1YLNA

The crystal structure of the protein of unknown function vca0042 from vibrio cholerae o1
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
226
structure length
225
Chain Sequence
TVSTINSTDALAMVEHSELTLSITTPVGTKFVCRTPFIGTHTDKFLLVEMPKISADDLQYFFQEGFWMNIRAISPRGEGALIHFRSQLMHILQEPVPMAFLSIPNTMQVSQLRKEPRFELNLAGKVLFDEHRGDCELRDLSRSGCRFITPPLGKTYQVGDLVALEIFSDLRGTKTFPPLTGKICNLQRSLHHARYGLEFNEEGRNNAKNLLAQLKFNGTKLTLNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein vca0042
publication title The crystal structure of the hypothetical protein vca0042 from Vibrio cholerae O1
rcsb
source organism Vibrio cholerae o1
total genus 39
structure length 225
sequence length 226
ec nomenclature
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07238 PilZ PilZ domain
A PF12945 YcgR_2 Flagellar protein YcgR
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.110.10 Mainly Beta Roll Pnp Oxidase; Chain A Electron Transport, Fmn-binding Protein; Chain A 1ylnA01
2.40.10.220 Mainly Beta Beta Barrel Thrombin, subunit H predicted glycosyltransferase like domains 1ylnA02
2OL5A 4YWNA 1YOAA 2ASFA 4HMXA 3BPKA 2I02A 1VL7A 3DNHA 4RT0A 3K86A 5CHOA 4HMVA 3ZODA 1I0RA 1EJEA 1NRGA 2X1KA 5KEDA 4F48B 2HQ7A 3R5RA 3SWJA 4N7RC 2D38A 2IG6A 2HQ9A 4XRNA 2PTFA 3K87A 2FHQA 3AMFA 3HY8A 4ZKYA 4HX6A 2FURA 1AXJA 2QEAA 1W3QA 5KECA 3CNRA 1WLIA 3U5WA 2OU5A 3ZOEA 4P00A 2Q9KA 2HTIA 4R82A 2ECRA 2AQ6A 3IN6A 5CHEC 5KGOA 3R5LA 4Y9IA 1G76A 1FLMA 3A6RA 4HMWA 3U35A 1W3RA 3K88A 1I0SA 2D36A 3ZOGA 2HHZA 2A2JA 2RDEA 3ZOFA 3E4VA 3RH7A 4HMUA 3R5ZA 1WGBA 1YWUA 1G78A 4L82A 1CI0A 1RZ1A 2GJGA 2HTDA 2ECUA 2D5MA 3F7EA 5ESCA 3ZOHA 2IABA 1XXOA 3NFWA 1RFEA 1YLNA 3KYGA 4XJ2A 3R5PA 5EJ1A 2R0XA 3DB0A 3DSGA 1W3PA 3AWHA 4Z85A 3FKHA 4RT1A 2FG9A 3PFTA 2R6VA 1TY9A 1DNLA 2D37A 4QVBA 2NR4A 4HMTA 1G79A 2QCKA 3TGVA 3A6QA 3VY2A 4I86A 2ARZA 3HMZA 1XHNA 3FGEA 3EC6A 3R5WA 5EJZA 1USFA 2X1JA 1G77A 3VYAA 4P02A 4IRAA 3H96A 4XHYA 1WV4A 1WLKA 3U34A 3B5MA 2RE7A 4F07A 3A20A 3ZOCA 2I51A 2IMLA 1T9MA 3CP3A 5JABA 2E83A 4HMSA 1USCA 3KYFA 3DMBA 3R5YA 3GASA 3BNKA 3BA3A 4YBNA 4HG6A 5EJLA 5BNCA 5EIYA 1W9AA 2L74A 1RZ0A 1W3OA 1JNWA 4FOUC 3CB0A 2VPAA 1Y30A 3U0IA 3VY5A 2ED4A
chains in the Genus database with same CATH superfamily
1BZXE 3BIVH 3M5LA 4FU9A 1OP2A 2THFB 5HGGA 3DA9B 1V2NT 3P70B 1O3IA 1FI8A 1RTFB 3M3SA 4MNWA 2F9OA 1MMJN 3DT0H 5EW2H 3FZZA 2FOBA 1UVTH 2J98B 4X1QU 2IG6A 2GMTB 2W7SA 1ZSJA 1GBKA 2FHQA 1GJBB 1O2GH 4Y8XA 1TFXA 4I33A 4DY7B 1AO5A 3PV5A 1AXJA 1FAKH 2QAAA 1W14U 1Y3XA 1PPFE 3TNSA 1W3QA 1QRXA 2ZGXH 1UK3A 3AW1A 4R82A 1VR1H 2V3MA 4OM9A 2ZDVH 1JRTA 1O5CB 1P03A 2R0KA 1GI6A 2J2UA 1W13U 1DX5M 4FUHA 1FUJA 1WV7H 3DUXH 3LGIA 1QL7A 3UQVA 1P0SH 1O5DH 1TPAE 5FXLA 3M36A 1MH0A 1WGBA 2BD7A 1EZUC 2ANYA 1G9IE 3A7YA 4ACAA 3URCA 2ESTE 2W3KA 1S0RA 2FS8A 4FVBA 1OP0A 2GJGA 1EOJA 1BITA 5FPTA 3MQKC 2ZPQA 1F0RA 3H09A 3P92A 2PGBB 2JJ2D 1EB1H 4Y7BA 2BM2A 2IPHA 2O8MA 1O5AB 1TNHA 3NFWA 3A83A 1GL1A 4AOQA 1YLNA 1C9TA 1VCPA 4SGAE 2DE9A 3DSGA 3GICB 1C2FA 1K1PA 1C5XB 2Y80A 4X8SH 3TJNA 2H6MA 3A86A 4Y6DA 2Z9IA 4FUDA 4A1XA 1DNLA 1KIGH 3SUGA 4F55A 3U1JB 3UPEA 2DUCA 2D2DA 3S7KB 2ARZA 1P2JA 4K60A 5J4SA 3MO6A 5GJ4B 5IDKA 3DSPA 5B6LA 4YXWD 2R3UA 4AFUA 1K1MA 2Y5FA 3SU3A 4ZKSU 4ABHA 5CMXH 2ILNA 1V2KT 3GDVA 1HAIH 2ZFSA 1BBRH 3PLKA 3RXKA 2GCHF 1A3EH 4DCDA 7LPRA 4X2WA 1C5OH 3LGWA 1EXFA 3P17H 3T25A 2STBE 1VITF 4GSOA 2A31A 2GVFA 3RM2H 1KTTB 2EI8A 2GP9B 1BTPA 4X6OA 2KX4A 3B9FH 1C4V2 1IHTH 2ODYB 3U0IA 1EPTA 1HB0B 4B75A 3A87A 2V3HH 4HMXA 1VGCC 1ZRKA 1VL7A 1O3LA 1QR3E 4X8UH 2A2XH 2BQ6B 5LPFA 1XKAC 4TSFD 4U30A 1O2QA 1IOEA 1H8DH 3BSQA 4YO9A 2RG3A 3UOPA 3ZVGA 4B74A 3K9XB 2H9EH 4XSKU 4AG1A 3SJ8A 3AAVA 3TLOA 1WCZA 1LVMA 3D23A 5DP9A 1UVOA 1V2WT 3E6PH 2KAIA 3ZVFA 2PLXA 1GHBF 3CNRA 4KGAA 3LIWA 3ZOEA 3DCLA 3CP7A 2OQ5A 2P8OC 4M7GA 5HIZA 4K2YA 2FMJA 1VZQH 3P95A 3ZOGA 1NTPA 2ALPA 4MPWA 1C1MA 4UDWH 2ZFRH 2FI4E 4CH2B 1KDQA 1C1QA 1SSXA 2BTCE 4D9QA 1G32B 3I29A 3SOSA 1UTPA 2ZA5A 2TGAA 5EU8A 1TBQH 1E1RD 2J95A 4JZIA 1DE7H 4CRAA 7GCHG 5ABWA 3H7OA 3RXGA 1SLUB 1ZTJA 4Y71A 2Q1JA 3HK3B 4ABIA 3AWHA 2R6VA 4WMEA 1TY9A 2F9PA 4MTKA 2QV1A 4TT3D 3DD2H 1XUJA 2AERH 1SLXB 1KSNA 4X2VA 3SU5A 1NM6A 2P3UB 3PWBA 4OS2A 5C0TA 1GBHA 2KFWA 4IC5A 4Y7AA 1LKAA 1SGCA 3A20A 2G55A 3UUZA 5HXFA 1T9MA 1KTSB 1AGJA 2E83A 3ATMA 2GKVE 2QY0B 3QWCH 2KZ4A 5C0UA 4NSYA 2C4FH 3BTKE 3UQOA 1GBIA 2A4QA 1P10A 4AGKA 1DANH 2VPAA 1SGRE 4IBLH 4WVPE 4ZAEA 3VY5A 1E34B 2ZCKP 2P8OB 5JPMH 3BN9A 4XD7D 1ARBA 1QBNA 2RDLA 1FQ3A 3QO6A 1A5GH 4TWYA 1EOLA 2OCVB 3FP6E 2VBCA 2Z3CA 1UK4A 4Q2KA 1ZLRA 5SGAE 1HBTH 4CREA 3VB6A 1DITH 1D3DB 1BIOA 1KYNA 4FUGA 4XRNA 4XBCA 1JIMA 1QB6A 1W3CA 2FOAA 2BDHA 3AW0A 2FOHA 5FCRA 1QURH 1YPKH 5GIBA 1Y5AT 4Z1MD 1W0ZU 4B73A 1E37B 2GT8A 2W3IA 2FX6A 1ELEE 1L2EA 1V2ST 1XMNB 1Y3UA 2ZPRA 3KIDU 2SGDE 4NIYA 3RM0H 1KXAA 2AQ6A 1DVAH 3RMLH 1GHZA 3SUDA 3TGIE 3SI4H 3MI4A 3FOAA 2VINA 1NN6A 1OWDA 3SJ9A 1SBWA 3TIUA 2ZEBA 2RDEA 1O31A 1C4Y2 1GHAF 1K22H 5C5NA 2TBSA 2G4TA 2G5NA 4K1TA 4YESB 3SV6A 4Y79A 1TBZH 2M2AA 4X2XA 4KTUA 3TITA 2PUQH 4A7IB 3P8FA 2FLBH 1PFXC 1BTZA 1TB6H 2GV6A 2WINI 3KQBA 1EJAA 1Z8GA 4NGAH 4X6PA 1F0UA 2HLDD 5E0HA 1A0LA 1GGDC 3RXSA 3GY6A 2QYIA 1NFWA 1BRBE 2P3FH 1C1VH 2ZO3H 5FL7D 1SGPE 2D1JA 1ZHMA 1P9UA 3UREA 1F5LA 5EXMA 2KM0A 4IMQA 2G4UA 1AE8H 4JK5A 1QNJA 1PPHE 3GOVB 1FIZA 1QQ4A 1GMCF 3BG4C 2J5UA 1MD7A 1DDJA 2WYJA 2QF0A 5C5OA 4F49A 1HIAB 1SC8U 4BAMB 2A7HA 3EC6A 4GPGA 5EJZA 3RXEA 2GV7A 1C5ZB 