;  3PFT A;  3QB5 A;  4IL9 A;  3AE8 A;  3FBL A;  4HWC A;  5LXT E;  2YK0 A;  2K5B B;  2I51 A;  3Q2M A;  2K4Q A;  5J2T E;  1YKH B;  4Z90 A;  2A9U A;  4HMT A;  3P8C D;  2CBI A;  3L39 A;  3ZOF A;  3RPU A;  2UUC T;  5L2L A;  2HHH T;  3RRC A;  3MK7 C;  2ASF A;  4EGW A;  3P4P A;  3QK6 A;  1M7K A;  4LFA T;  5JVD E;  2NP9 A;  3VHL A;  2JRK A;  4I55 E;  5JR9 C;  3AAE B;  4MLK A;  4HEA A;  4DR7 T;  3LSV A;  3ONL C;  4FJO A;  1HF8 A;  2L8K A;  4U7I A;  2Y6X A;  2LSI A;  1HS7 A;  3EC6 A;  2OU5 A;  5BR8 T;  4DV6 T;  2W62 A;  4AQF C;  4KMC A;  1N34 T;  2ZM8 A;  4ZI2 C;  2WZI A;  3KV9 A;  2IUB A;  3O9X A;  4G63 A;  5DQW A;  1L0V A;  4PK4 A;  1KNZ A;  2IW5 B;  4TV9 E;  5ETW A;  3DB0 A;  2RP4 A;  1US7 B;  3H3A A;  3OBV E;  2E5L T;  4QH1 A;  2XHE B;  4IDN A;  3UUM A;  4TV4 A;  5JTG A;  1BR2 A;  4HGA A;  2A2J A;  3ABV A;  3ZOD A;  2KLQ A;  5C2T A;  4JEU B;  4XHY A;  3EVY A;  4IE7 A;  4C90 A;  3UUN A;  3BQI A;  3LG7 A;  5JH7 E;  4X65 T;  4YXD A;  1OED B;  4GKJ T;  2A2F X;  4QXC B;  4AKI A;  2V7J A;  1G78 A;  5L4E A;  2V6X A;  4AXP A;  1KNP A;  2WU5 A;  5FL0 A;  3IN6 A;  2WAU A;  1LRZ A;  4QH4 A;  3ZJ2 A;  3OTO T;  4UEL A;  4HWF A;  1G79 A;  4B3T T;  4Q25 A;  1LKX A;  4OK0 A;  2XQ9 A;  5JDG A;  2W66 A;  4KUM B;  2NW9 A;  5EZY E;  1OED A;  5F8P A;  4LF4 T;  4A98 A;  3A7M A;  3MA9 A;  3UUL A;  2FBW A;  3CB0 A;  3AWH A;  3ZT5 A;  4JI7 T;  5L3C B;  5L3E B;  4TV8 E;  4NUU A;  2BBJ A;  3ZMT B;  3WI3 A;  3AA6 B;  2VKJ A;  5FKY A;  3JCF A;  3ZSS A;  2X66 A;  5AQI B;  2KWI B;  3PUV F;  2I02 A;  5LB7 B;  4K0K T;  4JI2 T;  3IHR A;  2EHO D;  4ILA A;  2LKH A;  4Y9I A;  5AQR B;  1MND A;  1X9B A;  2VKO A;  5EK4 A;  1I0R A;  3UU5 A;  4U74 A;  2IAK A;  2LEH A;  5C8Y E;  2BBH A;  2CHO A;  5LG4 A;  5BNC A;  1BR1 A;  2CE7 A;  3K8P C;  4IDO A;  2D0U A;  1HX1 B;  3PUA A;  4WYV A;  1Y01 A;  2E9X D;  4NPP A;  2QVA A;  3LBX B;  2DNX A;  2N2N A;  1KFY A;  2D36 A;  5AQQ B;  4DMV A;  3W15 B;  2W4X A;  4UHV A;  2LSY A;  3JAD