2NR4A

Crystal structure of fmn-bound protein mm1853 from methanosarcina mazei, pfam duf447
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
192
structure length
191
Chain Sequence
DLSSFGIREGISEIIASTGFEHPNAAPIGIVMKGERPFVRLFKGSHTWENVLKEKCLASNVVYDPILFVRSTFSDLVPSEFEYVDGEFKFPVLKEAIAWVVFECINLRNTDQSLVADLVPLNAGFNERNIKELPVPNRGFNAVLEATVHATRYQLTGEEKYLELIRHYESLASKCGGDAEKKAMKLIYEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Conserved hypothetical protein
publication title Crystal structure of conserved FMN bound hypothetical protein from Methanosarcina mazei
rcsb
source organism Methanosarcina mazei
total genus 54
structure length 191
sequence length 192
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04289 DUF447 Protein of unknown function (DUF447)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.290 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical membrane protein ta0354_69_121. 2nr4A02
2.30.110.10 Mainly Beta Roll Pnp Oxidase; Chain A Electron Transport, Fmn-binding Protein; Chain A 2nr4A01
1WLIA 3AWHA 2OU5A 4Z85A 3DB0A 3U5WA 2IMLA 3BNKA 4QVBA 3R5PA 3VY5A 2RE7A 1W9AA 3SWJA 2QEAA 5BNCA 3R5RA 1WV4A 3VYAA 1CI0A 1W3QA 3R5WA 4HMXA 3AMFA 3U35A 1AXJA 2PTFA 1X9BA 2IABA 1I0SA 1YLNA 3KYFA 3ZOHA 3HMZA 5CHEC 2D38A 1G76A 1NRGA 2D37A 1USCA 3FKHA 5ESCA 3FGEA 3CB0A 1RZ1A 1W3PA 1JNWA 2OL5A 2E83A 2HTIA 2FG9A 3PFTA 4HMVA 3DNHA 3EC6A 2D36A 4F07A 4HX6A 2R0XA 2ECUA 3F7EA 3BPKA 2QCKA 3DMBA 3K87A 4R82A 4YBNA 4ZKYA 1EJEA 3ZOEA 5JABA 1DNLA 2GJGA 4IRAA 1G78A 2AQ6A 2HQ9A 2ECRA 4N7RC 1FLMA 3R5YA 2R6VA 3IN6A 2HQ7A 2X1KA 3A20A 3E4VA 2FHQA 3U0IA 1USFA 2X1JA 3H96A 3TGVA 4HMWA 3K86A 3GASA 3R5ZA 4XHYA 3ZOFA 1RFEA 2NR4A 3R5LA 3U34A 3ZOCA 4HMUA 1WGBA 1Y30A 3NFWA 3A6RA 3CP3A 2VPAA 2A2JA 1G79A 2IG6A 1T9MA 3K88A 1W3RA 3RH7A 1W3OA 1G77A 1YOAA 2ASFA 3B5MA 2HHZA 4Y9IA 2Q9KA 1TY9A 2HTDA 3HY8A 3VY2A 2D5MA 1VL7A 4YWNA 4HMTA 1WLKA 3A6QA 1XXOA 3ZOGA 1I0RA 2FURA 1RZ0A 4XJ2A 2I02A 3ZODA 3BA3A 2ARZA 5CHOA 2I51A 2RDEA 3KYGA 4HMSA 1XHNA 4L82A 2ED4A
chains in the Genus database with same CATH superfamily
1NWMX 2J62A 3U5WA 3O4XE 1D1AA 4IIJE 4IE5A 3R5RA 1XMOT 2R6GF 4ZOLE 1E1HB 3O9XA 2PTFA 3MJXA 3HKBE 2C5IT 2M6IA 4ZHQE 3K3QC 1B7TA 5JDMA 4HWHA 5FVKA 4O4LE 4DV6T 2BKPA 1W3PA 3SS1A 1OEDA 1HFAA 1D0ZA 4I4TE 2L8KA 4MALA 3AE5A 4ILUA 2BBJA 4JEUB 3RPUA 4JI1T 1HG2A 1YXRA 3RLFF 4OX9T 4PFPA 1KFYA 4N7RC 5AQTB 2YDRA 3E4VA 3CIRA 3I9WA 1USFA 2UXCT 4I43B 3HKCE 3O1HA 3R5ZA 2XZEA 3UU5A 4IL4A 3K3NA 3QOFA 3UUXB 3CP3A 4DV4T 5DQWA 2V7IA 3AEDA 4DMWA 3OTOT 3PDYA 3AE2A 4I0UA 3C51A 2HHZA 3JC6D 1HX1B 5LOVE 4JV5T 5JQGE 5JREA 3OVUA 1QUUA 3ZMVB 4CQIA 5L3FB 1BR4A 2P5ZX 4K0KT 3KV5A 5AQFB 4U72A 2X67A 3AE8A 3CWZB 3VU7H 3K1SA 2X66A 2DCFA 4JI3T 3GN5B 3N9LA 2WU2A 2DWKA 1W0AA 4DR7T 4MHCA 1D1CA 3H3MA 2WMNA 1G8XA 5LA6E 3NRXA 2CLYC 1U5PA 3PUSA 4DR3T 5LMNT 1IJ6A 2D38A 3KVBA 3FGEA 5AFUL 3KBUA 3PUQA 3CK6A 2CM0A 2K5BB 4TNWA 4P1NA 2JMKA 5JDHA 2YU2A 4O8SA 4ADZA 3E22E 4EZ4A 2QCKA 3CX6B 3MACA 2RA1A 5JABA 3N9OA 1FEWA 4FI5A 2YKSA 2WY2A 2HQ7A 2KXPB 5L3BB 4DIDB 2BG9E 5LYJE 1I6ZA 4BAYB 3N9PA 4EOZB 4YTPA 3LK3B 4OYKA 5ABFA 1FJGT 2W00A 1G79A 3LDQB 1HS7A 2M67A 1WYCA 3M65A 1T9MA 2JIWA 2BG9B 3F31A 4YTMA 4H63V 2CXDA 5L3DB 2ODVA 5LHHB 3FXDB 1MMGA 2HN2A 4QXCB 2XAHB 1KF6A 4HMSA 4LF5T 2W62A 3LK42 3ZJ2A 2ED4A 3G06A 4HGAA 2Q9QD 2IMLA 2VASA 3AE3A 3VHLA 1SA0E 2XQ3A 2BVMA 2NTXA 1CUNA 3R6NA 3ZN0B 1W3QA 3AECA 2XTLA 4NUVA 3RYIE 1Y01A 3U35A 1HX8A 3EAAA 5TAOA 4UR9A 4ILBA 2WZHA 3LBXA 4DR6T 4DV0T 2RP4A 2D37A 1IBKT 1L0VA 3C4XA 4PJMA 4OHFA 2BG9C 3EC6A 3ONXA 3UQ7A 5HEOA 2ZM6T 2H7VC 5JTGA 4YBNA 3VRAA 4QH4A 2Q9QB 5AQHB 1KNRA 3ZT5A 1QLBA 1N33T 4I50E 5AQPB 