1SPJA 3VYAA 3CENA 3OTJE 4B6FA 2XC0A 1B7XB 3T62A 1A2CH 1OWJA 3GDUA 1TMBH 4HZHA 3STJA 1TX7A 4AG2A 3F9EA 1PQAA 4DT7B 4CRBA 2M5TA 1DWCH 3LC5A 1W9AA 3PMJA 1GI9B 2WZQA 1Z8RA 1GG6C 3A80A 3B23B 5JBTA 1YOAA 2XTTB 3F6UH 3U8OH 1V2JT 4XFQA 1NPMA 2GT7A 4D7FA 5DG6A 3ZODA 3TK9A 1NFYA 1LKBA 1TGTA 3BTHE 2V3OH 4BTTB 1G2MA 1RGQA 2CXVA 3FP7E 1SGEE 5HIYA 1V2MT 1EZQA 3RC4A 3TU7H 3OEHD 2FYQA 2QGRA 1O3HA 2D38A 1DWBH 2QE7D 1RD3B 2VJ1A 5HM2A 1DWEH 1BRCE 1O39A 2BY9X 1CBWC 4MVNA 1GGDB 1OYQA 2FURA 1DLEA 3V4HA 4HKHA 3D65E 1YYY1 3R0FA 2OC1A 5CDFE 1WLIA 1YPHC 3DHKH 1QL8A 3MH6A 1EB2A 2ECRA 1PPEE 1IQGA 3R5LA 4Y9IA 1GCTB 1EAWA 1FLMA 4HMWA 1O3BA 1W3RA 1DLKB 1HNEE 2W5EA 3LH3A 4NWKA 3UY9A 3BG4B 1K0HA 1DS2E 1P06A 2OBQA 1GDUA 1HAGE 2JH6D 4K69A 1G78A 3E0PB 1TQ0B 4Y11E 4AYYB 1XUFA 9ESTA 2ZTXA 1UVUH 5E8EH 2SGEE 2JDID 2ECUA 3A7WA 3EE7A 2UUFB 1XXOA 1WQVH 5A8YA 1RFEA 1HDTH 1CU1A 9LPRA 1U6QA 3I77A 3O8CA 1EFRD 4ABAA 1GHXH 1Y12A 2QF3A 2AEIH 1D9IA 2BD9A 1UTLM 1BHXB 4WXIA 4CR5A 4Q80A 4HMTA 1N6YA 3RP2A 1C1SA 3M5NA 1ID5H 4H6TA 4ESTE 3MH4A 2YNBA 1G3CA 2FTLE 1ACBE 1JXPA 1MTSA 1NU7B 4ABBA 4DW2U 3RUOA 1WV4A 2XBYA 1E79D 3ZOCA 3RMMH 3NRLA 3RXAA 3CP3A 1C2LA 2ZU3A 2H5DA 1CBWB 2BY5X 4XDEA 1LPGB 2AGGX 1LQEA 4FU8A 1ELTA 2G81E 1THSH 1MABB 5DJ7A 5T6FA 1W10U 2VVCA 2OTVA 1O2ZA 2C90B 2I02A 3RMNH 1D3QB 1ELGA 3A89A 3KEEA 5JB8S 1P12E 2QC2A 2R9PA 3GY3A 1ELAA 4OGXA 1LCYA 4H4FA 4CRCA 5TCCA 1FZZA 4N7RC 3ZVAA 5C1YA 4A5TS 1SGYE 2HQ9A 1G3BA 2PKSB 1PQ5A 3TK5A 3QLPH 2ZHFH 2KCYA 4DVAU 2NU3E 1OWEA 3MOCA 5C17A 1PQ7A 4OGYA 1DSTA 1KLTA 3U5WA 5HKKD 3UNSA 1ZJDA 2D8WA 2UUYA 1D6RA 3A85A 3AASA 4IN1A 4UFFH 2XC4A 1COWD 4MNXA 3S0NA 1D3PB 5A0AE 1G76A 3I78A 2D36A 2IPQX 2BX4A 4Q7ZA 5L2ZH 1AVGH 3E4VA 1W2KH 3GCOA 1BHXF 3QK1A 2CV3A 1AWFH 4NA7A 1O3GA 1T8NA 4K8YA 2H5CA 3MMGA 1S84A 3DFJA 2VIDA 3ODFA 3S69A 2F9NA 4GAWA 1C2JA 3ZYEA 1S85A 1EZSC 1LHEH 1W11U 2EI6A 2OC0A 5DKMA 2HWLB 1FXYA 1MTNC 3M5MA 1GI1A 1IAUA 2XNDD 2D5MA 3F7EA 4VGCC 2GCTC 1G3DA 3ZVBA 3RXMA 2XCFA 3R5PA 2GCHG 1TA6A 3KN2A 1AKSB 1UCYK 1O2PA 2Y5HA 1FPCH 4B1TA 3BV9B 4RT1A 3TH4H 1O2WA 2FOFA 2FIRH 2TRMA 1G79A 2Z7FE 2XC5A 1MBMA 3UWJH 4MDSA 4JZ1A 1XXFA 6CHAC 2BDYA 1XHNA 3OSYA 1ANEA 3M3VA 3RXOA 1KXCA 4R0IA 4A1VA 1OOKB 1KLJH 2WPDD 1CHOF 3R3GB 1V2LT 1OKXA 2ZDKA 1ZRBA 3PM3A 2XNIA 5L6NH 1QL9A 4K5ZA 3RLWH 3M7QA 1BCUH 2CHAC 2J92A 1K1LA 1FLEE 3SORA 1HUTH 5C20A 3LC3A 3SGAE 3CB0A 2GZ8A 2BD4A 1GHBG 3BTFE 3E90B 4YWNA 1AFEH 3UR6A 2GDEH 1NT1A 4XBBA 2FX4A 3RXBA 4UD9H 4RT0A 2KR7A 3KL6A 1I0RA 2Z9JA 1PJPA 3Q76A 1QCPA 1O3NA 5JB9S 4YM9A 5DSFA 2GGVB 4WMFA 1FY3A 2J4IA 1TOMH 3R5RA 2XYAA 1J8AA 2O8TA 1YPLH 4ZHMU 1EX3A 3Q00A 5I25A 4IN2A 1MTNB 1V2OT 1EKBB 4B71A 2GCTB 5LGOA 2BOKA 3PO1C 1BMFD 1A5HA 2VVUA 1MTWA 3MU8A 2QCYA 4NZQA 1WU1A 2ZHDA 4W64A 1UTKA 3KGPA 1P11E 4LZ4B 2BY6X 1K1IA 1KXBA 1XX9A 7ESTE 3PMAB 2BZ6H 2O9QA 3A8DA 1GWAA 1O5GH 5FAHA 1P2NA 2ZG0H 2ALVA 3LKWA 3OU0A 3QGJA 3PTBA 1HAOH 2G5VA 3W95A 5JBAS 1V3XA 1BT7A 1GBFA 3VB5A 5C1UA 1QTFA 1EP5A 1GVLA 4WJG2 5T3HA 2BQ7B 1J17T 3U9AH 3ZVEA 4X0WU 3KYGA 3SW2B 2CHAB 2FOGA 3E1XB 3IITA 1W0KD 1C2EA 1TGSZ 4B2BA 1H9HE 4Y0ZE 1H8ED 1FIWA 1Y5BT 2FS9A 3ZZ7A 4NCYA 4U2WA 1A7SA 1O2KA 3TGVA 2XRCA 1Z6EA 1YLDA 1E1QD 2B0FA 4ZROA 1GJ8B 4K1SA 1QQUA 1ABJH 5IYTA 1ABIH 3BEUA 1TNJA 3BTWE 2ZGBH 1V2PT 1GJ9B 3U34A 1NS3A 3SGBE 3B5MA 3RXRA 1O0DH 2G52A 2Y7ZA 5T1VA 5B6OA 1NFUA 1FY5A 1WYKA 2KCOA 4ISLA 2FO9A 5E2OA 3P8OA 2CMYA 1LTOA 1LHFH 1HAHH 2CJIA 2GTBA 4BANB 1YPJH 4UFDH 3VB4A 1Y30A 5JBCS 3MH5A 4JYTA 3NCLA 1QA0A 1OWKA 2HGTH 1UVSH 2WPHS 5A09A 1TLDA 2Y5GA 5GDSH 3SU1A 3JZ2B 1MAXA 1GHAG 1NRPH 3H7TA 1MKXK 5GCHF 2YNAA 3K87A 1ELFA 4JYUH 1O30A 4ZMAH 1BMNH 3ZIAD 1HPGA 2JETC 5GNDA 4DIIH 3KF2A 1QRZA 2A2QH 4CHAC 4P00A 1ORFA 3K2UA 2BY7X 3Q77A 4IGDA 3L33A 3SU6A 5K7RA 5KGOA 3RXTA 2JJ1D 2TGPZ 5FX5A 1N6XA 3E16B 3GCNA 3PTNA 1TAWA 3SHCH 1CA0C 1HFDA 3T29A 3PRDA 5ESTE 4NIXA 2HVYB 4JYVH 3U8TH 1TMUH 1GMCG 1P3CA 2ZWLH 3MU0A 2EC9H 2Y82A 2NWNA 5EQQA 1KXFA 1RZ1A 3KQ5A 1QB9A 1THRH 4I7YH 1AU8A 5AF9H 1FY1A 2J38A 2IABA 1O2MA 2BB4A 1EJMA 1TWXB 2TGTA 5TCAA 1SGFG 4K3JA 1ZJKA 3WWBA 1TA2A 1W3PA 2A45B 4H42U 4Z85A 1O3PB 1XUGA 1W0YH 1BQYA 2G8TA 2SNWA 1C5SA 1XUHA 1S6LA 1D4PB 1L0ZA 1NESE 5C67A 1UVPA 2GD4B 3LGUA 1BA8B 2BHGA 1GI8B 2WPKS 1AZ8A 1Y3WA 3FAOA 1OSSA 2WV5A 1C1RA 4IRAA 1WUNH 2ZHWH 1BOQA 1P2OA 3SBKA 5JABA 3C27B 1TONA 3RXVA 4AN7A 1DUAA 1YPEH 4XE4A 1QFKH 1UHBB 4A92A 3R5YA 5LPEA 3GASA 2FI5E 2A5AA 2WPMS 4CHAB 2XBXA 3EGKH 1LDTT 1VGCB 2A1DB 1YKTA 2FTMA 5CHBA 2A32A 2J34A 4X6MA 1FN8A 1HAVB 1O3MA 2PKAB 3QTOH 2AIPA 1Z8IB 3DNHA 1MAYA 3VXEH 1AB9C 4HI3A 4FUJA 2BD8A 3AAUA 1GI3A 1T8LA 4BTIB 3MU1A 1LO6A 2RA3A 4DGJA 3RXCA 1O3OA 1GJCB 2PGQB 1GMHF 1MKWH 1FY4A 3ZZDA 1NRQH 1ZTLA 4Y8ZA 1RIWC 3HY8A 2ULLA 3UIRA 3RXHA 1S81A 2FOEA 3T28A 3KQDA 2HLCA 1F92A 2J9NA 4FUIA 1CHGA 5KECA 1JWTA 2PFEA 4ISHH 3BTME 1LVYA 3ZYDA 4KP0A 4ABFA 5AHGH 3IN6A 1THPB 1PYTD 1ELVA 2FM2A 1F7ZA 3K6YA 2Z9GA 1QIXB 3MNXA 1TABE 3SZNA 1MUEB 2V7QD 5GXPA 2VU8E 1WDIA 1AVWA 1YWUA 1Q31A 3ZZBA 4IW4E 3BTTE 3SNBA 4DOQA 1HRTH 5L30H 1C5RA 2PHBA 1D6WA 4AZ2B 4H6SB 3SNAA 1BB0B 2Z3DA 5ESCA 1TX8A 3QN7A 3QZQA 4LK4A 3SYJA 1JMOH 3TJVA 3VFEA 3GCHC 1FX0B 2PSXA 3M7UA 3DB0A 2EI7A 4NFFA 1GBJA 3H5CB 3GY7A 1NRNH 3M7TA 3RXFA 3ENSB 1SQAA 3HPTB 4WMDA 8LPRA 2ZGJA 1TE0A 2FEQH 2QN5T 1EAUA 5A8XA 1SVPA 3DFLA 3BG8A 1P2KA 1AB9B 2BVSH 2SGFE 4ISNA 1W0JD 2BOHB 3RC5A 1GDQA 1BRUP 4YLQH 2UUKB 4AB8A 4IMZA 3BEFB 2IMLA 1SMFE 2ZNKH 2VIPA 4NA9H 3E91A 4HMSA 2ZDNA 4U32A 3SJOA 3BA3A 1C5QA 1EJNA 