A;  4R82 A;  4A97 A;  3AB3 B;  4UVA B;  4U72 A;  4ZS3 A;  1BR4 A;  1NAF A;  2MAW A;  3PU3 A;  2QA7 A;  3Q5E A;  2V5D A;  2UUB T;  2HN1 A;  2PG8 A;  2SPC A;  3NRX A;  4CN6 A;  2UU9 T;  4JV5 T;  4OFZ A;  1D1A A;  2XM1 A;  2WDV A;  4CXX A;  1J1J A;  4AKH A;  3NFW A;  2CRB A;  1LVF A;  2L1T A;  5HEU A;  1EZ3 A;  1MMA A;  1MIY A;  2WQY A;  2FJE A;  2UUA T;  3C98 B;  4TZ4 C;  2K48 A;  1FEW A;  4PW8 A;  1VOM A;  3ZCI A;  4WZX A;  4UIG A;  4H63 H;  2FJB A;  3J7Y q;  4ZI3 D;  4GK0 E;  2IAB A;  3R5W A;  1D1B A;  4UF0 A;  3SS1 A;  5M4Y A;  4LFB T;  2YEV C;  5CGM A;  3RHW A;  2XAH B;  3AEF A;  2FHQ A;  2LM2 A;  1WR0 A;  3RKO A;  3H3M A;  1T9M A;  1Y64 B;  2VKD A;  1QSD A;  3UTK A;  2XQ7 A;  3VU7 H;  2V7L A;  1X79 A;  4L9I A;  2H7O A;  3ZOG A;  4DR4 T;  3P4S A;  2BVL A;  3TLW A;  5JDF A;  3NZQ A;  4IST A;  4TWF A;  5AQO B;  5AQN B;  3BK9 A;  4NIQ A;  5ESC A;  2MTQ A;  2XAG B;  2V7K A;  1KK7 A;  2OL5 A;  5KDM C;  1FIO A;  2VK9 A;  4IDP A;  4H63 V;  4YTM A;  2VQF T;  1HCI A;  2M6I A;  4HE8 A;  3NZP A;  4DV0 T;  1J5W A;  4AI6 A;  4OYJ A;  3PUS A;  1JNR A;  2CPT A;  3P4Q A;  2WBL A;  2YOE A;  5IUX A;  3KV4 A;  5ADX L;  2LOP A;  4DUY T;  2OA5 A;  3DP7 A;  4JEH B;  4GIW A;  3UU3 A;  3DMB A;  2BS4 A;  5LGU B;  2VUR A;  4DR2 T;  2WMO A;  2YN6 A;  4O8S A;  3KBT A;  3PU8 A;  2K3W A;  1W0B A;  1WCR A;  4B6X A;  1D1C A;  4JI6 T;  5ABE A;  1N33 T;  2I0M A;  3ANW B;  3UU8 A;  2BKO A;  3PUG A;  5C3J A;  2CA5 A;  3SRZ A;  2IML A;  3PV0 F;  4KBM B;  1XNR T;  3AE3 A;  2Z6E A;  5GON E;  4LMJ A;  3N2K E;  3Q5D A;  1YQ3 A;  2VL8 A;  3FB2 A;  2AQ6 A;  1O3X A;  3UU6 A;  2E83 A;  2J62 A;  3NRY A;  2KIN B;  3EDU A;  5AQU B;  4ADZ A;  3ANW A;  3PUR A;  4Z85 A;  4O2A E;  3HA4 A;  2UXB T;  2DHR A;  3N9M A;  1ZHC A;  3MXZ A;  3CP3 A;  3C64 A;  3OYX A;  2QCK A;  3MJX A;  2WDQ A;  1D0Z A;  1XZY A;  2XSA A;  3HKB E;  3K1S A;  3KFW X;  2MPK A;  4ANJ A;  5AQG B;  4DMW A;  1RZ0 A;  4Z91 A;  2NW7 A;  3R5Y A;  2W61 A;  3B57 