1W9RA 3UU3A 2CHOA 4HTEA 1YD8G 2FHQA 3QB5A 3N9QA 4NIQA 4ZI2D 2DHRA 5AQKB 3SFEA 2CXFA 2WP9A 4ILCA 5IUXA 2LSKA 3P8CD 3RRCA 5BMVE 1IZNB 3X1DA 4TWFA 4MFRA 5LG3A 2XAQB 3KVAA 1BR0A 2DLRA 2YINA 2E9XD 4YJ2E 2LRKA 4IDZA 3DTOA 1VL7A 1WLKA 2X0LB 2KSRA 2WCAA 5GONE 4JLEA 2JRKA 2ES0A 1IBMT 1NENA 3DB0A 2CBIA 3AA6B 5HCJA 2KLQA 2JJ9A 4JYAT 3SWJA 3ZPOA 4AKLA 2XQ7A 2Z6EA 4LF9T 4JI0T 2F4VT 2CWYA 4UV8B 2YDSA 4ZS3A 4HFIA 3ZOHA 5M4YA 2KNDA 3QNUA 1V9DA 2E9XB 5CFBA 3FHNA 3HI2A 5BR8T 3VR8A 4GK5E 2ZM0A 5FYMA 4TWDA 2OA5A 2IHR1 3O1IA 3DP7A 4CN6A 2DL1A 4JI7T 2CBJA 4R82A 4QH1A 1OXZA 4EYUA 3JAEA 4MTKA 2FUPA 4UF0A 5FNVE 2BBHA 2HQ9A 1BR2A 4HWCA 5LXTE 4QXBB 5J2TE 2X1JA 3H96A 4YXDA 2IAKA 3CQGB 4JI6T 4LMLA 3VKHA 1Z0PA 2PG8A 2H89A 5JR9B 5FY7A 4ERRA 2NW9A 4AISA 3CKDA 2IUBA 3FXEB 3PV0F 5AQRB 1ZKEA 2Q9KA 4MBQA 3HY8A 5HXHA 1D1BA 1XXOA 2LSJA 2J4GA 1WLXA 4XJ2A 2QGSA 1KNZA 3LG7A 4JI4T 2WWVA 3OYXA 4B3ST 4YT0A 2A3DA 5LJNA 4BA9A 3VY5A 3AAIA 2QEAA 2W63A 3LK2B 1WV4A 1CI0A 4U3CA 3NBXX 5CA0E 3D0TA 3AE4A 1OEDC 5AQLB 1I0SA 4HE8A 3KDSE 5HXSA 1RZ1A 2LOSA 1JNWA 1IAPA 4HMVA 4QXHB 2FG9A 3RX6A 4ASKA 1HCIA 2DWGA 4H9SE 4EGWA 2R0XA 2ECUA 3FBLA 4EYYR 3CX7B 3H3AA 3UFGA 4DV2T 4B3TT 4GKJT 3RYFE 2FBWA 3PURA 3CQXC 3AEGA 3U0IA 4O2BE 4H9RC 3A7MA 2WU5A 4PK6A 4U2ZA 1WGBA 3KV6A 4E7ZA 2VPAA 1UUSA 4DNDA 5AQUB 2V5DA 2V7JA 3FZHB 2CRBA 1S94A 2X0YA 3ZOGA 5F3JA 1I0RA 4TUYE 3UT5E 5HYAA 1MIYA 1UURA 3IEEA 4Q25A 2MBGA 5KMGP 2XQ6A 4Z85A 4DVDA 4A97A 4CXYA 4A56A 3P50A 3VYAA 3MZKB 3F2EA 2W61A 2IABA 2LJLA 5C8YE 2D0TA 5EK2A 2XQAA 3BQIA 3CVRA 4JI5T 4IDPA 3CB0A 3RGLA 1BR1A 5JDNA 4DO0A 2K3WA 2AE9A 3RKGA 3F7EA 4ZKYA 4IE4A 4X64T 2CEAA 4XBFB 3MK7C 4IRAA 1T8BA 3IBPA 4AKGA 3KV4A 1SE7A 3ZN1B 2W67A 3ZC0A 2G0UA 1UCUA 2NR4A 4G63A 4HMUA 2EHOA 4QX8B 3A6RA 2N1GA 2IC6A 5LNKA 1HNWT 4ILAA 3I1AA 3CPZA 4HFBA 4UV9B 4DR5T 3N5LA 4AI6A 4L5GA 2V1DB 1W3OA 2LSYA 2HTDA 2FJBA 2XSBA 4PFOA 4DV7T 2CLYB 5JDGA 4K0UA 5J0ZA 3W15B 2E5LT 3CX8B 2I51A 2VQFT 5AQSB 4DBQA 2XJ7A 5LJMA 4YSXA 2XM1A 4QVBA 2RE7A 3S4UA 3NVOA 2ZM2A 5FXVA 3KFWX 1J5WA 3R5WA 5LG4A 3IHRA 3OKQA 2NW7A 2ZM8A 2V5CA 4YY3T 3PUZF 4GYSA 3AE9A 3RIUC 5LHGB 2V6YA 3NKZA 4UVBB 2OV9A 3PFTA 4TV9E 3FZFB 3EVYA 3PUYF 2A2FX 5E0OA 3SWHA 1Y12A 5CB4E 2BVLA 4NXMT 2IC9A 5LGNB 4EZHA 2JPFA 2BZBA 3PTRB 3DJBA 3L09A 3IN6A 3UU8A 2KMFA 3H37A 3I0QA 2XAGB 3AVSA 2XQYA 1XWMA 3FB2A 4X62T 1KNPA 3AEFA 4ZI7E 1FIOA 4KP3C 4YJ3E 2SPCA 2A72A 3B5MA 3BQKA 4AKRB 1UX4A 4AKHA 2BS2A 3J7Yq 3A6QA 4GOUA 2FURA 1RZ0A 3P4WA 2K24A 3I9YA 4H9NC 3A8YC 4EAHA 2CHNA 2VL0A 1XDPA 3ZYKA 4B3RT 3K8PC 4L82A 3UUNA 3U3IA 2OU5A 5L47A 4LF4T 5L3CB 3LSVA 3K3OA 5ABEA 2UUAT 4LF8T 2X9HA 3PE0A 4WYVA 3HMZA 2P9BA 4QKNA 2HPJA 1M62A 3QUJA 4OFZA 1USCA 4EIWA 4TN7B 2M6BA 4U31A 3ANWA 2DI4A 2NTYA 3RQWA 4O2AE 3DNHA 2ACXA 4W64A 2KWHA 2XAFB 5L3EB 4H9QC 4E7SA 4HX6A 4YFSA 3KV9A 4G2AA 4IREA 4WW0A 3AEBA 2WDRA 2GJGA 5J2UE 2YEVC 3N2GE 1MMDA 3R5YA 4EB6E 4C90A 3OBVE 3N2KE 5AQMB 3T8OA 3ZOFA 5HEGA 2VVNA 5LBQB 3RYCE 1WYBA 1ZEEA 3RYHE 1YOAA 5HEUA 3E0ZA 4ZI3C 1MNDA 2I59A 3LJCA 2J1DG 4HFCA 4UVCB 2KZ7B 1JNZA 1N36T 4QX7B 3OPCA 5CHOA 2IW5B 1XNRT 2BS3A 2V7MA 2IDOB 4KX6A 1XNQT 5JRCB 4LFBT 2HH7A 2MAWA 4LF7T 3C50A 2WWUA 4KMCA 4P0BA 5DQVA 4OK0A 2Y6XA 2UXXB 1MIWA 2XM2A 3MXZA 5FY1A 5IHYA 2WAUA 4YHJA 2V6XA 3QK6A 4JBWF 4CXXA 5HAXA 2LLYA 5JVDE 3JAFA 4AKIA 3EAMA 4LMKA 2I0MA 2CXLA 5JDLA 3I0OA 3PUXF 4CI3B 4PK5A 2XQ4A 2K9AA 3ZCIA 4NXNT 2LEHA 4ZEYA 3EDVA 2YOEA 2ODUA 1FLMA 5J1GA 3GN5A 4I55E 3N9MA 2ZLYA 4HMWA 2V7KA 5FVLA 2MPKA 3K86A 2FJDA 3L3PA 4DUZT 3AA7B 1RFEA 3ETUA 1MMNA 4ZS2A 3NFWA 1OEDE 3ZT7A 4UHVA 3RC3A 1OWAA 2WQYA 5FKYA 2I6HA 1W3RA 5L4HA 2X9XA 3PJAA 1OEDB 2LHNA 3ZEFB 2X68A 5FP3A 2CE7A 2I02A 5ABHA 3BA3A 1VRBA 5L3GB 