1DOJA 2HPPH 4XBDA 1AFQC 2F4LA 2L74A 4CRDA 4UHVA 1BBRE 3EYDA 4CBOA 5DP6A 2Z6BD 2VB0A 1AUTC 3TGKE 1FMGA 1GL0E 3O8RA 4Z6AH 2CK3D 4NZLA 2OUAA 5LPRA 5CHOA 3F0PA 4ZH8A 2X1KA 1KLIH 3A8CA 3SU0A 5HMAA 1Z7KA 4Y8YA 2FDAA 3HKJB 3F9GA 1HLTH 1TPPA 2R3YA 1IQFA 1XXDA 1VKYA 1EPTC 3Q3KA 1T8OA 2ZU5A 2R0LA 3A8BA 3KQEA 2J98A 3FKSD 2IJOB 3EAJA 2BD2A 1CT4E 1H9LB 4ISIH 1NBMD 3K65B 2Z94A 1TRYA 3SNEA 2Q6GA 1W12U 1C9PA 1K1NA 5FBEA 1TNKA 1O2XA 3K88A 4TV4A 1Z8JB 1DT2A 2AHME 1C1PA 4NSVA 2A2JA 3GISB 3O8DA 1HGTH 4GVUA 1NU9A 8GCHG 1IQMA 1J16A 3QDZB 1LPZB 1F0TA 4I8JA 1ZMLA 1VJAU 1HAXB 5A0CA 1NROH 1Q3XA 3FANA 1J15A 2B8OH 1OHHD 2L6OA 3UNRA 2AMQA 3ZZ9A 1CHOG 4XJ2A 1NO9H 1MQ5A 3ATIA 1MD8A 1DM4B 1AFQB 2ZFQH 3UB0A 2R2WU 3HGNA 1EAXA 1O2VA 1TX6A 1V6DA 4Q4LA 1GBMA 8KME2 2FG9A 3PFTA 3ZZ3A 1YF4A 3W94A 1G30B 4JZFH 4QVBA 2D37A 3STIA 1SLVB 2QCKA 1IQEA 1O2NA 1ZR0A 2KCAA 4ISOA 3VY2A 2HNTC 5CHAC 4KELA 3ZV8A 2C8WB 2ZDMA 1W7GH 2X1JA 1G77A 1H1BA 1QA7A 3ATWA 2ZZUH 4Z0KA 2L1TA 2Q6FA 3GYMA 1YY3A 3PLBA 2OC8A 5DGJA 3SQEE 1SGDE 3K6ZA 3MNBA 3OEED 4ABGA 3U28C 1RS0A 1EPTB 2SNVA 1XKBC 3MHWU 1SOZA 3BNKA 1GG6B 2TGDA 1QY6A 3P6ZB 2PV9B 3M35A 2F9UA 2ANMH 3F2FA 3RU4D 1CQQA 3FVFB 1DXPA 4BAOB 1FNIA 1ZYOA 3K86A 3FFGA 1QZ8A 4NA8A 4AYVB 2OP9A 4I8HA 3MNSA 1A4WH 1O3EA 1TQ7B 4JMYA 3ITIA 3SV9A 2FYRA 2KAIB 2ZHQH 3L3TA 1SKYE 2BLWA 4X2YA 3NKKA 3D62A 2XCNA 3RXDA 3GY5A 1GMDF 1K9OE 2GDDA 3KNXA 4X8TH 3RDZA 1GJ7B 1C2HA 2FLRH 4JZEH 4ZHLU 4YZUA 2P94A 5EXNA 2ZU2A 1BTHH 3VB3A 3OE7D 4ZKRU 2P95A 1P8VC 4GCHF 4QT8C 1H9IE 2HTIA 4FVDA 4MNYA 3FZDA 2Y6TA 1C2DA 1S83A 4K8BA 2EQNA 1KDQB 4YT7H 5AVDA 3EE0B 5K0HA 3U35A 2RCEA 3ESTA 1GHVH 1V2UT 1BTWA 4FXGH 3RH7A 3R5ZA 2ZDLA 5CHAB 2O8WA 2EA3A 1K2I1 4L82A 4E06H 4MPXA 3VGCC 1YGCH 1ETRH 1L4ZA 2WV4A 4FUBA 4ZUHA 1IQJA 1TRMA 3BIUH 4O03A 3S9CA 5EPYA 2NU0E 2BD5A 4J1YA 5EODA 3Q3XA 5G4BA 3ZV9A 1KY9A 4THNH 1SG8B 1TGBA 6ESTA 1JBUH 4GHQA 1B0EA 2GZ9A 2ZFPH 2ZQ2A 1MTVA 2RFKC 1OX1A 4X1PU 1PYTC 4OS7A 4KTCA 2V35A 3JZ1B 2Y81A 3F9FA 3MWIU 2XWAA 1BJUA 5DP8A 1ZPBA 3FGEA 1WSSH 1RTLA 2PWXA 3ZVDA 2BDIA 1MKXH 4P02A 1EAIA 2FOCA 5FBIA 2NU1E 1PPBH 1A1RA 2RE7A 1O2JA 1C5NH 2C8ZB 4TWWA 3EQ0H 5C94A 3C1KA 3WY8A 1JIRA 2SGAA 5GCHG 1MZDA 1CSOE 4TPYA 4TY6A 8GCHF 4MG3A 1ANBA 4NFEA 4UFGH 5DPAA 1A5IA 1BUIA 1O3KA 2SGPE 1T4UH 5DP5A 1GI0A 2ED4A 2VWMA 3SI3H 1TNGA 3KHVA 1KXDA 1C5YB 2OD3B 1FJSA 3M37A 2UWOA 3TK6A 3LT3A 1PPCE 2WUBA 1HJAC 4E7RG 3TH2H 1VCWA 1F2SE 1UTJA 1WTHD 4WY3A 3MO3A 2CF9H 3LOXA 4RN6A 5EQRA 2HNTF 3VGCB 3BEIB 4NIVA 4BXSA 1VITH 1EQ9A 1QB1A 1TMTH 3HATH 1BJVA 1SGFA 1C5LH 2GMTC 1TNIA 1DUEA 2FPZA 2ZF0H 1NFXA 3PWCA 2EEKA 4BAHB 2QEAA 1YLCA 3OY5U 2H9TH 1EATA 1L1JA 1CVWH 3A84A 1A46H 1RJXB 2VWNA 1TOCB 1NRSH 1T32A 2HHZA 1C1NA 1YPHE 2ZCLP 1Q2WA 1YCPK 3ZOFA 1IQKA 4YOGA 2ODQA 1C1TA 3LDXH 1L1GA 2F91A 2AS9A 2BQWB 4YOJA 1CI0A 4TY7A 3IG6B 2C8YB 3V0XA 5BPEA 5LH8A 4VGCB 3ZZ4A 3UR9A 1HJ8A 3E3TA 1Z1IA 4FUFA 3MO9A 1C2IA 4WWYA 2VVVA 1CGJE 2BD3A 1G36A 1LHCH 3SNDA 1T4VH 1S5SA 1GI2A 1NC6A 1SB1H 3MTYA 1SHYA 1P2IA 3LGVA 1A0JA 2ZDAH 3FKHA 5EXLA 1C5UA 1O3DA 2J97A 1P2QA 1HXEH 3EA7A 5F8ZA 6CHAB 2AIQA 3IWMA 2YMSD 2P16A 3NUMA 2SGQE 1UMAH 4KTSA 1HJAB 3LJJA 1ETTH 1MU8B 1OS8A 1HAYB 2OXSA 5EPNA 2QXJA 1SGQE 3H96A 4MPUA 1C2MA 1MBQA 1ZGVA 5GPIB 1HIAA 3ZVCA 3B8JA 2I51A 4ZKOU 5E0JA 2XW9A 3RXPA 2VIVA 3SHAH 4JZDH 2P3TB 5JYIA 2GX4A 3A7XA 1GMHG 1O2IA 2IJD1 3SU2A 1TRNA 1BDAA 3RXLA 2VGCC 1JNWA 3LONA 4ZXYH 3NWUA 1HV7A 1Z1JA 1ESTA 3OAAD 2VIOA 1ZHPA 2OL5A 1O37A 4SGBE 3BPKA 1TALA 1HAPH 1P09A 1OWIA 3A81A 3V13A 1BTYA 1PPGE 4FUCA 1C4U2 5T6DA 2CN0H 3BTEE 4F48B 1OPHB 3WW7A 1ZPZA 2ZP0H 1XVMA 2Q6DA 1H8HD 3TVJB 4AGJA 1C2KA 1P02A 2J94A 3PO1B 1QBOA 4RKJB 3RXJA 1JRSA 1FY8E 4K1EA 5HM9A 5IK2D 2FOMB 4Y10E 3LGTA 5DP3A 1LHDH 1K28D 2XBWA 2R2MB 1CA8B 2ZQ1A 1ZMJA 1QRWA 1QBVH 3RMOH 1IQNA 2VH0A 2ZIQH 1SQTA 4LZ1H 1H4WA 1AD8H 1MZAA 3A6RA 2FP7B 2PSYA 3UTUH 2B5TB 5AFZH 3SN8A 2LPRA 1T7CA 3F3BA 4JCNA 1AN1E 6LPRA 3OY6U 3O8BA 4O3UA 3SNCA 3NK8A 4YOIA 2BXUH 1LPKB 2BVRH 2XOKD 4AFQA 5F53A 4ASHA 1GJ6A 1IQIA 1GBBA 3U1IB 1GVZA 1FN6A 2YOLA 1D3TB 4X8VH 2D26C 1WQSA 1IHSH 2F9VA 2QXIA 1WBGB 1A61H 2H2ZA 4R8TB 1Z6JH 1MCVA 5E2PA 1AIXH 4D7GA 1YBWA 1GI7B 1E36B 1V2TT 1EASA 1ZSKA 1L4DA 3LJOA 2VGCB 5EW1H 1Y5UT 1A3BH 2A0QB 2WUCA 1O5FH 2DE8A 2Y7XA 4DJZB 1F0SA 1B5GH 2NR4A 1SGTA 1XM1A 1P57B 2AGIX 1ETSH 3GDSA 1CGHA 3ATLA 5GWZA 3P8NA 1GJAB 2ZU1A 3FN8A 2F3CE 1FONA 4ACBA 6GCHF 5DP7A 2ZFFH 4DG4A 3RLYH 5ETXA 5A8ZA 3OFND 5H4IB 1W7XH 4BAKB 1WLKA 1ZPCA 5F03A 1AZZA 2K4QA 5DO4H 2W6JD 4DURA 3FP8E 3M5OA 5AFYH 4O9VA 3V3MA 1CO7E 2KCPA 3BF6H 3T2NA 3TNTA 1F5KU 3EA8A 1LVOA 2AH4X 5TJXA 1IQLA 1P04A 3MYWA 1GI5A 4FOUC 1O2UA 3S7HB 2IN2A 2HVXA 3SJKA 2A4GA 2VWLA 3D49H 1O2RA 1BRAA 4UE7H 1AHTH 1ESAA 2K0QA 1Y3VA 2QA9E 5JDUB 1CE5A 1M9UA 4ABJA 4CRFA 1KXEA 1UTMA 3AK5A 1DSUA 4GUXA 1SGNE 5KEDA 1BMMH 3M3TA 2QXGA 2ZGHA 2WV9A 1EZXC 3N7DA 4TYDA 2JETB 2CF8H 1SQOA 1E0FD 2JH0D 8ESTE 3CS7A 3GCTF 4ZKYA 4YLUA 2WPIS 2TPIZ 2H1UA 5DN6D 1ZOMA 2OLGA 3ZZAA 3PV4A 1ELDE 1S6FA 2WSSD 1CA0B 2LP6A 1O2LA 4MQAA 1TIOA 7KMEH 4GLYA 2I6SA 3P8GA 1TPSA 1O38A 5A0BA 1UK2A 3ZZCA 1C5WB 4NWLA 1O2OA 4X6NA 4OS1A 1RXPA 2FI3E 3QX5H 3N7OA 1NZQH 1NBME 1O5EH 1AVXA 1GBDA 1JOUB 4RKOB 2BDAA 1SQRA 2ANWA 2HALA 3ZOHA 2V0BA 2Z3EA 4A6LA 2R0XA 2JH5D 3F0OA 4NG9H 1VCQA 1ZGIA 1GCDA 1V2QT 3E0NB 1AKSA 3CS0A 4D9RA 4DT4A 3LU9B 3ODDA 1WXRA 1QGFA 1ELBA 4UEHH 3GS9A 4HGCA 4UONA 2FWWA 1Y59T 2ZPSA 3ZZ8A 2AMDA 3UFAA 4I8LA 3SU4A 2Z9KA 1OXGA 2AYWA 1N1LA 4U01A 1K21H 2C8XB 2PTCE 1MTUA 1TBRH 