A;  3FBZ A;  2V6Y A;  3KYG A;  3FHN A;  1WYC A;  2E5V A;  5L3G B;  3Q9D A;  5L3D B;  1HG5 A;  3RIU A;  5LA6 E;  5J1G A;  2YIN A;  4PK6 A;  2ARZ A;  4ZEY A;  4JI0 T;  2X9X A;  3AE9 A;  4B3R T;  2FUR A;  3K3N A;  3F7E A;  4HFE A;  5H6R B;  3C51 A;  3CQC B;  4CN4 A;  2XZE A;  3PJA J;  3RIA A;  5EK2 A;  2D9D A;  3TGV A;  1OXZ A;  3E22 E;  2GJG A;  4YT0 A;  2KZ7 B;  2WCA A;  1ZKE A;  1MIV A;  3CX7 B;  3VYA A;  2LSK A;  2XQ3 A;  5JDN A;  3PUY F;  4N7R C;  2VQE T;  3BQL A;  4WNK A;  2X0Y A;  2ODU A;  2FJD A;  5FY1 A;  2BS3 A;  3QUJ A;  2LRK A;  1ZV4 X;  4YFS A;  4HKH A;  3P4W A;  4HKA A;  1G76 A;  3RIF A;  1IBL T;  3RKG A;  3AEA A;  3AEC A;  2C5K T;  3C50 A;  4GKK T;  5HXC A;  4LF7 T;  2X1J A;  3CVR A;  5KXJ A;  5IHY A;  3SFD A;  4JI5 T;  3H96 A;  2ACZ A;  5FMN A;  1S35 A;  5J2U E;  3S4U A;  2X9Y A;  3K88 A;  1TY9 A;  5KX5 E;  1WLK A;  4IE4 A;  5CA1 E;  5LNK A;  5F5W A;  2W0G A;  2N9D A;  5JQG E;  1IJ6 A;  1OED C;  3O4X E;  1WV4 A;  1YQ4 A;  3QC9 A;  3AE5 A;  2X9W A;  3LJC A;  2JPF A;  4L82 A;  3RF1 A;  4PK5 A;  1YD8 G;  4ZOL E;  4XJ2 A;  4IL4 A;  3A6R A;  4P0A A;  4DR1 T;  2JQK A;  2MBG A;  3HMZ A;  2GK9 A;  4MBQ A;  3VY5 A;  1IZN B;  1Z8U A;  4TWD A;  1WR6 A;  2JIW A;  3U5W A;  2BVM A;  2CBJ A;  1AJ3 A;  3HKE E;  3HKC E;  3AVR A;  2DWK A;  2EHO B;  1R8I A;  2HHZ A;  3CX6 B;  2W2U A;  3ZEF B;  1E2A A;  5HWX A;  1ZEE A;  4X5T A;  3CIR A;  4DV7 T;  2VL0 A;  3PJA A;  4COF A;  3ZC0 A;  4EYU A;  3K86 A;  4JI1 T;  5ABF A;  3ZN1 B;  3L3P A;  4YSZ A;  2C0S A;  2CM0 A;  2EHO A;  3H37 A;  1VL7 A;  4HTE A;  5AQH B;  3JAE A;  5LGN B;  2V8S V;  3U3I A;  3GMI A;  2BG9 C;  4AKG A;  1OED E;  2LE8 A;  5LJN A;  1VCT A;  3VRB A;  2E9X B;  2PTF A;  2NTY A;  3V4H A;  2RA1 A;  2C5J A;  2ZLY A;  2P5Z X;  4DV4 T;  4HX6 A;  3NKZ A;  4F8H A;  2ZMA A;  3KV6 A;  2PBI A;  3RQW A;  3EAM A;  5FY7 A;  4UEM A;  4KX6 A;  2A3D A;  4ILU A;  5FL1 A;  2Q9K A;  3OJA A;  3LK4 2;  3PUZ F;  3R5R A;  2E9X A;  4B3M T;  1IAP