5EK4A 1XHNA 4TZ4C 3AB3B 3ZCJA 2KT9A 1UGOA 2QA7A 2W4XA 5ETWA 4YLHA 1UK5A 3Q9DA 4AQGA 4HKAA 3EUHA 2D9DA 4AIUA 1J5ET 2XQ5A 5L2LA 2VKOA 2WDVA 4CXWA 1SHZC 1H7CA 2BG9A 2QVAA 4IE7A 5ESCA 4ANJA 4U74A 2JQKA 1I94T 1XZYA 4PK4A 3R84B 4KUMB 2YK0A 2IIUA 2HPLA 3K87A 4EEDA 2BS4A 1MIVA 2UXDT 2L3LA 1QSDA 2EHOC 1G78A 1O3XA 4EV6A 2UXNB 2W66A 5AQQB 5AQJB 2X1KA 2YDQA 2CA5A 2QRXA 4U33A 3GASA 2ZMAA 2Y48B 2V7LA 3Q5XA 3U34A 2L9QA 3TLUA 2A2JA 1HR0T 4MLKA 2JMHA 2KINB 2IG6A 3EHZA 3Q5DA 4HFHA 4BJMA 2VK9A 4DV3T 2ARZA 4UEMA 3ESLA 2Q9QA 4FJOA 4DV1T 1EZ3A 4XAXB 1DU2A 3PUGA 4L0RA 4H9PC 3V5SA 2YN6A 3FZLB 3WI3A 5F5WA 5KXJA 3F57A 1VCSA 1IJ5A 4PW8A 5HCMA 4PJNA 1G73A 1T98A 3P4SA 5ABFB 3PUAA 4X66T 3AE6A 3VKGA 1NRGA 3AXJB 3FKHA 4OYJA 4DR2T 4DBRA 2JQHA 4F8HA 2HN1A 4WBOA 3LFMA 4QH5A 2NP9A 3HE1A 1NAFA 2J47A 3E08A 3SRZA 4PJJA 3DMBA 2N9DA 3ONJA 4X1YE 1Y64B 3ABVA 2VKDA 3BK9A 5LHIB 4NPPA 4IT4A 1FMVA 1HG5A 4UVAB 3A20A 4Z90A 5HWXA 2BKNA 3C98B 5LMUT 3ZMZB 1R8IA 2X0HA 3R5LA 4LFCT 2B76A 3AA0B 5FL1A 3T1YT 3LBXB 4AQFA 4DV5T 2E9XA 3ZT6A 3FZKB 3RH7A 3GA8A 4P09A 4IDNA 2D2SA 3IA3A 5AQIB 2L1TA 3L8RA 2X9YA 2LM2A 3TLWA 3CQCB 3WAJA 2D5UA 4EXTA 4TV8E 2BDEA 4BJNA 3TKLB 4GIWA 4IL9A 4GYRA 5FL0A 4IE0A 3BNKA 3P4PA 2WZIA 1U4QA 1YKHB 2LSGA 4ISTA 4COFA 1J1JA 3HKEE 2XQ9A 4A5XA 3PU3A 5AQGB 4V1Av 3AEEA 3VR9A 1ZV4X 2UU9T 4C91A 4X20E 5JR9A 4P0AA 1N32T 2K4QA 3RI5A 1XDOA 4A98A 3ETVA 3N2OA 5CGMA 2WB5A 2E83A 4GK0E 3V5UA 5JDQA 4EEBA 4PNIA 5KDMC 3T1HT 3SFDA 4U7IA 3HR0A 3ZOEA 2XSAA 2C0SA 4IGUA 3NZQA 1YQ4A 3QB5K 2ECRA 3FBZA 3L39A 4NUUA 4O4IE 4HFEA 3NRYA 4Z8XA 2FJAA 1Y30A 4HFVA 2VL8A 2XY8B 4YSZA 2H7OA 2UXBT 5F8PA 1MMAA 2VQET 1N34T 3KBTA 2JQ9A 4CZZB 3AAEB 2OLTA 4HWFA 1VOMA 4HWIB 5CJ5A 4B3MT 2HHHT 5A1LA 2D5MA 4HMTA 3AE7A 4TX5A 5JDFA 5H6RB 3OYZA 1FMWA 2XQ8A 4YHHT 1T7SA 3AWHA 4ZI3D 4DMVA 4UF0B 5LCYA 3R5PA 4CN4A 3UU4A 3ZKRA 1LKXA 2W2UA 2E5VA 5LB7B 3HKDE 1AJ3A 2K48A 5EK3A 4J2CA 4X1IE 3KYFA 1G76A 4H9OC 2X9WA 3Q5EA 3RHWA 2Y8DA 3QC9A 4LF6T 4XZCA 3B57A 4O4HE 4ISSA 5FY0A 3UQ4A 1S35A 2XPKA 2LRLA 3AE1A 2WM9A 5HXEA 3ZSSA 2RPAA 2XUEA 3AXJA 4UXNB 4N78D 2A9UA 3RF1A 2V8SV 3EDUA 1ZP0A 2LE8A 2PJQA 3NWIA 3JC6C 1MNEA 3RH3A 3OJAA 1ZHCA 4WZXA 3RIFA 3K88A 1XMQT 4WNKA 4U7YA 4U2YA 4Y9IA 1WCRA 3VY2A 4KI0F 4JUYA 3VRBA 4ZZCA 2AXDS 5IWAT 2LKGA 4M1PA 2VB6A 3RC8A 2VKJA 4KHZF 5BNCA 2KWIB 3MA9A 4HMXA 1AXJA 3PUWF 2CWOA 2VKHA 3RIUA 5HXRA 1D0YA 4IDOA 4JI2T 2MTQA 5CHEC 1JNRA 1WRDA 3JCFA 3P4QA 3EI0A 4UIGA 4AQYT 2D36A 5HWYA 5C2TA 3BPKA 4AXPA 5FXWA 4X65T 5C3JA 1M7KA 2B1EA 1DNLA 1NEKA 2LKHA 1HTJF 2WMOA 2LM9A 3ZMSB 3RRWA 2W0GA 3TGVA 2C5KT 3FZMB 2E2AA 4HFDA 3UUBA 4TNVA 2ACZA 2EHOD 5AQNB 3WAKA 3ZYMA 2C5JA 3P7IA 5CA1E 4IHJE 4IE6A 1G77A 3AA1B 2Q9QC 2PFVA 4CN1A 1CHUA 2DNXA 2WDQA 2JQQA 1X79A 5KX5E 2V26A 1UX5A 2GK9A 4PJLA 3A5XA 3J9X1 1T72A 1HF8A 1LRZA 3Q2MA 1WLIA 3AVRA 5HEJA 1YKEB 1YW0A 3UTKA 3UFEA 1IBLT 5FXZA 3RIAA 2NW8A 3JADA 4JI8T 4DR1T 1LVFA 5AQOB 1LVKA 2LT3A 3BQLA 5DABA 2EHOB 2NOXA 1E2AA 2MYSA 3RQUA 1KEYA 2WBLA 3B13A 2CMRA 2OL5A 1W0BA 1SUMB 3V4HA 4ZI2C 4F07A 2UUCT 3MKDA 4LMJA 2XAJB 4HKHA 3C64A 1EJEA 4L9IA 2D0UA 4B6XA 3UULA 3KINB 3PUVF 2UUBT 3NZPA 4AQFC 2E9XC 3C4WA 4KHPT 2VVSA 4XHYA 3RKOA 2NWBA 1WR6A 4ZZBA 3O1JA 2X51A 3EABA 2V6YB 5DJQC 3AEAA 3ZSTA 5FMNA 3PU8A 5IYZE 3ZLIA 4DR4T 3PJAJ 3U78A 5ABGA 2WS3A 2H3RA 3ZODA 3HL6A 1WR0A 4HN9A 2YU1A 3KYGA 3IF8B 3UUMA 4TWHA 4CI2B 4WBNE 5H6QB 3AAAB 1ZOYA 1W9AA 4HWDA 4IDQA 5JR9C 1HNXT 2WSSV 4PAGA 2MOZA 4Z91A 1E7PA 4KBMB 3AMFA 5L4EA 1X9BA 3SOLA 5JH7E 3Q5WA 4LFAT 1YLNA 2CCQA 4X5TA 4O4JE 5LGTB 1D0XA 1YQ3A 4X1KE 1VCTA 3ZJ1A 3GWHA 2HTIA 4H63H 3ZC1A 3P4RA 4DUYT 2QYWA 1KK7A 1W09A 5EZYE 3GMIA 3TLSA 2LOPA 3ONLC 1US7B 5HXCA 2PBIA 3HA4A 4UELA 5JRCA 3ZMUB 4HEAA 3UU6A 2AQ6A 3ZMTB 2R6VA 3N9NA 2BKOA 5FXXA 4F6RC 4CI1B 2XASB 3TLVA 4YSYA 3ZYLA 3ZOCA 4GKKT 3CMLA 5HEHA 2E8IA 2CPTA 2LSIA 4QHOA 2ASFA 3C4ZA 3M3ZB 1GQEA 1Z8UA 1TY9A 2H88A 3ANWB 1HNZT 2FJEA 4JEHB 5LGUB 4YWNA 1WFDA 4YTNA 5LBMA 5ADXL 3TLTA 4QWNB 2LHRA 2RDEA 2GUJA 4ZXLA 2XHEB 4TV4A 5LP6E 2N2NA 5AQVB 2VWAA 2VURA