3GY2A 1F5RA 4MPVA 4ASUD 4BOHA 1CT0E 3F9HA 2XXLA 3KQCA 4YBNA 1GMDG 2FODA 3FO8D 5DP4A 1ZSLA 1ZTKA 3RU4T 1RZ0A 1AI8H 1P2MA 4IC6A 5ESBA 4HFPB 1XVOA 4UFEH 2BYAX 1EP6A 1GJDB 4X1NU 3UAIC 1P3EA 3TJUA 4AC9A 1CT2E 2BVXH 4MTBA 4GCHG 3MU5A 1KMHB 4MNVA 1C1OA 2YMSC 1E38B 3BTDE 1RTKA 1TPOA 4D76A 2SFAA 2NU2E 3NZIA 4AFSA 1DPOA 1RIWB 3MU4A 2VH6A 2W7UA 3RU4E 1OYTH 4CH8B 4JK6A 3URDA 2FXRA 4OS4A 3EDXB 1BTUA 3U98H 1BBRK 3VPKA 3A7TA 3GY8A 5C3NA 4BAQB 3F2HA 5HYOA 1GI4A 4I8GA 3RXQA 3W1EA 2F83A 5CHEC 1O34A 1T31A 4I32A 1C1UH 3N99A 2NU4E 1I0SA 1B0FA 1ANCA 1GCTC 5FX6A 1TYNA 3F68H 3ZZ6A 2I6QA 2B7DH 2UWPA 5JBBS 1O3CA 2HOBA 3MH7A 1J14A 1ZMNA 1UCYH 1GDNA 2TIOA 2A7JA 1O2YA 3KCGH 2PW8H 3GCHB 3TGJE 3DSOA 1ANDA 2QF4A 2ZCHP 4AX9H 3T5FH 4BXWA 1C2GA 3RXUA 2A5KA 3HK6B 4INKA 1O2TA 1TGCA 1AE5A 1G3EA 4FU7A 3ELAH 4HTCH 2JIZD 1ZHRA 1RFNA 4Q7XA 5FPYA 4X1SU 4B2AA 3PROA 1C5TA 4I86A 2P5ZX 1OWHA 2YMSB 1DXWA 3Q3YA 1O33A 1K1JA 3E8LA 4AFZA 3T26A 5FCKA 2VIQA 7GCHF 3PMBB 1CGIE 3PLPA 3VB7A 3S9BA 1RRKA 1UO6A 2ZGCA 3N7EA 2BDBA 1Y3YA 2FESH 1V2RT 3UWIA 5J4QA 3PV2A 2K1QA 1UTOA 2BZAA 3KYFA 5E0GA 1S6HA 2C3SA 4CBNA 1AQ7A 5EJLA 5EIYA 2HPQH 5L2YH 3S9AA 1O3AA 1A0HB 1W3OA 3LGYA 2BLOA 4I8KA 4XOJA 4CR9A 4HG6A 1YCPH 1S82A 4ZKNU 2ASFA 1H8IH 2WYGA 4FUEA 1O2HA 3EAAA 2K8IA 1LVBA 4HMVA 3GYLB 2F9BH 3VG8A 1O2SA 2JKHA 4YTAA 1ELCA 1N8OC 1TNLA 3LPRA 1MU6B 3G01A 2Z9LA 3OX7U 4M9FA 1FDPA 1GHWH 3T27A 2BDCA 1YPGH 3SWJA 1YC0A 3QTVH 1O3FA 1SOTA 4Q7YA 1YPMH 4RI0A 5BRRE 1WTGH 4Y0YE 3AMFA 2HRVA 2BLVA 2PKSC 1QJ6B 4HX6A 1Z71A 2XWBI 2ASUB 3HE1A 4B76A 1HJ9A 1GBLA 1O5BB 1J9CH 1MKWK 1AMHA 1GBCA 1HAZB 4LOYH 5T6GA 4WF8A 1SFIA 4OS6A 2CGAA 3NPSA 1BTXA 3M61U 3TPIZ 2H9HA 3ZZ5A 1SLWB 2QIQA 1GBEA 4J2YB 2VWOA 1LMWB 5EGMA 4HMUA 3SO3A 2ZTYA 3PB1E 1WAYB 4PROA 3HKIB 1GJ5H 1YM0A 4WH8A 4ZCNA 2OQUA 4B2CA 2BLQA 2LNCA 3F2GA 2ZHEH 3A7ZA 2ZU4A 3TH3H 1ARCA 2UUJB 3VXFH 2HTDA 5FHTA 4F4OC 3V12A 2FZZA 5F8TA 3SV2H 1DY8A 1O36A 1GHYH 3HGPA 4IS5A 4RSPA 3SUFA 5CE1A 4INHA 4CRGA 1C5MD 3SZEA 4ABDA 4E7NA 5EJ1A 1SL3A 1ESBA 2OBOA 2BY8X 2W26A 1OP8A 2W6ID 4DIHH 2ZFTA 1L1NA 2AMPA 2EY4C 3PRBA 3PYHA 3LH1A 3QZRA 1UW7A 3A6QA 1O35A 2AGEX 1FPHH 2BXTH 3SV7A 2VNTA 2ZTZA 2OK5A 4B6EA 3MFJA 1DY9A 3R5WA 1N8OB 3U8RH 2P59A 2UWLA 4FETA 1USFA 3PMHB 4O3TA 4D8NA 1BMAA 3NXPA 2RA0A 3SUEA 3WWFA 4AORA 1SR5C 1ZZZA 4AB9A 4MLFB 4F07A 1FAXA 2VIWA 1NY22 1S0QA 1AWHB 4WH6A 3RXIA 5C1XA 1K1OA 1USCA 1G37A 1SFQB 3V7TA 2PP6A 2WHXA 2B9LA 1UHBA 4BTUB 1X7AC 2BMGB 2G51A 2BDGA 4ZHAA 3SGQE 3SV8A 1QJ1B 1C5VA 2GUJA 3A88A 1EJEA 1UJ1A 2WPLS 1NRGA 1INCA 1HAVA 2PKAA 2ZECA 4BNRA 1GPZA 2HQ7A 4TPIZ 5DK1A 3TJOA 2GZ7A 1O3JA 2ZC9H 2PTFA 2V6NA 1T8MA 1TGNA 1UTQA 3EA9A 3OYPA 1DFPA 3U69H 3QGNB 2O8UA 1GVKB 1YCPM 1O32A 2XBVA 1XUIA 2ZKSA 3UOUA 3RC6A 2OU5A 2PR3A 2Q9KA 4Y76A 1C1WH 1EUFA 5F6MA 1WOFA 1PQ8A 1AUJA 2P93A 5I46H 3F1SB 2LELA 1UCYE 5A2MH 1NRRH 1V2VT 1HCGA 2A4OA 2IOTA 1DWDH 5C2ZA 1VITG 4E05H 2O8LA 3BTGE 4ZXXH 5EQSA 2WPJS 2A5IA 3SQHE 1UTNA 1SI5H 3ATKA 4INLA 1LQDB 3A8AA 6GCHG 5EOKA 2PTNA 1AY6H 2ODPA 1E35B 4A1TA 3A7VA 1GBTA 4I31A 4YT6H 1QHRB 2PUXB 1LHGH 1QJ7B 1PPZA 3A82A 2BX3A 3QUMP 4NIWA 1FV9A 4WXVA 2OC7A 1SGIB 5FPSA 4KKDA 1XUKA 1IQHA 3GY4A 4O97A 4LXBH 1Y8TA 4X1RU 1DICA 1P9SA 4GHTA 1G2LA 3BTQE 2QXHA 1C5PA 3UNQA 3OTPA 3HMZA 1YP9A 4OS5A 2AFQB 1VJ9U 2ZI2H 5F8XA 4Q63A 1P05A 1HXFH 4XHYA 3L6PA 2G00A 1SHHB 1P01A 2HNTE 1W8BH 1BMLA 1GBAA 2QF5A 5EG4A 1MCTA 4ABEA 2OINA 5PTPA 3VEQB 1GJ4H 2F43B 3AVZA 2A7CA 3DMBA 2STAE 3MNCA 2C93B 2ANKH 5BNCA 2A4RA 3GCTG 1HYLA 1MQ6A 3SJIA
chains in the Genus database with same CATH topology
2OL5A 4YWNA 1YOAA 2ASFA 4HMXA 3BPKA 2I02A 1VL7A 3DNHA 4RT0A 3K86A 5CHOA 4HMVA 3ZODA 1I0RA 1EJEA 1NRGA 2X1KA 5KEDA 4F48B 2HQ7A 3R5RA 3SWJA 4N7RC 2D38A 2IG6A 2HQ9A 4XRNA 2PTFA 3K87A 2FHQA 3AMFA 3HY8A 4ZKYA 4HX6A 2FURA 1AXJA 2QEAA 1W3QA 5KECA 3CNRA 1WLIA 3U5WA 2OU5A 3ZOEA 4P00A 2Q9KA 2HTIA 4R82A 2ECRA 2AQ6A 3IN6A 5CHEC 5KGOA 3R5LA 4Y9IA 1G76A 1FLMA 3A6RA 4HMWA 3U35A 1W3RA 3K88A 1I0SA 2D36A 3ZOGA 2HHZA 2A2JA 2RDEA 3ZOFA 3E4VA 3RH7A 4HMUA 3R5ZA 1WGBA 1YWUA 1G78A 4L82A 1CI0A 1RZ1A 2GJGA 2HTDA 2ECUA 2D5MA 3F7EA 5ESCA 3ZOHA 2IABA 1XXOA 3NFWA 1RFEA 1YLNA 3KYGA 4XJ2A 3R5PA 5EJ1A 2R0XA 3DB0A 3DSGA 1W3PA 3AWHA 4Z85A 3FKHA 4RT1A 2FG9A 3PFTA 2R6VA 1TY9A 1DNLA 2D37A 4QVBA 2NR4A 4HMTA 1G79A 2QCKA 3TGVA 3A6QA 3VY2A 4I86A 2ARZA 3HMZA 1XHNA 3FGEA 3EC6A 3R5WA 5EJZA 1USFA 2X1JA 1G77A 3VYAA 4P02A 4IRAA 3H96A 4XHYA 1WV4A 1WLKA 3U34A 3B5MA 2RE7A 4F07A 3A20A 3ZOCA 2I51A 2IMLA 1T9MA 3CP3A 5JABA 2E83A 4HMSA 1USCA 3KYFA 3DMBA 3R5YA 3GASA 3BNKA 3BA3A 4YBNA 4HG6A 5EJLA 5BNCA 5EIYA 1W9AA 2L74A 1RZ0A 1W3OA 1JNWA 4FOUC 3CB0A 2VPAA 1Y30A 3U0IA 3VY5A 2ED4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OL5 A;  4YWN A;  1YOA A;  2ASF A;  4HMX A;  3BPK A;  2I02 A;  1VL7 A;  3DNH A;  4RT0 A;  3K86 A;  5CHO A;  4HMV A;  3ZOD A;  1I0R A;  1EJE A;  1NRG A;  2X1K A;  5KED A;  4F48 B;  2HQ7 A;  3R5R A;  3SWJ A;  4N7R C;  2D38 A;  2IG6 A;  2HQ9 A;  4XRN A;  2PTF A;  3K87 A;  2FHQ A;  3AMF A;  3HY8 A;  4ZKY A;  4HX6 A;  2FUR A;  1AXJ A;  2QEA A;  1W3Q A;  5KEC A;  3CNR A;  1WLI A;  3U5W A;  2OU5 A;  3ZOE A;  4P00 A;  2Q9K A;  2HTI A;  4R82 A;  2ECR A;  2AQ6 A;  3IN6 A;  5CHE C;  5KGO A;  3R5L A;  4Y9I A;  1G76 A;  1FLM A;  3A6R A;  4HMW A;  3U35 A;  1W3R A;  3K88 A;  1I0S A;  2D36 A;  3ZOG A;  2HHZ A;  2A2J A;  2RDE A;  3ZOF A;  3E4V A;  3RH7 A;  4HMU A;  3R5Z A;  1WGB A;  1YWU A;  1G78 A;  4L82 A;  1CI0 A;  1RZ1 