A;  2D0T A;  3ZMU B;  2KND A;  4BA9 A;  4EXT A;  2YDQ A;  2A72 A;  4MFR A;  4ILC A;  4ZI7 E;  2V1D B;  4WBO A;  1M62 A;  3NBX X;  5AQF B;  2QYW A;  3ESL A;  3WAK A;  3FZH B;  3ZMV B;  4HFI A;  2BG9 B;  5FVK A;  2CCQ A;  1YOA A;  2YDR A;  4DV3 T;  3KBU A;  2OV9 A;  4DVD A;  2QEA A;  3IBP A;  4G2A A;  2V26 A;  3Q5W A;  4E7Z A;  1W3R A;  2QGS A;  4OX9 T;  4L0R A;  3JC6 D;  3N9Q A;  1HX8 A;  4E7S A;  2WDR A;  2ES0 A;  2BG9 A;  2WWV A;  2XAF B;  2WM9 A;  4IGU A;  3PDY A;  3O1I A;  4LML A;  2ACX A;  3EHZ A;  5DJQ C;  4N78 D;  4I50 E;  2WSS V;  3AEG A;  2IHR 1;  3KYF A;  3ZT6 A;  3UT5 E;  3IA3 A;  4O4I E;  4DR5 T;  3SWH A;  3OYZ A;  3AE2 A;  2X67 A;  2J47 A;  3A8Y C;  2LJL A;  1WFD A;  3R5L A;  5F3J A;  2BKP A;  4UF0 B;  4H9Q C;  3ETV A;  4ZXL A;  1IBK T;  3FXE B;  5HXR A;  4ZHQ E;  5LHH B;  2XQ6 A;  4H9S E;  3J9X 1;  3DNH A;  2Q9Q A;  4O4H E;  5HWY A;  3OPC A;  3T8O A;  5HXH A;  2LOS A;  5FXV A;  5L4H A;  3A5X A;  2ED4 A;  3ZT7 A;  1BR0 A;  2PJQ A;  2UXX B;  1XXO A;  3A20 A;  1NEN A;  4V1A v;  2CWY A;  5JRE A;  3IEE A;  3TKL B;  4NXN T;  2M6B A;  2VVS A;  3UFG A;  3DJB A;  4EV6 A;  2IC9 A;  5EK3 A;  5FXW A;  2XTL A;  2XSB A;  3FGE A;  4CI1 B;  2Q9Q D;  3RI5 A;  4O4L E;  3ZCJ A;  3BA3 A;  3PUX F;  4U31 A;  4DBQ A;  3AAI A;  2R6V A;  3UQ4 A;  2ECR A;  5JRC B;  3N9L A;  3ONJ A;  3QNU A;  3CQG B;  5J0Z A;  2CLY C;  2MYS A;  4KP3 C;  4J2C A;  2WMN A;  2J4G A;  4H9O C;  1KNR A;  2BDE A;  3LK3 B;  3ZMZ B;  2PFV A;  2LRL A;  4MTK A;  4AIS A;  2CXD A;  3E08 A;  1USC A;  4PFP A;  4KHZ F;  5JRC A;  3FKH A;  2X0L B;  4P0B A;  5AQM B;  2CWO A;  1HG2 A;  4OHF A;  3TLT A;  3PE0 A;  3ZST A;  4PJL A;  2AE9 A;  3HR0 A;  5A1L A;  4ASK A;  1RZ1 A;  2VWA A;  5FXZ A;  4X64 T;  4CQI A;  2I59 A;  1MIW A;  3ONX A;  3RIU C;  3F57 A;  3VY2 A;  3R5Z A;  3ZYL A;  3UUX B;  1S94 A;  2NWB A;  1E7P A;  2LKG A;  1N36 T;  2DL1 A;  3CWZ B;  2L9Q A;  4F6R C;  2CLY B;  1FLM A;  3N9O A;  3N2O A;  3AED A;  3AAA B;  3HI2 