chains in the Genus database with same CATH topology
1WLIA 3AWHA 2OU5A 4Z85A 3DB0A 3U5WA 2IMLA 3BNKA 4QVBA 3R5PA 3VY5A 2RE7A 1W9AA 3SWJA 2QEAA 5BNCA 3R5RA 1WV4A 3VYAA 1CI0A 1W3QA 3R5WA 4HMXA 3AMFA 3U35A 1AXJA 2PTFA 1X9BA 2IABA 1I0SA 1YLNA 3KYFA 3ZOHA 3HMZA 5CHEC 2D38A 1G76A 1NRGA 2D37A 1USCA 3FKHA 5ESCA 3FGEA 3CB0A 1RZ1A 1W3PA 1JNWA 2OL5A 2E83A 2HTIA 2FG9A 3PFTA 4HMVA 3DNHA 3EC6A 2D36A 4F07A 4HX6A 2R0XA 2ECUA 3F7EA 3BPKA 2QCKA 3DMBA 3K87A 4R82A 4YBNA 4ZKYA 1EJEA 3ZOEA 5JABA 1DNLA 2GJGA 4IRAA 1G78A 2AQ6A 2HQ9A 2ECRA 4N7RC 1FLMA 3R5YA 2R6VA 3IN6A 2HQ7A 2X1KA 3A20A 3E4VA 2FHQA 3U0IA 1USFA 2X1JA 3H96A 3TGVA 4HMWA 3K86A 3GASA 3R5ZA 4XHYA 3ZOFA 1RFEA 2NR4A 3R5LA 3U34A 3ZOCA 4HMUA 1WGBA 1Y30A 3NFWA 3A6RA 3CP3A 2VPAA 2A2JA 1G79A 2IG6A 1T9MA 3K88A 1W3RA 3RH7A 1W3OA 1G77A 1YOAA 2ASFA 3B5MA 2HHZA 4Y9IA 2Q9KA 1TY9A 2HTDA 3HY8A 3VY2A 2D5MA 1VL7A 4YWNA 4HMTA 1WLKA 3A6QA 1XXOA 3ZOGA 1I0RA 2FURA 1RZ0A 4XJ2A 2I02A 3ZODA 3BA3A 2ARZA 5CHOA 2I51A 2RDEA 3KYGA 4HMSA 1XHNA 4L82A 2ED4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WLI A;  3AWH A;  2OU5 A;  4Z85 A;  3DB0 A;  3U5W A;  2IML A;  3BNK A;  4QVB A;  3R5P A;  3VY5 A;  2RE7 A;  1W9A A;  3SWJ A;  2QEA A;  5BNC A;  3R5R A;  1WV4 A;  3VYA A;  1CI0 A;  1W3Q A;  3R5W A;  4HMX A;  3AMF A;  3U35 A;  1AXJ A;  2PTF A;  1X9B A;  2IAB A;  1I0S A;  1YLN A;  3KYF A;  3ZOH A;  3HMZ A;  5CHE C;  2D38 A;  1G76 A;  1NRG A;  2D37 A;  1USC A;  3FKH A;  5ESC A;  3FGE A;  3CB0 A;  1RZ1 A;  1W3P A;  1JNW A;  2OL5 A;  2E83 A;  2HTI A;  2FG9 A;  3PFT A;  4HMV A;  3DNH A;  3EC6 A;  2D36 A;  4F07 A;  4HX6 A;  2R0X A;  2ECU A;  3F7E A;  3BPK A;  2QCK A;  3DMB A;  3K87 A;  4R82 A;  4YBN A;  4ZKY A;  1EJE A;  3ZOE A;  5JAB A;  1DNL A;  2GJG A;  4IRA A;  1G78 A;  2AQ6 A;  2HQ9 A;  2ECR A;  4N7R C;  1FLM A;  3R5Y A;  2R6V A;  3IN6 A;  2HQ7 A;  2X1K A;  3A20 A;  3E4V A;  2FHQ A;  3U0I A;  1USF A;  2X1J A;  3H96 A;  3TGV A;  4HMW A;  3K86 A;  3GAS A;  3R5Z A;  4XHY A;  3ZOF A;  1RFE A;  2NR4 A;  3R5L A;  3U34 A;  3ZOC A;  4HMU A;  1WGB A;  1Y30 A;  3NFW A;  3A6R A;  3CP3 A;  2VPA A;  2A2J A;  1G79 A;  2IG6 A;  1T9M A;  3K88 A;  1W3R A;  3RH7 A;  1W3O A;  1G77 A;  1YOA A;  2ASF A;  3B5M A;  2HHZ A;  4Y9I A;  2Q9K A;  1TY9 A;  2HTD A;  3HY8 A;  3VY2 A;  2D5M A;  1VL7 A;  4YWN A;  4HMT A;  1WLK A;  3A6Q A;  1XXO A;  3ZOG A;  1I0R A;  2FUR A;  1RZ0 A;  4XJ2 A;  2I02 A;  3ZOD A;  3BA3 A;  2ARZ A;  5CHO A;  2I51 A;  2RDE A;  3KYG A;  4HMS A;  1XHN A;  4L82 A;  2ED4 A; 
#chains in the Genus database with same CATH topology
 1NWM X;  2J62 A;  3U5W A;  3O4X E;  1D1A A;  4IIJ E;  4IE5 A;  3R5R A;  1XMO T;  2R6G F;  4ZOL E;  1E1H B;  3O9X A;  2PTF A;  3MJX A;  3HKB E;  2C5I T;  2M6I A;  4ZHQ E;  3K3Q C;  1B7T A;  5JDM A;  4HWH A;  5FVK A;  4O4L E;  4DV6 T;  2BKP A;  1W3P A;  3SS1 A;  1OED A;  1HFA A;  1D0Z A;  4I4T E;  2L8K A;  4MAL A;  3AE5 A;  4ILU A;  2BBJ A;  4JEU B;  3RPU A;  4JI1 T;  1HG2 A;  1YXR A;  3RLF F;  4OX9 T;  4PFP A;  1KFY A;  4N7R C;  5AQT B;  2YDR A;  3E4V A;  3CIR A;  3I9W A;  1USF A;  2UXC T;  4I43 B;  3HKC E;  3O1H A;  3R5Z A;  2XZE A;  3UU5 A;  4IL4 A;  3K3N A;  3QOF A;  3UUX B;  3CP3 A;  4DV4 T;  5DQW A;  2V7I A;  3AED A;  4DMW A;  3OTO T;  3PDY A;  3AE2 A;  4I0U A;  3C51 A;  2HHZ A;  3JC6 D;  1HX1 B;  