A;  2GJG A;  2HTD A;  2ECU A;  2D5M A;  3F7E A;  5ESC A;  3ZOH A;  2IAB A;  1XXO A;  3NFW A;  1RFE A;  1YLN A;  3KYG A;  4XJ2 A;  3R5P A;  5EJ1 A;  2R0X A;  3DB0 A;  3DSG A;  1W3P A;  3AWH A;  4Z85 A;  3FKH A;  4RT1 A;  2FG9 A;  3PFT A;  2R6V A;  1TY9 A;  1DNL A;  2D37 A;  4QVB A;  2NR4 A;  4HMT A;  1G79 A;  2QCK A;  3TGV A;  3A6Q A;  3VY2 A;  4I86 A;  2ARZ A;  3HMZ A;  1XHN A;  3FGE A;  3EC6 A;  3R5W A;  5EJZ A;  1USF A;  2X1J A;  1G77 A;  3VYA A;  4P02 A;  4IRA A;  3H96 A;  4XHY A;  1WV4 A;  1WLK A;  3U34 A;  3B5M A;  2RE7 A;  4F07 A;  3A20 A;  3ZOC A;  2I51 A;  2IML A;  1T9M A;  3CP3 A;  5JAB A;  2E83 A;  4HMS A;  1USC A;  3KYF A;  3DMB A;  3R5Y A;  3GAS A;  3BNK A;  3BA3 A;  4YBN A;  4HG6 A;  5EJL A;  5BNC A;  5EIY A;  1W9A A;  2L74 A;  1RZ0 A;  1W3O A;  1JNW A;  4FOU C;  3CB0 A;  2VPA A;  1Y30 A;  3U0I A;  3VY5 A;  2ED4 A; 
#chains in the Genus database with same CATH topology
 1BZX E;  3BIV H;  3M5L A;  4FU9 A;  1OP2 A;  2THF B;  5HGG A;  3DA9 B;  1V2N T;  3P70 B;  1O3I A;  1FI8 A;  1RTF B;  3M3S A;  4MNW A;  2F9O A;  1MMJ N;  3DT0 H;  5EW2 H;  3FZZ A;  2FOB A;  1UVT H;  2J98 B;  4X1Q U;  2IG6 A;  2GMT B;  2W7S A;  1ZSJ A;  1GBK A;  2FHQ A;  1GJB B;  1O2G H;  4Y8X A;  1TFX A;  4I33 A;  4DY7 B;  1AO5 A;  3PV5 A;  1AXJ A;  1FAK H;  2QAA A;  1W14 U;  1Y3X A;  1PPF E;  3TNS A;  1W3Q A;  1QRX A;  2ZGX H;  1UK3 A;  3AW1 A;  4R82 A;  1VR1 H;  2V3M A;  4OM9 A;  2ZDV H;  1JRT A;  1O5C B;  1P03 A;  2R0K A;  1GI6 A;  2J2U A;  1W13 U;  1DX5 M;  4FUH A;  1FUJ A;  1WV7 H;  3DUX H;  3LGI A;  1QL7 A;  3UQV A;  1P0S H;  1O5D H;  1TPA E;  5FXL A;  3M36 A;  1MH0 A;  1WGB A;  2BD7 A;  1EZU C;  2ANY A;  1G9I E;  3A7Y A;  4ACA A;  3URC A;  2EST E;  2W3K A;  1S0R A;  2FS8 A;  4FVB A;  1OP0 A;  2GJG A;  1EOJ A;  1BIT A;  5FPT A;  3MQK C;  2ZPQ A;  1F0R A;  3H09 A;  3P92 A;  2PGB B;  2JJ2 D;  1EB1 H;  4Y7B A;  2BM2 A;  2IPH A;  2O8M A;  1O5A B;  1TNH A;  3NFW A;  3A83 A;  1GL1 A;  4AOQ A;  1YLN A;  1C9T A;  1VCP A;  4SGA E;  2DE9 A;  3DSG A;  3GIC B;  1C2F A;  1K1P A;  1C5X B;  2Y80 A;  4X8S H;  3TJN A;  2H6M A;  3A86 A;  4Y6D A;  2Z9I A;  4FUD A;  4A1X A;  1DNL A;  1KIG H;  3SUG A;  4F55 A;  3U1J B;  3UPE A;  2DUC A;  2D2D A;  3S7K B;  2ARZ A;  1P2J A;  4K60 A;  5J4S A;  3MO6 A;  5GJ4 B;  5IDK A;  3DSP A;  5B6L A;  4YXW D;  2R3U A;  4AFU A;  1K1M A;  2Y5F A;  3SU3 A;  4ZKS U;  4ABH A;  5CMX H;  2ILN A;  1V2K T;  3GDV A;  1HAI H;  2ZFS A;  1BBR H;  3PLK A;  3RXK A;  2GCH F;  1A3E H;  4DCD A;  7LPR A;  4X2W A;  1C5O H;  3LGW A;  1EXF A;  3P17 H;  3T25 A;  2STB E;  1VIT F;  4GSO A;  2A31 A;  2GVF A;  3RM2 H;  1KTT B;  2EI8 A;  2GP9 B;  1BTP A;  4X6O A;  2KX4 A;  3B9F H;  1C4V 2;  1IHT H;  2ODY B;  3U0I A;  1EPT A;  1HB0 B;  4B75 A;  3A87 A;  2V3H H;  4HMX A;  1VGC C;  1ZRK A;  1VL7 A;  1O3L A;  1QR3 E;  4X8U H;  2A2X H;  2BQ6 B;  5LPF A;  1XKA C;  4TSF D;  4U30 A;  1O2Q A;  1IOE A;  1H8D H;  3BSQ A;  4YO9 A;  2RG3 A;  3UOP A;  3ZVG A;  4B74 A;  3K9X B;  2H9E H;  4XSK U;  4AG1 A;  3SJ8 A;  3AAV A;  3TLO A;  1WCZ A;  1LVM A;  3D23 A;  5DP9 A;  1UVO A;  1V2W T;  3E6P H;  2KAI A;  3ZVF A;  2PLX A;  1GHB F;  3CNR A;  4KGA A;  3LIW A;  3ZOE A;  3DCL A;  3CP7 A;  2OQ5 A;  2P8O C;  4M7G A;  5HIZ A;  4K2Y A;  2FMJ A;  1VZQ H;  3P95 A;  3ZOG A;  1NTP A;  2ALP A;  4MPW A;  1C1M A;  4UDW H;  2ZFR H;  2FI4 E;  4CH2 B;  1KDQ A;  1C1Q A;  1SSX A;  2BTC E;  4D9Q A;  1G32 B;  3I29 A;  3SOS A;  1UTP A;  2ZA5 A;  2TGA A;  5EU8 A;  1TBQ H;  1E1R D;  2J95 A;  4JZI A;  1DE7 H;  4CRA A;  7GCH G;  5ABW A;  3H7O A;  3RXG A;  1SLU B;  1ZTJ A;  4Y71 A;  2Q1J A;  3HK3 B;  4ABI A;  3AWH A;  2R6V A;  4WME A;  1TY9 A;  2F9P A;  4MTK A;  2QV1 A;  4TT3 D;  3DD2 H;  1XUJ A;  2AER H;  1SLX B;  1KSN A;  4X2V A;  3SU5 A;  1NM6 A;  2P3U B;  3PWB A;  4OS2 A;  5C0T A;  1GBH A;  2KFW A;  4IC5 A;  4Y7A A;  1LKA A;  1SGC A;  3A20 A;  2G55 A;  3UUZ A;  5HXF A;  1T9M A;  1KTS B;  1AGJ A;  2E83 A;  3ATM A;  2GKV E;  2QY0 B;  3QWC H;  2KZ4 A;  5C0U A;  4NSY A;  2C4F H;  3BTK E;  3UQO A;  1GBI A;  2A4Q A;  1P10 A;  4AGK A;  1DAN H;  2VPA A;  1SGR E;  4IBL H;  4WVP E;  4ZAE A;  3VY5 A;  1E34 B;  2ZCK P;  2P8O B;  5JPM H;  3BN9 A;  4XD7 D;  1ARB A;  1QBN A;  2RDL A;  1FQ3 A;  3QO6 A;  1A5G H;  4TWY A;  1EOL A;  2OCV B;  3FP6 E;  2VBC A;  2Z3C A;  1UK4 A;  4Q2K A;  1ZLR A;  5SGA E;  1HBT H;  4CRE A;  3VB6 A;  1DIT H;  1D3D B;  1BIO A;  1KYN A;  4FUG A;  4XRN A;  4XBC A;  1JIM A;  1QB6 A;  1W3C A;  2FOA A;  2BDH A;  3AW0 A;  2FOH A;  5FCR A;  1QUR H;  1YPK H;  5GIB A;  1Y5A T;  4Z1M D;  1W0Z U;  4B73 A;  1E37 B;  2GT8 A;  2W3I A;  2FX6 A;  1ELE E;  1L2E A;  1V2S T;  1XMN B;  1Y3U A;  2ZPR A;  3KID U;  2SGD E;  4NIY A;  3RM0 H;  1KXA A;  2AQ6 A;  1DVA H;  3RML H;  1GHZ A;  3SUD A;  3TGI E;  3SI4 H;  3MI4 A;  3FOA A;  2VIN A;  1NN6 A;  1OWD A;  3SJ9 A;  1SBW A;  3TIU A;  2ZEB A;  2RDE A;  1O31 A;  1C4Y 2;  1GHA F;  1K22 H;  5C5N A;  2TBS A;  2G4T A;  2G5N A;  4K1T A;  4YES B;  3SV6 A;  4Y79 A;  1TBZ H;  2M2A A;  4X2X A;  4KTU A;  3TIT A;  2PUQ H;  4A7I B;  3P8F A;  2FLB H;  1PFX C;  1BTZ A;  1TB6 H;  2GV6 A;  2WIN I;  3KQB A;  1EJA A;  1Z8G A;  4NGA H;  4X6P A;  1F0U A;  2HLD D;  5E0H A;  1A0L A;  1GGD C;  3RXS A;  3GY6 A;  2QYI A;  1NFW A;  1BRB E;  2P3F H;  1C1V H;  2ZO3 H;  5FL7 D;  1SGP E;  2D1J A;  1ZHM A;  1P9U A;  3URE A;  1F5L A;  5EXM A;  2KM0 A;  4IMQ A;  2G4U A;  1AE8 H;  4JK5 A;  1QNJ A;  1PPH E;  3GOV B;  1FIZ A;  1QQ4 A;  1GMC F;  3BG4 C;  2J5U A;  1MD7 A;  1DDJ A;  2WYJ A;  2QF0 A;  5C5O A;  4F49 A;  1HIA B;  1SC8 U;  4BAM B;  2A7H A;  3EC6 A;  4GPG A;  5EJZ A;  3RXE A;  2GV7 A;  1C5Z B;  1SPJ A;  3VYA A;  3CEN A;  3OTJ E;  4B6F A;  2XC0 A;  1B7X B;  3T62 A;  1A2C H;  1OWJ A;  3GDU A;  1TMB H;  4HZH A;  3STJ A;  1TX7 A;  4AG2 A;  3F9E A;  1PQA A;  4DT7 B;  4CRB A;  2M5T A;  1DWC H;  3LC5 A;  1W9A A;  3PMJ A;  1GI9 B;  2WZQ A;  1Z8R A;  1GG6 C;  3A80 A;  3B23 B;  5JBT A;  1YOA A;  2XTT B;  3F6U H;  3U8O H;  1V2J T;  4XFQ A;  1NPM A;  2GT7 A;  4D7F A;  5DG6 A;  3ZOD A;  3TK9 A;  1NFY A;  1LKB A;  1TGT A;  3BTH E;  2V3O H;  4BTT B;  1G2M A;  1RGQ A;  2CXV A;  3FP7 E;  1SGE E;  5HIY A;  1V2M T;  1EZQ A;  3RC4 A;  3TU7 H;  3OEH D;  2FYQ A;  2QGR A;  1O3H A;  2D38 A;  1DWB H;  2QE7 D;  1RD3 B;  2VJ1 A;  5HM2 A;  1DWE H;  1BRC E;  1O39 A;  2BY9 X;  1CBW C;  4MVN A;  1GGD B;  1OYQ A;  2FUR A;  1DLE A;  3V4H A;  4HKH A;  3D65 E;  1YYY 1;  3R0F A;  2OC1 A;  5CDF E;  1WLI A;  1YPH C;  3DHK H;  1QL8 A;  3MH6 A;  1EB2 A;  2ECR A;  1PPE E;  1IQG A;  3R5L A;  4Y9I A;  1GCT B;  1EAW A;  1FLM A;  4HMW A;  1O3B A;  1W3R A;  1DLK B;  1HNE E;  2W5E A;  3LH3 A;  4NWK A;  3UY9 A;  3BG4 B;  1K0H A;  1DS2 E;  1P06 A;  2OBQ A;  1GDU A;  1HAG E;  2JH6 D;  4K69 A;  1G78 A;  3E0P B;  1TQ0 B;  4Y11 E;  4AYY B;  1XUF A;  9EST A;  2ZTX A;  1UVU H;  5E8E H;  2SGE E;  2JDI D;  2ECU A;  3A7W A;  3EE7 A;  2UUF B;  1XXO A;  1WQV H;  5A8Y A;  1RFE A;  1HDT H;  1CU1 A;  9LPR A;  1U6Q A;  3I77 A;  3O8C A;  1EFR D;  4ABA A;  1GHX H;  1Y12 A;  2QF3 A;  2AEI H;  1D9I A;  2BD9 A;  1UTL M;  1BHX B;  4WXI A;  4CR5 A;  4Q80 A;  4HMT A;  1N6Y A;  3RP2 A;  1C1S A;  3M5N A;  1ID5 H;  4H6T A;  4EST E;  3MH4 A;  2YNB A;  1G3C A;  2FTL E;  1ACB E;  1JXP A;  1MTS A;  1NU7 B;  4ABB A;  4DW2 U;  3RUO A;  1WV4 A;  2XBY A;  1E79 D;  3ZOC A;  3RMM H;  3NRL A;  3RXA A;  3CP3 A;  1C2L A;  2ZU3 A;  2H5D A;  1CBW B;  2BY5 X;  4XDE A;  1LPG B;  2AGG X;  1LQE A;  4FU8 A;  1ELT A;  2G81 E;  1THS H;  1MAB B;  5DJ7 A;  5T6F A;  1W10 U;  2VVC A;  2OTV A;  1O2Z A;  2C90 B;  2I02 A;  3RMN H;  1D3Q B;  1ELG A;  3A89 A;  3KEE A;  5JB8 S;  1P12 E;  2QC2 A;  2R9P A;  3GY3 A;  1ELA A;  4OGX A;  1LCY A;  4H4F A;  4CRC A;  5TCC A;  1FZZ A;  4N7R C;  3ZVA A;  5C1Y A;  4A5T S;  1SGY E;  2HQ9 A;  1G3B A;  2PKS B;  1PQ5 A;  3TK5 A;  3QLP H;  2ZHF H;  2KCY A;  4DVA U;  2NU3 E;  1OWE A;  3MOC A;  5C17 A;  1PQ7 A;  4OGY A;  1DST A;  1KLT A;  3U5W A;  5HKK D;  3UNS A;  1ZJD A;  2D8W A;  2UUY A;  1D6R A;  3A85 A;  3AAS A;  4IN1 A;  4UFF H;  2XC4 A;  1COW D;  4MNX A;  3S0N A;  1D3P B;  5A0A E;  1G76 A;  3I78 A;  2D36 A;  2IPQ X;  2BX4 A;  4Q7Z A;  5L2Z H;  1AVG H;  3E4V A;  1W2K H;  3GCO A;  1BHX F;  3QK1 A;  2CV3 A;  1AWF H;  4NA7 A;  1O3G A;  1T8N A;  4K8Y A;  2H5C A;  3MMG A;  1S84 A;  3DFJ A;  2VID A;  3ODF A;  3S69 A;  2F9N A;  4GAW A;  1C2J A;  3ZYE A;  1S85 A;  1EZS C;  1LHE H;  1W11 U;  2EI6 A;  2OC0 A;  5DKM A;  2HWL B;  1FXY A;  1MTN C;  3M5M A;  1GI1 A;  1IAU A;  2XND D;  2D5M A;  3F7E A;  4VGC C;  2GCT C;  1G3D A;  3ZVB A;  3RXM A;  2XCF A;  3R5P A;  2GCH G;  1TA6 A;  3KN2 A;  1AKS B;  1UCY K;  1O2P A;  2Y5H A;  1FPC H;  4B1T A;  3BV9 B;  4RT1 A;  3TH4 H;  1O2W A;  2FOF A;  2FIR H;  2TRM A;  1G79 A;  2Z7F E;  2XC5 A;  1MBM A;  3UWJ H;  4MDS A;  4JZ1 A;  1XXF A;  6CHA C;  2BDY A;  1XHN A;  3OSY A;  1ANE A;  3M3V A;  3RXO A;  1KXC A;  4R0I A;  4A1V A;  1OOK B;  1KLJ H;  2WPD D;  1CHO F;  3R3G B;  1V2L T;  1OKX A;  2ZDK A;  1ZRB A;  3PM3 A;  2XNI A;  5L6N H;  1QL9 A;  4K5Z A;  3RLW H;  3M7Q A;  1BCU H;  2CHA C;  2J92 A;  1K1L A;  1FLE E;  3SOR A;  1HUT H;  5C20 A;  3LC3 A;  3SGA E;  3CB0 A;  2GZ8 A;  2BD4 A;  1GHB G;  3BTF E;  3E90 B;  4YWN A;  1AFE H;  3UR6 A;  2GDE H;  1NT1 A;  4XBB A;  2FX4 A;  3RXB A;  4UD9 H;  4RT0 A;  2KR7 A;  3KL6 A;  1I0R A;  2Z9J A;  1PJP A;  3Q76 A;  1QCP A;  1O3N A;  5JB9 S;  4YM9 A;  5DSF A;  2GGV B;  4WMF A;  1FY3 A;  2J4I A;  1TOM H;  3R5R A;  2XYA A;  1J8A A;  2O8T A;  1YPL H;  4ZHM U;  1EX3 A;  3Q00 A;  5I25 A;  4IN2 A;  1MTN B;  1V2O T;  1EKB B;  4B71 A;  2GCT B;  5LGO A;  2BOK A;  3PO1 C;  1BMF D;  1A5H A;  2VVU A;  1MTW A;  3MU8 A;  2QCY A;  4NZQ A;  1WU1 A;  2ZHD A;  4W64 A;  1UTK A;  3KGP A;  1P11 E;  4LZ4 B;  2BY6 X;  1K1I A;  1KXB A;  1XX9 A;  7EST E;  3PMA B;  2BZ6 H;  2O9Q A;  3A8D A;  1GWA A;  1O5G H;  5FAH A;  1P2N A;  2ZG0 H;  2ALV A;  3LKW A;  3OU0 A;  3QGJ A;  3PTB A;  1HAO H;  2G5V A;  3W95 A;  5JBA S;  1V3X A;  1BT7 A;  1GBF A;  3VB5 A;  5C1U A;  1QTF A;  1EP5 A;  1GVL A;  4WJG 2;  5T3H A;  2BQ7 B;  1J17 T;  3U9A H;  3ZVE A;  4X0W U;  3KYG A;  3SW2 B;  2CHA B;  2FOG A;  3E1X B;  3IIT A;  1W0K D;  1C2E A;  1TGS Z;  4B2B A;  1H9H E;  4Y0Z E;  1H8E D;  1FIW A;  1Y5B T;  2FS9 A;  3ZZ7 A;  4NCY A;  4U2W A;  1A7S A;  1O2K A;  3TGV A;  2XRC A;  1Z6E A;  1YLD A;  1E1Q D;  2B0F A;  4ZRO A;  1GJ8 B;  4K1S A;  1QQU A;  1ABJ H;  5IYT A;  1ABI H;  3BEU A;  1TNJ A;  3BTW E;  2ZGB H;  1V2P T;  1GJ9 B;  3U34 A;  1NS3 A;  3SGB E;  3B5M A;  3RXR A;  1O0D H;  2G52 A;  2Y7Z A;  5T1V A;  5B6O A;  1NFU A;  1FY5 A;  1WYK A;  2KCO A;  4ISL A;  2FO9 A;  5E2O A;  3P8O A;  2CMY A;  1LTO A;  1LHF H;  1HAH H;  2CJI A;  2GTB A;  4BAN B;  1YPJ H;  4UFD H;  3VB4 A;  1Y30 A;  5JBC S;  3MH5 A;  4JYT A;  