A;  2HQ7 A;  4O4J E;  3RX6 A;  2Y8D A;  1YKE B;  2W00 A;  3VKH A;  4JBW F;  1ZOY A;  4YHJ A;  3HY8 A;  3AE4 A;  4YY3 T;  2OLT A;  1HFA A;  5FXX A;  3FZF B;  3E0Z A;  2RE7 A;  1IJ5 A;  4QKN A;  3V5U A;  1J5E T;  2JMH A;  4GOU A;  3L09 A;  2HTD A;  2V6Y B;  5TAO A;  5HEG A;  4UR9 A;  3CKD A;  4HMW A;  2B76 A;  4DV5 T;  4HMU A;  5LOV E;  3ZOC A;  1WYB A;  2M67 A;  2LM9 A;  2XQ8 A;  3AXJ A;  1USF A;  1NEK A;  3BQK A; 
#chains in the Genus database with same CATH homology
 1W3O A;  2ARZ A;  4Y9I A;  2FG9 A;  1W3Q A;  4ZKY A;  1USC A;  3R5P A;  1WV4 A;  4HX6 A;  2VPA A;  3U35 A;  3BNK A;  3AMF A;  3FKH A;  1X9B A;  2FUR A;  3DB0 A;  1RFE A;  3F7E A;  4HMS A;  2R0X A;  3B5M A;  3E4V A;  3RH7 A;  3PFT A;  1YLN A;  4L82 A;  4F07 A;  1I0R A;  1W3P A;  2IML A;  3R5L A;  3U0I A;  2RDE A;  1RZ1 A;  3TGV A;  1EJE A;  2IAB A;  3R5W A;  2I51 A;  1AXJ A;  2X1K A;  2Q9K A;  2GJG A;  2A2J A;  4XJ2 A;  3R5R A;  3A6R A;  2FHQ A;  3DNH A;  3GAS A;  1G77 A;  5BNC A;  2AQ6 A;  3ZOD A;  1T9M A;  2NR4 A;  1Y30 A;  2E83 A;  3K87 A;  3VY2 A;  4XHY A;  3VYA A;  3R5Z A;  4HMT A;  3HMZ A;  2D37 A;  4Z85 A;  2ED4 A;  3VY5 A;  3ZOF A;  4HMV A;  1XXO A;  3A20 A;  4N7R C;  2HTI A;  3ZOG A;  1FLM A;  3U5W A;  1G78 A;  3CP3 A;  1JNW A;  3ZOE A;  2HQ7 A;  2QCK A;  2D36 A;  1WLI A;  3IN6 A;  5ESC A;  2D5M A;  2ASF A;  2HHZ A;  2OL5 A;  4R82 A;  1G79 A;  1YOA A;  3HY8 A;  4YWN A;  3A6Q A;  1G76 A;  2QEA A;  3FGE A;  1NRG A;  1W3R A;  5JAB A;  2RE7 A;  3K86 A;  1DNL A;  3BA3 A;  3CB0 A;  3U34 A;  3SWJ A;  3AWH A;  2R6V A;  1RZ0 A;  2IG6 A;  2X1J A;  1I0S A;  2ECR A;  3R5Y A;  2HTD A;  1XHN A;  3H96 A;  4IRA A;  5CHO A;  1VL7 A;  3EC6 A;  3KYG A;  3ZOH A;  2OU5 A;  2ECU A;  4HMX A;  3K88 A;  1TY9 A;  2I02 A;  4HMW A;  1WGB A;  3NFW A;  3BPK A;  2HQ9 A;  2D38 A;  1WLK A;  4HMU A;  3ZOC A;  3DMB A;  5CHE C;  1CI0 A;  1USF A;  1W9A A;  4YBN A;  3KYF A;  2PTF A;  4QVB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...