5LOV E;  4JV5 T;  5JQG E;  5JRE A;  3OVU A;  1QUU A;  3ZMV B;  4CQI A;  5L3F B;  1BR4 A;  2P5Z X;  4K0K T;  3KV5 A;  5AQF B;  4U72 A;  2X67 A;  3AE8 A;  3CWZ B;  3VU7 H;  3K1S A;  2X66 A;  2DCF A;  4JI3 T;  3GN5 B;  3N9L A;  2WU2 A;  2DWK A;  1W0A A;  4DR7 T;  4MHC A;  1D1C A;  3H3M A;  2WMN A;  1G8X A;  5LA6 E;  3NRX A;  2CLY C;  1U5P A;  3PUS A;  4DR3 T;  5LMN T;  1IJ6 A;  2D38 A;  3KVB A;  3FGE A;  5AFU L;  3KBU A;  3PUQ A;  3CK6 A;  2CM0 A;  2K5B B;  4TNW A;  4P1N A;  2JMK A;  5JDH A;  2YU2 A;  4O8S A;  4ADZ A;  3E22 E;  4EZ4 A;  2QCK A;  3CX6 B;  3MAC A;  2RA1 A;  5JAB A;  3N9O A;  1FEW A;  4FI5 A;  2YKS A;  2WY2 A;  2HQ7 A;  2KXP B;  5L3B B;  4DID B;  2BG9 E;  5LYJ E;  1I6Z A;  4BAY B;  3N9P A;  4EOZ B;  4YTP A;  3LK3 B;  4OYK A;  5ABF A;  1FJG T;  2W00 A;  1G79 A;  3LDQ B;  1HS7 A;  2M67 A;  1WYC A;  3M65 A;  1T9M A;  2JIW A;  2BG9 B;  3F31 A;  4YTM A;  4H63 V;  2CXD A;  5L3D B;  2ODV A;  5LHH B;  3FXD B;  1MMG A;  2HN2 A;  4QXC B;  2XAH B;  1KF6 A;  4HMS A;  4LF5 T;  2W62 A;  3LK4 2;  3ZJ2 A;  2ED4 A;  3G06 A;  4HGA A;  2Q9Q D;  2IML A;  2VAS A;  3AE3 A;  3VHL A;  1SA0 E;  2XQ3 A;  2BVM A;  2NTX A;  1CUN A;  3R6N A;  3ZN0 B;  1W3Q A;  3AEC A;  2XTL A;  4NUV A;  3RYI E;  1Y01 A;  3U35 A;  1HX8 A;  3EAA A;  5TAO A;  4UR9 A;  4ILB A;  2WZH A;  3LBX A;  4DR6 T;  4DV0 T;  2RP4 A;  2D37 A;  1IBK T;  1L0V A;  3C4X A;  4PJM A;  4OHF A;  2BG9 C;  3EC6 A;  3ONX A;  3UQ7 A;  5HEO A;  2ZM6 T;  2H7V C;  5JTG A;  4YBN A;  3VRA A;  4QH4 A;  2Q9Q B;  5AQH B;  1KNR A;  3ZT5 A;  1QLB A;  1N33 T;  4I50 E;  5AQP B;  1W9R A;  3UU3 A;  2CHO A;  4HTE A;  1YD8 G;  2FHQ A;  3QB5 A;  3N9Q A;  4NIQ A;  4ZI2 D;  2DHR A;  5AQK B;  3SFE A;  2CXF A;  2WP9 A;  4ILC A;  5IUX A;  2LSK A;  3P8C D;  3RRC A;  5BMV E;  1IZN B;  3X1D A;  4TWF A;  4MFR A;  5LG3 A;  2XAQ B;  3KVA A;  1BR0 A;  2DLR A;  2YIN A;  2E9X D;  4YJ2 E;  2LRK A;  4IDZ A;  3DTO A;  1VL7 A;  1WLK A;  2X0L B;  2KSR A;  2WCA A;  5GON E;  4JLE A;  2JRK A;  2ES0 A;  1IBM T;  1NEN A;  3DB0 A;  2CBI A;  3AA6 B;  5HCJ A;  2KLQ A;  2JJ9 A;  4JYA T;  3SWJ A;  3ZPO A;  4AKL A;  2XQ7 A;  2Z6E A;  4LF9 T;  4JI0 T;  2F4V T;  2CWY A;  4UV8 B;  2YDS A;  4ZS3 A;  4HFI A;  3ZOH A;  5M4Y A;  2KND A;  3QNU A;  1V9D A;  2E9X B;  5CFB A;  3FHN A;  3HI2 A;  5BR8 T;  3VR8 A;  4GK5 E;  2ZM0 A;  5FYM A;  4TWD A;  2OA5 A;  2IHR 1;  3O1I A;  3DP7 A;  4CN6 A;  2DL1 A;  4JI7 T;  2CBJ A;  4R82 A;  4QH1 A;  1OXZ A;  4EYU A;  3JAE A;  4MTK A;  2FUP A;  4UF0 A;  5FNV E;  2BBH A;  2HQ9 A;  1BR2 A;  4HWC A;  5LXT E;  4QXB B;  5J2T E;  2X1J A;  3H96 A;  4YXD A;  2IAK A;  3CQG B;  4JI6 T;  4LML A;  3VKH A;  1Z0P A;  2PG8 A;  2H89 A;  5JR9 B;  5FY7 A;  4ERR A;  2NW9 A;  4AIS A;  3CKD A;  2IUB A;  3FXE B;  3PV0 F;  5AQR B;  1ZKE A;  2Q9K A;  4MBQ A;  3HY8 A;  5HXH A;  1D1B A;  1XXO A;  2LSJ A;  2J4G A;  1WLX A;  4XJ2 A;  2QGS A;  1KNZ A;  3LG7 A;  4JI4 T;  2WWV A;  3OYX A;  4B3S T;  4YT0 A;  2A3D A;  5LJN A;  4BA9 A;  3VY5 A;  3AAI A;  2QEA A;  2W63 A;  3LK2 B;  1WV4 A;  1CI0 A;  4U3C A;  3NBX X;  5CA0 E;  3D0T A;  3AE4 A;  1OED C;  5AQL B;  1I0S A;  4HE8 A;  3KDS E;  5HXS A;  1RZ1 A;  2LOS A;  1JNW A;  1IAP A;  4HMV A;  4QXH B;  2FG9 A;  3RX6 A;  4ASK A;  1HCI A;  2DWG A;  4H9S E;  4EGW A;  2R0X A;  2ECU A;  3FBL A;  4EYY R;  3CX7 B;  3H3A A;  3UFG A;  4DV2 T;  4B3T T;  4GKJ T;  3RYF E;  2FBW A;  3PUR A;  3CQX C;  3AEG A;  3U0I A;  4O2B E;  4H9R C;  3A7M A;  2WU5 A;  4PK6 A;  4U2Z A;  1WGB A;  3KV6 A;  4E7Z A;  2VPA A;  1UUS A;  4DND A;  5AQU B;  2V5D A;  2V7J A;  3FZH B;  2CRB A;  1S94 A;  2X0Y A;  3ZOG A;  5F3J A;  1I0R A;  4TUY E;  3UT5 