3NCL A;  1QA0 A;  1OWK A;  2HGT H;  1UVS H;  2WPH S;  5A09 A;  1TLD A;  2Y5G A;  5GDS H;  3SU1 A;  3JZ2 B;  1MAX A;  1GHA G;  1NRP H;  3H7T A;  1MKX K;  5GCH F;  2YNA A;  3K87 A;  1ELF A;  4JYU H;  1O30 A;  4ZMA H;  1BMN H;  3ZIA D;  1HPG A;  2JET C;  5GND A;  4DII H;  3KF2 A;  1QRZ A;  2A2Q H;  4CHA C;  4P00 A;  1ORF A;  3K2U A;  2BY7 X;  3Q77 A;  4IGD A;  3L33 A;  3SU6 A;  5K7R A;  5KGO A;  3RXT A;  2JJ1 D;  2TGP Z;  5FX5 A;  1N6X A;  3E16 B;  3GCN A;  3PTN A;  1TAW A;  3SHC H;  1CA0 C;  1HFD A;  3T29 A;  3PRD A;  5EST E;  4NIX A;  2HVY B;  4JYV H;  3U8T H;  1TMU H;  1GMC G;  1P3C A;  2ZWL H;  3MU0 A;  2EC9 H;  2Y82 A;  2NWN A;  5EQQ A;  1KXF A;  1RZ1 A;  3KQ5 A;  1QB9 A;  1THR H;  4I7Y H;  1AU8 A;  5AF9 H;  1FY1 A;  2J38 A;  2IAB A;  1O2M A;  2BB4 A;  1EJM A;  1TWX B;  2TGT A;  5TCA A;  1SGF G;  4K3J A;  1ZJK A;  3WWB A;  1TA2 A;  1W3P A;  2A45 B;  4H42 U;  4Z85 A;  1O3P B;  1XUG A;  1W0Y H;  1BQY A;  2G8T A;  2SNW A;  1C5S A;  1XUH A;  1S6L A;  1D4P B;  1L0Z A;  1NES E;  5C67 A;  1UVP A;  2GD4 B;  3LGU A;  1BA8 B;  2BHG A;  1GI8 B;  2WPK S;  1AZ8 A;  1Y3W A;  3FAO A;  1OSS A;  2WV5 A;  1C1R A;  4IRA A;  1WUN H;  2ZHW H;  1BOQ A;  1P2O A;  3SBK A;  5JAB A;  3C27 B;  1TON A;  3RXV A;  4AN7 A;  1DUA A;  1YPE H;  4XE4 A;  1QFK H;  1UHB B;  4A92 A;  3R5Y A;  5LPE A;  3GAS A;  2FI5 E;  2A5A A;  2WPM S;  4CHA B;  2XBX A;  3EGK H;  1LDT T;  1VGC B;  2A1D B;  1YKT A;  2FTM A;  5CHB A;  2A32 A;  2J34 A;  4X6M A;  1FN8 A;  1HAV B;  1O3M A;  2PKA B;  3QTO H;  2AIP A;  1Z8I B;  3DNH A;  1MAY A;  3VXE H;  1AB9 C;  4HI3 A;  4FUJ A;  2BD8 A;  3AAU A;  1GI3 A;  1T8L A;  4BTI B;  3MU1 A;  1LO6 A;  2RA3 A;  4DGJ A;  3RXC A;  1O3O A;  1GJC B;  2PGQ B;  1GMH F;  1MKW H;  1FY4 A;  3ZZD A;  1NRQ H;  1ZTL A;  4Y8Z A;  1RIW C;  3HY8 A;  2ULL A;  3UIR A;  3RXH A;  1S81 A;  2FOE A;  3T28 A;  3KQD A;  2HLC A;  1F92 A;  2J9N A;  4FUI A;  1CHG A;  5KEC A;  1JWT A;  2PFE A;  4ISH H;  3BTM E;  1LVY A;  3ZYD A;  4KP0 A;  4ABF A;  5AHG H;  3IN6 A;  1THP B;  1PYT D;  1ELV A;  2FM2 A;  1F7Z A;  3K6Y A;  2Z9G A;  1QIX B;  3MNX A;  1TAB E;  3SZN A;  1MUE B;  2V7Q D;  5GXP A;  2VU8 E;  1WDI A;  1AVW A;  1YWU A;  1Q31 A;  3ZZB A;  4IW4 E;  3BTT E;  3SNB A;  4DOQ A;  1HRT H;  5L30 H;  1C5R A;  2PHB A;  1D6W A;  4AZ2 B;  4H6S B;  3SNA A;  1BB0 B;  2Z3D A;  5ESC A;  1TX8 A;  3QN7 A;  3QZQ A;  4LK4 A;  3SYJ A;  1JMO H;  3TJV A;  3VFE A;  3GCH C;  1FX0 B;  2PSX A;  3M7U A;  3DB0 A;  2EI7 A;  4NFF A;  1GBJ A;  3H5C B;  3GY7 A;  1NRN H;  3M7T A;  3RXF A;  3ENS B;  1SQA A;  3HPT B;  4WMD A;  8LPR A;  2ZGJ A;  1TE0 A;  2FEQ H;  2QN5 T;  1EAU A;  5A8X A;  1SVP A;  3DFL A;  3BG8 A;  1P2K A;  1AB9 B;  2BVS H;  2SGF E;  4ISN A;  1W0J D;  2BOH B;  3RC5 A;  1GDQ A;  1BRU P;  4YLQ H;  2UUK B;  4AB8 A;  4IMZ A;  3BEF B;  2IML A;  1SMF E;  2ZNK H;  2VIP A;  4NA9 H;  3E91 A;  4HMS A;  2ZDN A;  4U32 A;  3SJO A;  3BA3 A;  1C5Q A;  1EJN A;  1DOJ A;  2HPP H;  4XBD A;  1AFQ C;  2F4L A;  2L74 A;  4CRD A;  4UHV A;  1BBR E;  3EYD A;  4CBO A;  5DP6 A;  2Z6B D;  2VB0 A;  1AUT C;  3TGK E;  1FMG A;  1GL0 E;  3O8R A;  4Z6A H;  2CK3 D;  4NZL A;  2OUA A;  5LPR A;  5CHO A;  3F0P A;  4ZH8 A;  2X1K A;  1KLI H;  3A8C A;  3SU0 A;  5HMA A;  1Z7K A;  4Y8Y A;  2FDA A;  3HKJ B;  3F9G A;  1HLT H;  1TPP A;  2R3Y A;  1IQF A;  1XXD A;  1VKY A;  1EPT C;  3Q3K A;  1T8O A;  2ZU5 A;  2R0L A;  3A8B A;  3KQE A;  2J98 A;  3FKS D;  2IJO B;  3EAJ A;  2BD2 A;  1CT4 E;  1H9L B;  4ISI H;  1NBM D;  3K65 B;  2Z94 A;  1TRY A;  3SNE A;  2Q6G A;  1W12 U;  1C9P A;  1K1N A;  5FBE A;  1TNK A;  1O2X A;  3K88 A;  4TV4 A;  1Z8J B;  1DT2 A;  2AHM E;  1C1P A;  4NSV A;  2A2J A;  3GIS B;  3O8D A;  1HGT H;  4GVU A;  1NU9 A;  8GCH G;  1IQM A;  1J16 A;  3QDZ B;  1LPZ B;  1F0T A;  4I8J A;  1ZML A;  1VJA U;  1HAX B;  5A0C A;  1NRO H;  1Q3X A;  3FAN A;  1J15 A;  2B8O H;  1OHH D;  2L6O A;  3UNR A;  2AMQ A;  3ZZ9 A;  1CHO G;  4XJ2 A;  1NO9 H;  1MQ5 A;  3ATI A;  1MD8 A;  1DM4 B;  1AFQ B;  2ZFQ H;  3UB0 A;  2R2W U;  3HGN A;  1EAX A;  1O2V A;  1TX6 A;  1V6D A;  4Q4L A;  1GBM A;  8KME 2;  2FG9 A;  3PFT A;  3ZZ3 A;  1YF4 A;  3W94 A;  1G30 B;  4JZF H;  4QVB A;  2D37 A;  3STI A;  1SLV B;  2QCK A;  1IQE A;  1O2N A;  1ZR0 A;  2KCA A;  4ISO A;  3VY2 A;  2HNT C;  5CHA C;  4KEL A;  3ZV8 A;  2C8W B;  2ZDM A;  1W7G H;  2X1J A;  1G77 A;  1H1B A;  1QA7 A;  3ATW A;  2ZZU H;  4Z0K A;  2L1T A;  2Q6F A;  3GYM A;  1YY3 A;  3PLB A;  2OC8 A;  5DGJ A;  3SQE E;  1SGD E;  3K6Z A;  3MNB A;  3OEE D;  4ABG A;  3U28 C;  1RS0 A;  1EPT B;  2SNV A;  1XKB C;  3MHW U;  1SOZ A;  3BNK A;  1GG6 B;  2TGD A;  1QY6 A;  3P6Z B;  2PV9 B;  3M35 A;  2F9U A;  2ANM H;  3F2F A;  3RU4 D;  1CQQ A;  3FVF B;  1DXP A;  4BAO B;  1FNI A;  1ZYO A;  3K86 A;  3FFG A;  1QZ8 A;  4NA8 A;  4AYV B;  2OP9 A;  4I8H A;  3MNS A;  1A4W H;  1O3E A;  1TQ7 B;  4JMY A;  3ITI A;  3SV9 A;  2FYR A;  2KAI B;  2ZHQ H;  3L3T A;  1SKY E;  2BLW A;  4X2Y A;  3NKK A;  3D62 A;  2XCN A;  3RXD A;  3GY5 A;  1GMD F;  1K9O E;  2GDD A;  3KNX A;  4X8T H;  3RDZ A;  1GJ7 B;  1C2H A;  2FLR H;  4JZE H;  4ZHL U;  4YZU A;  2P94 A;  5EXN A;  2ZU2 A;  1BTH H;  3VB3 A;  3OE7 D;  4ZKR U;  2P95 A;  1P8V C;  4GCH F;  4QT8 C;  1H9I E;  2HTI A;  4FVD A;  4MNY A;  3FZD A;  2Y6T A;  1C2D A;  1S83 A;  4K8B A;  2EQN A;  1KDQ B;  4YT7 H;  5AVD A;  3EE0 B;  5K0H A;  3U35 A;  2RCE A;  3EST A;  1GHV H;  1V2U T;  1BTW