E;  5HYA A;  1MIY A;  1UUR A;  3IEE A;  4Q25 A;  2MBG A;  5KMG P;  2XQ6 A;  4Z85 A;  4DVD A;  4A97 A;  4CXY A;  4A56 A;  3P50 A;  3VYA A;  3MZK B;  3F2E A;  2W61 A;  2IAB A;  2LJL A;  5C8Y E;  2D0T A;  5EK2 A;  2XQA A;  3BQI A;  3CVR A;  4JI5 T;  4IDP A;  3CB0 A;  3RGL A;  1BR1 A;  5JDN A;  4DO0 A;  2K3W A;  2AE9 A;  3RKG A;  3F7E A;  4ZKY A;  4IE4 A;  4X64 T;  2CEA A;  4XBF B;  3MK7 C;  4IRA A;  1T8B A;  3IBP A;  4AKG A;  3KV4 A;  1SE7 A;  3ZN1 B;  2W67 A;  3ZC0 A;  2G0U A;  1UCU A;  2NR4 A;  4G63 A;  4HMU A;  2EHO A;  4QX8 B;  3A6R A;  2N1G A;  2IC6 A;  5LNK A;  1HNW T;  4ILA A;  3I1A A;  3CPZ A;  4HFB A;  4UV9 B;  4DR5 T;  3N5L A;  4AI6 A;  4L5G A;  2V1D B;  1W3O A;  2LSY A;  2HTD A;  2FJB A;  2XSB A;  4PFO A;  4DV7 T;  2CLY B;  5JDG A;  4K0U A;  5J0Z A;  3W15 B;  2E5L T;  3CX8 B;  2I51 A;  2VQF T;  5AQS B;  4DBQ A;  2XJ7 A;  5LJM A;  4YSX A;  2XM1 A;  4QVB A;  2RE7 A;  3S4U A;  3NVO A;  2ZM2 A;  5FXV A;  3KFW X;  1J5W A;  3R5W A;  5LG4 A;  3IHR A;  3OKQ A;  2NW7 A;  2ZM8 A;  2V5C A;  4YY3 T;  3PUZ F;  4GYS A;  3AE9 A;  3RIU C;  5LHG B;  2V6Y A;  3NKZ A;  4UVB B;  2OV9 A;  3PFT A;  4TV9 E;  3FZF B;  3EVY A;  3PUY F;  2A2F X;  5E0O A;  3SWH A;  1Y12 A;  5CB4 E;  2BVL A;  4NXM T;  2IC9 A;  5LGN B;  4EZH A;  2JPF A;  2BZB A;  3PTR B;  3DJB A;  3L09 A;  3IN6 A;  3UU8 A;  2KMF A;  3H37 A;  3I0Q A;  2XAG B;  3AVS A;  2XQY A;  1XWM A;  3FB2 A;  4X62 T;  1KNP A;  3AEF A;  4ZI7 E;  1FIO A;  4KP3 C;  4YJ3 E;  2SPC A;  2A72 A;  3B5M A;  3BQK A;  4AKR B;  1UX4 A;  4AKH A;  2BS2 A;  3J7Y q;  3A6Q A;  4GOU A;  2FUR A;  1RZ0 A;  3P4W A;  2K24 A;  3I9Y A;  4H9N C;  3A8Y C;  4EAH A;  2CHN A;  2VL0 A;  1XDP A;  3ZYK A;  4B3R T;  3K8P C;  4L82 A;  3UUN A;  3U3I A;  2OU5 A;  5L47 A;  4LF4 T;  5L3C B;  3LSV A;  3K3O A;  5ABE A;  2UUA T;  4LF8 T;  2X9H A;  3PE0 A;  4WYV A;  3HMZ A;  2P9B A;  4QKN A;  2HPJ A;  1M62 A;  3QUJ A;  4OFZ A;  1USC A;  4EIW A;  4TN7 B;  2M6B A;  4U31 A;  3ANW A;  2DI4 A;  2NTY A;  3RQW A;  4O2A E;  3DNH A;  2ACX A;  4W64 A;  2KWH A;  2XAF B;  5L3E B;  4H9Q C;  4E7S A;  4HX6 A;  4YFS A;  3KV9 A;  4G2A A;  4IRE A;  4WW0 A;  3AEB A;  2WDR A;  2GJG A;  5J2U E;  2YEV C;  3N2G E;  1MMD A;  3R5Y A;  4EB6 E;  4C90 A;  3OBV E;  3N2K E;  5AQM B;  3T8O A;  3ZOF A;  5HEG A;  2VVN A;  5LBQ B;  3RYC E;  1WYB A;  1ZEE A;  3RYH E;  1YOA A;  5HEU A;  3E0Z A;  4ZI3 C;  1MND A;  2I59 A;  3LJC A;  2J1D G;  4HFC A;  4UVC B;  2KZ7 B;  1JNZ A;  1N36 T;  4QX7 B;  3OPC A;  5CHO A;  2IW5 B;  1XNR T;  2BS3 A;  2V7M A;  2IDO B;  4KX6 A;  1XNQ T;  5JRC B;  4LFB T;  2HH7 A;  2MAW A;  4LF7 T;  3C50 A;  2WWU A;  4KMC A;  4P0B A;  5DQV A;  4OK0 A;  2Y6X A;  2UXX B;  1MIW A;  2XM2 A;  3MXZ A;  5FY1 A;  5IHY A;  2WAU A;  4YHJ A;  2V6X A;  3QK6 A;  4JBW F;  4CXX A;  5HAX A;  2LLY A;  5JVD E;  3JAF A;  4AKI A;  3EAM A;  4LMK A;  2I0M A;  2CXL A;  5JDL A;  3I0O A;  3PUX F;  4CI3 B;  4PK5 A;  2XQ4 A;  2K9A A;  3ZCI A;  4NXN T;  2LEH A;  4ZEY A;  3EDV A;  2YOE A;  2ODU A;  1FLM A;  5J1G A;  3GN5 A;  4I55 E;  3N9M A;  2ZLY A;  4HMW A;  2V7K A;  5FVL A;  2MPK A;  3K86 A;  2FJD A;  3L3P A;  4DUZ T;  3AA7 B;  1RFE A;  3ETU A;  1MMN A;  4ZS2 A;  3NFW A;  1OED E;  3ZT7 A;  4UHV A;  3RC3 A;  1OWA A;  2WQY A;  5FKY A;  2I6H A;  1W3R A;  5L4H A;  2X9X A;  3PJA A;  1OED B;  2LHN A;  3ZEF B;  2X68 A;  5FP3 A;  2CE7 A;  2I02 A;  5ABH A;  3BA3 A;  1VRB A;  5L3G B;  5EK4 A;  1XHN A;  4TZ4 C;  3AB3 B;  3ZCJ A;  2KT9 A;  1UGO A;  2QA7 A;  2W4X A;  5ETW A;  4YLH A;  1UK5 A;  3Q9D A;  4AQG A;  4HKA A;  3EUH A;  2D9D A;  4AIU A;  1J5E T;  2XQ5 A;  5L2L A;  2VKO A;  2WDV A;  4CXW A;  1SHZ C;  1H7C A;  2BG9 A;  2QVA A;  4IE7 A;  5ESC A;  4ANJ A;  4U74 A;  2JQK A;  1I94 T;  1XZY A;  4PK4 A;  3R84 B;  4KUM B;  2YK0 A;  2IIU A;  2HPL A;  3K87 A;  4EED A;  2BS4 A;  1MIV A;  2UXD T;  2L3L A;  1QSD A;  2EHO C;  1G78 A;  1O3X A;  4EV6 A;  2UXN B;  2W66 A;  5AQQ B;  5AQJ B;  2X1K A;  2YDQ A;  2CA5 A;  2QRX A;  4U33 A;  3GAS A;  2ZMA A;  2Y48 B;  2V7L A;  3Q5X A;  3U34 A;  2L9Q A;  3TLU A;  2A2J A;  1HR0 T;  4MLK A;  2JMH A;  2KIN B;  2IG6 A;  3EHZ A;  3Q5D A;  4HFH A;  4BJM A;  2VK9 A;  4DV3 T;  2ARZ A;  4UEM A;  3ESL A;  2Q9Q A;  4FJO A;  4DV1 T;  1EZ3 A;  4XAX B;  1DU2 A;  3PUG A;  4L0R A;  4H9P C;  3V5S A;  2YN6 A;  3FZL B;  3WI3 A;  5F5W A;  5KXJ A;  3F57 A;  1VCS A;  1IJ5 A;  4PW8 A;  5HCM A;  4PJN A;  1G73 A;  1T98 A;  3P4S A;  5ABF B;  3PUA A;  4X66 T;  3AE6 A;  3VKG A;  1NRG A;  3AXJ B;  3FKH A;  4OYJ A;  4DR2 T;  4DBR A;  2JQH A;  4F8H A;  2HN1 A;  4WBO A;  3LFM A;  4QH5 A;  2NP9 A;  3HE1 A;  1NAF A;  2J47 A;  3E08 A;  3SRZ A;  4PJJ A;  3DMB A;  2N9D A;  3ONJ A;  4X1Y E;  1Y64 B;  3ABV A;  2VKD A;  3BK9 A;  5LHI B;  4NPP A;  4IT4 A;  1FMV A;  1HG5 A;  4UVA B;  3A20 A;  4Z90 A;  5HWX A;  2BKN A;  3C98 B;  5LMU T;  3ZMZ B;  1R8I A;  2X0H A;  3R5L A;  4LFC T;  2B76 A;  3AA0 B;  5FL1 A;  3T1Y T;  3LBX B;  4AQF A;  4DV5 T;  2E9X A;  3ZT6 A;  3FZK B;  3RH7 A;  3GA8 A;  4P09 A;  4IDN A;  2D2S A;  3IA3 A;  5AQI B;  2L1T A;  3L8R A;  2X9Y A;  2LM2 A;  3TLW A;  3CQC B;  3WAJ A;  2D5U A;  4EXT A;  4TV8 E;  2BDE A;  4BJN A;  3TKL B;  4GIW A;  4IL9 A;  4GYR A;  5FL0 A;  4IE0 A;  3BNK A;  3P4P A;  2WZI A;  1U4Q A;  1YKH B;  2LSG A;  4IST A;  4COF A;  1J1J A;  3HKE E;  2XQ9 A;  4A5X A;  3PU3 A;  5AQG B;  4V1A v;  3AEE A;  3VR9 A;  1ZV4 X;  2UU9 T;  4C91 A;  4X20 E;  5JR9 A;  4P0A A;  1N32 T;  2K4Q A;  3RI5 A;  1XDO A;  4A98 A;  3ETV A;  3N2O A;  5CGM A;  2WB5 A;  2E83 A;  4GK0 E;  3V5U A;  5JDQ A;  4EEB A;  4PNI A;  5KDM C;  3T1H T;  3SFD A;  4U7I A;  3HR0 A;  3ZOE A;  2XSA A;  2C0S A;  4IGU A;  3NZQ A;  1YQ4 A;  3QB5 K;  2ECR A;  3FBZ A;  3L39 A;  4NUU A;  4O4I E;  4HFE A;  3NRY A;  4Z8X A;  2FJA A;  1Y30 A;  4HFV A;  2VL8 A;  2XY8 B;  4YSZ A;  2H7O A;  2UXB T;  5F8P A;  1MMA A;  2VQE T;  1N34 T;  3KBT A;  2JQ9 A;  4CZZ B;  3AAE B;  2OLT A;  4HWF A;  1VOM A;  4HWI B;  5CJ5 A;  4B3M T;  2HHH T;  5A1L A;  2D5M A;  4HMT A;  3AE7 A;  4TX5 A;  5JDF A;  5H6R B;  3OYZ A;  1FMW A;  2XQ8 A;  4YHH T;  1T7S A;  3AWH A;  4ZI3 D;  4DMV A;  4UF0 B;  5LCY A;  3R5P A;  4CN4 A;  3UU4 A;  3ZKR A;  1LKX A;  2W2U A;  2E5V A;  5LB7 B;  3HKD E;  1AJ3 A;  2K48 A;  5EK3 A;  4J2C A;  4X1I E;  3KYF A;  1G76 A;  4H9O C;  2X9W A;  3Q5E A;  3RHW A;  2Y8D A;  3QC9 A;  4LF6 T;  4XZC A;  3B57 A;  4O4H E;  4ISS A;  5FY0 A;  3UQ4 A;  1S35 A;  2XPK A;  2LRL A;  3AE1 A;  2WM9 A;  5HXE A;  3ZSS A;  2RPA A;  2XUE A;  3AXJ A;  4UXN B;  4N78 D;  2A9U A;  3RF1 A;  2V8S V;  3EDU A;  1ZP0 A;  2LE8 A;  2PJQ A;  3NWI A;  3JC6 C;  1MNE A;  3RH3 A;  3OJA A;  1ZHC A;  4WZX A;  3RIF A;  3K88 A;  1XMQ T;  4WNK A;  4U7Y A;  4U2Y A;  4Y9I A;  1WCR A;  3VY2 A;  4KI0 F;  4JUY A;  3VRB A;  4ZZC A;  2AXD S;  5IWA T;  2LKG A;  4M1P A;  2VB6 A;  3RC8 A;  2VKJ A;  4KHZ F;  5BNC A;  2KWI B;  3MA9 A;  4HMX A;  1AXJ A;  3PUW F;  2CWO A;  2VKH A;  3RIU A;  5HXR A;  1D0Y A;  4IDO A;  4JI2 T;  2MTQ A;  5CHE C;  1JNR A;  1WRD A;  3JCF A;  3P4Q A;  3EI0 A;  4UIG A;  4AQY T;  2D36 A;  5HWY A;  5C2T A;  3BPK A;  4AXP A;  5FXW A;  4X65 T;  5C3J A;  1M7K A;  2B1E A;  1DNL A;  1NEK A;  2LKH A;  1HTJ F;  2WMO A;  2LM9 A;  3ZMS B;  3RRW A;  2W0G A;  3TGV A;  2C5K T;  3FZM B;  2E2A A;  4HFD A;  3UUB A;  4TNV A;  2ACZ A;  2EHO D;  5AQN B;  3WAK A;  3ZYM A;  2C5J A;  3P7I A;  5CA1 E;  4IHJ E;  4IE6 A;  1G77 A;  3AA1 B;  2Q9Q C;  2PFV A;  4CN1 A;  1CHU A;  2DNX A;  2WDQ A;  2JQQ A;  1X79 A;  5KX5 E;  2V26 A;  1UX5 A;  2GK9 A;  4PJL A;  3A5X A;  3J9X 1;  1T72 A;  1HF8 A;  1LRZ A;  3Q2M A;  1WLI A;  3AVR A;  5HEJ A;  1YKE B;  1YW0 A;  3UTK A;  3UFE A;  1IBL T;  5FXZ A;  3RIA A;  2NW8 A;  3JAD A;  4JI8 T;  4DR1 T;  1LVF A;  5AQO B;  1LVK A;  2LT3 A;  3BQL A;  5DAB A;  2EHO B;  2NOX A;  1E2A A;  2MYS A;  3RQU A;  1KEY A;  2WBL A;  3B13 A;  2CMR A;  2OL5 A;  1W0B A;  1SUM B;  3V4H A;  4ZI2 C;  4F07 A;  2UUC T;  3MKD A;  4LMJ A;  2XAJ B;  4HKH A;  3C64 A;  1EJE A;  4L9I A;  2D0U A;  4B6X A;  3UUL A;  3KIN B;  3PUV F;  2UUB T;  3NZP A;  4AQF C;  2E9X C;  3C4W A;  4KHP T;  2VVS A;  4XHY A;  3RKO A;  2NWB A;  1WR6 A;  4ZZB A;  3O1J A;  2X51 A;  3EAB A;  2V6Y B;  5DJQ C;  3AEA A;  3ZST A;  5FMN A;  3PU8 A;  5IYZ E;  3ZLI A;  4DR4 T;  3PJA J;  3U78 A;  5ABG A;  2WS3 A;  2H3R A;  3ZOD A;  3HL6 A;  1WR0 A;  4HN9 A;  2YU1 A;  3KYG A;  3IF8 B;  3UUM A;  4TWH A;  4CI2 B;  4WBN E;  5H6Q B;  3AAA B;  1ZOY A;  1W9A A;  4HWD A;  4IDQ A;  5JR9 C;  1HNX T;  2WSS V;  4PAG A;  2MOZ A;  4Z91 A;  1E7P A;  4KBM B;  3AMF A;  5L4E A;  1X9B A;  3SOL A;  5JH7 E;  3Q5W A;  4LFA T;  1YLN A;  2CCQ A;  4X5T A;  4O4J E;  5LGT B;  1D0X A;  1YQ3 A;  4X1K E;  1VCT A;  3ZJ1 A;  3GWH A;  2HTI A;  4H63 H;  3ZC1 A;  3P4R A;  4DUY T;  2QYW A;  1KK7 A;  1W09 A;  5EZY E;  3GMI A;  3TLS A;  2LOP A;  3ONL C;  1US7 B;  5HXC A;  2PBI A;  3HA4 A;  4UEL A;  5JRC A;  3ZMU B;  4HEA A;  3UU6 A;  2AQ6 A;  3ZMT B;  2R6V A;  3N9N A;  2BKO A;  5FXX A;  4F6R C;  4CI1 B;  2XAS B;  3TLV A;  4YSY A;  3ZYL A;  3ZOC A;  4GKK T;  3CML A;  5HEH A;  2E8I A;  2CPT A;  2LSI A;  4QHO A;  2ASF A;  3C4Z A;  3M3Z B;  1GQE A;  1Z8U A;  1TY9 A;  2H88 A;  3ANW B;  1HNZ T;  2FJE A;  4JEH B;  5LGU B;  4YWN A;  1WFD A;  4YTN A;  5LBM A;  5ADX L;  3TLT A;  4QWN B;  2LHR A;  2RDE A;  2GUJ A;  4ZXL A;  2XHE B;  4TV4 A;  5LP6 E;  2N2N A;  5AQV B;  2VWA A;  2VUR A; 
#chains in the Genus database with same CATH homology
 1WLI A;  3AWH A;  2OU5 A;  4Z85 A;  3DB0 A;  3U5W A;  2IML A;  3BNK A;  4QVB A;  3R5P A;  3VY5 A;  2RE7 A;  1W9A A;  3SWJ A;  2QEA A;  5BNC A;  3R5R A;  1WV4 A;  3VYA A;  1CI0 A;  1W3Q A;  3R5W A;  4HMX A;  3AMF A;  3U35 A;  1AXJ A;  2PTF A;  1X9B A;  2IAB A;  1I0S A;  1YLN A;  3KYF A;  3ZOH A;  3HMZ A;  5CHE C;  2D38 A;  1G76 A;  1NRG A;  2D37 A;  1USC A;  3FKH A;  5ESC A;  3FGE A;  3CB0 A;  1RZ1 A;  1W3P A;  1JNW A;  2OL5 A;  2E83 A;  2HTI A;  2FG9 A;  3PFT A;  4HMV A;  3DNH A;  3EC6 A;  2D36 A;  4F07 A;  4HX6 A;  2R0X A;  2ECU A;  3F7E A;  3BPK A;  2QCK A;  3DMB A;  3K87 A;  4R82 A;  4YBN A;  4ZKY A;  1EJE A;  3ZOE A;  5JAB A;  1DNL A;  2GJG A;  4IRA A;  1G78 A;  2AQ6 A;  2HQ9 A;  2ECR A;  4N7R C;  1FLM A;  3R5Y A;  2R6V A;  3IN6 A;  2HQ7 A;  2X1K A;  3A20 A;  3E4V A;  2FHQ A;  3U0I A;  1USF A;  2X1J A;  3H96 A;  3TGV A;  4HMW A;  3K86 A;  3GAS A;  3R5Z A;  4XHY A;  3ZOF A;  1RFE A;  2NR4 A;  3R5L A;  3U34 A;  3ZOC A;  4HMU A;  1WGB A;  1Y30 A;  3NFW A;  3A6R A;  3CP3 A;  2VPA A;  2A2J A;  1G79 A;  2IG6 A;  1T9M A;  3K88 A;  1W3R A;  3RH7 A;  1W3O A;  1G77 A;  1YOA A;  2ASF A;  3B5M A;  2HHZ A;  4Y9I A;  2Q9K A;  1TY9 A;  2HTD A;  3HY8 A;  3VY2 A;  2D5M A;  1VL7 A;  4YWN A;  4HMT A;  1WLK A;  3A6Q A;  1XXO A;  3ZOG A;  1I0R A;  2FUR A;  1RZ0 A;  4XJ2 A;  2I02 A;  3ZOD A;  3BA3 A;  2ARZ A;  5CHO A;  2I51 A;  2RDE A;  3KYG A;  4HMS A;  1XHN A;  4L82 A;  2ED4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...