A;  4FXG H;  3RH7 A;  3R5Z A;  2ZDL A;  5CHA B;  2O8W A;  2EA3 A;  1K2I 1;  4L82 A;  4E06 H;  4MPX A;  3VGC C;  1YGC H;  1ETR H;  1L4Z A;  2WV4 A;  4FUB A;  4ZUH A;  1IQJ A;  1TRM A;  3BIU H;  4O03 A;  3S9C A;  5EPY A;  2NU0 E;  2BD5 A;  4J1Y A;  5EOD A;  3Q3X A;  5G4B A;  3ZV9 A;  1KY9 A;  4THN H;  1SG8 B;  1TGB A;  6EST A;  1JBU H;  4GHQ A;  1B0E A;  2GZ9 A;  2ZFP H;  2ZQ2 A;  1MTV A;  2RFK C;  1OX1 A;  4X1P U;  1PYT C;  4OS7 A;  4KTC A;  2V35 A;  3JZ1 B;  2Y81 A;  3F9F A;  3MWI U;  2XWA A;  1BJU A;  5DP8 A;  1ZPB A;  3FGE A;  1WSS H;  1RTL A;  2PWX A;  3ZVD A;  2BDI A;  1MKX H;  4P02 A;  1EAI A;  2FOC A;  5FBI A;  2NU1 E;  1PPB H;  1A1R A;  2RE7 A;  1O2J A;  1C5N H;  2C8Z B;  4TWW A;  3EQ0 H;  5C94 A;  3C1K A;  3WY8 A;  1JIR A;  2SGA A;  5GCH G;  1MZD A;  1CSO E;  4TPY A;  4TY6 A;  8GCH F;  4MG3 A;  1ANB A;  4NFE A;  4UFG H;  5DPA A;  1A5I A;  1BUI A;  1O3K A;  2SGP E;  1T4U H;  5DP5 A;  1GI0 A;  2ED4 A;  2VWM A;  3SI3 H;  1TNG A;  3KHV A;  1KXD A;  1C5Y B;  2OD3 B;  1FJS A;  3M37 A;  2UWO A;  3TK6 A;  3LT3 A;  1PPC E;  2WUB A;  1HJA C;  4E7R G;  3TH2 H;  1VCW A;  1F2S E;  1UTJ A;  1WTH D;  4WY3 A;  3MO3 A;  2CF9 H;  3LOX A;  4RN6 A;  5EQR A;  2HNT F;  3VGC B;  3BEI B;  4NIV A;  4BXS A;  1VIT H;  1EQ9 A;  1QB1 A;  1TMT H;  3HAT H;  1BJV A;  1SGF A;  1C5L H;  2GMT C;  1TNI A;  1DUE A;  2FPZ A;  2ZF0 H;  1NFX A;  3PWC A;  2EEK A;  4BAH B;  2QEA A;  1YLC A;  3OY5 U;  2H9T H;  1EAT A;  1L1J A;  1CVW H;  3A84 A;  1A46 H;  1RJX B;  2VWN A;  1TOC B;  1NRS H;  1T32 A;  2HHZ A;  1C1N A;  1YPH E;  2ZCL P;  1Q2W A;  1YCP K;  3ZOF A;  1IQK A;  4YOG A;  2ODQ A;  1C1T A;  3LDX H;  1L1G A;  2F91 A;  2AS9 A;  2BQW B;  4YOJ A;  1CI0 A;  4TY7 A;  3IG6 B;  2C8Y B;  3V0X A;  5BPE A;  5LH8 A;  4VGC B;  3ZZ4 A;  3UR9 A;  1HJ8 A;  3E3T A;  1Z1I A;  4FUF A;  3MO9 A;  1C2I A;  4WWY A;  2VVV A;  1CGJ E;  2BD3 A;  1G36 A;  1LHC H;  3SND A;  1T4V H;  1S5S A;  1GI2 A;  1NC6 A;  1SB1 H;  3MTY A;  1SHY A;  1P2I A;  3LGV A;  1A0J A;  2ZDA H;  3FKH A;  5EXL A;  1C5U A;  1O3D A;  2J97 A;  1P2Q A;  1HXE H;  3EA7 A;  5F8Z A;  6CHA B;  2AIQ A;  3IWM A;  2YMS D;  2P16 A;  3NUM A;  2SGQ E;  1UMA H;  4KTS A;  1HJA B;  3LJJ A;  1ETT H;  1MU8 B;  1OS8 A;  1HAY B;  2OXS A;  5EPN A;  2QXJ A;  1SGQ E;  3H96 A;  4MPU A;  1C2M A;  1MBQ A;  1ZGV A;  5GPI B;  1HIA A;  3ZVC A;  3B8J A;  2I51 A;  4ZKO U;  5E0J A;  2XW9 A;  3RXP A;  2VIV A;  3SHA H;  4JZD H;  2P3T B;  5JYI A;  2GX4 A;  3A7X A;  1GMH G;  1O2I A;  2IJD 1;  3SU2 A;  1TRN A;  1BDA A;  3RXL A;  2VGC C;  1JNW A;  3LON A;  4ZXY H;  3NWU A;  1HV7 A;  1Z1J A;  1EST A;  3OAA D;  2VIO A;  1ZHP A;  2OL5 A;  1O37 A;  4SGB E;  3BPK A;  1TAL A;  1HAP H;  1P09 A;  1OWI A;  3A81 A;  3V13 A;  1BTY A;  1PPG E;  4FUC A;  1C4U 2;  5T6D A;  2CN0 H;  3BTE E;  4F48 B;  1OPH B;  3WW7 A;  1ZPZ A;  2ZP0 H;  1XVM A;  2Q6D A;  1H8H D;  3TVJ B;  4AGJ A;  1C2K A;  1P02 A;  2J94 A;  3PO1 B;  1QBO A;  4RKJ B;  3RXJ A;  1JRS A;  1FY8 E;  4K1E A;  5HM9 A;  5IK2 D;  2FOM B;  4Y10 E;  3LGT A;  5DP3 A;  1LHD H;  1K28 D;  2XBW A;  2R2M B;  1CA8 B;  2ZQ1 A;  1ZMJ A;  1QRW A;  1QBV H;  3RMO H;  1IQN A;  2VH0 A;  2ZIQ H;  1SQT A;  4LZ1 H;  1H4W A;  1AD8 H;  1MZA A;  3A6R A;  2FP7 B;  2PSY A;  3UTU H;  2B5T B;  5AFZ H;  3SN8 A;  2LPR A;  1T7C A;  3F3B A;  4JCN A;  1AN1 E;  6LPR A;  3OY6 U;  3O8B A;  4O3U A;  3SNC A;  3NK8 A;  4YOI A;  2BXU H;  1LPK B;  2BVR H;  2XOK D;  4AFQ A;  5F53 A;  4ASH A;  1GJ6 A;  1IQI A;  1GBB A;  3U1I B;  1GVZ A;  1FN6 A;  2YOL A;  1D3T B;  4X8V H;  2D26 C;  1WQS A;  1IHS H;  2F9V A;  2QXI A;  1WBG B;  1A61 H;  2H2Z A;  4R8T B;  1Z6J H;  1MCV A;  5E2P A;  1AIX H;  4D7G A;  1YBW A;  1GI7 B;  1E36 B;  1V2T T;  1EAS A;  1ZSK A;  1L4D A;  3LJO A;  2VGC B;  5EW1 H;  1Y5U T;  1A3B H;  2A0Q B;  2WUC A;  1O5F H;  2DE8 A;  2Y7X A;  4DJZ B;  1F0S A;  1B5G H;  2NR4 A;  1SGT A;  1XM1 A;  1P57 B;  2AGI X;  1ETS H;  3GDS A;  1CGH A;  3ATL A;  5GWZ A;  3P8N A;  1GJA B;  2ZU1 A;  3FN8 A;  2F3C E;  1FON A;  4ACB A;  6GCH F;  5DP7 A;  2ZFF H;  4DG4 A;  3RLY H;  5ETX A;  5A8Z A;  3OFN D;  5H4I B;  1W7X H;  4BAK B;  1WLK A;  1ZPC A;  5F03 A;  1AZZ A;  2K4Q A;  5DO4 H;  2W6J D;  4DUR A;  3FP8 E;  3M5O A;  5AFY H;  4O9V A;  3V3M A;  1CO7 E;  2KCP A;  3BF6 H;  3T2N A;  3TNT A;  1F5K U;  3EA8 A;  1LVO A;  2AH4 X;  5TJX A;  1IQL A;  1P04 A;  3MYW A;  1GI5 A;  4FOU C;  1O2U A;  3S7H B;  2IN2 A;  2HVX A;  3SJK A;  2A4G A;  2VWL A;  3D49 H;  1O2R A;  1BRA A;  4UE7 H;  1AHT H;  1ESA A;  2K0Q A;  1Y3V A;  2QA9 E;  5JDU B;  1CE5 A;  1M9U A;  4ABJ A;  4CRF A;  1KXE A;  1UTM A;  3AK5 A;  1DSU A;  4GUX A;  1SGN E;  5KED A;  1BMM H;  3M3T A;  2QXG A;  2ZGH A;  2WV9 A;  1EZX C;  3N7D A;  4TYD A;  2JET B;  2CF8 H;  1SQO A;  1E0F D;  2JH0 D;  8EST E;  3CS7 A;  3GCT F;  4ZKY A;  4YLU A;  2WPI S;  2TPI Z;  2H1U A;  5DN6 D;  1ZOM A;  2OLG A;  3ZZA A;  3PV4 A;  1ELD E;  1S6F A;  2WSS D;  1CA0 B;  2LP6 A;  1O2L A;  4MQA A;  1TIO A;  7KME H;  4GLY A;  2I6S A;  3P8G A;  1TPS A;  1O38 A;  5A0B A;  1UK2 A;  3ZZC A;  1C5W B;  4NWL A;  1O2O A;  4X6N A;  4OS1 A;  1RXP A;  2FI3 E;  3QX5 H;  3N7O A;  1NZQ H;  1NBM E;  1O5E H;  1AVX A;  1GBD A;  1JOU B;  4RKO B;  2BDA A;  1SQR A;  2ANW A;  2HAL A;  3ZOH A;  2V0B A;  2Z3E A;  4A6L A;  2R0X A;  2JH5 D;  3F0O A;  4NG9 H;  1VCQ A;  1ZGI A;  1GCD A;  1V2Q T;  3E0N B;  1AKS A;  3CS0 A;  4D9R A;  4DT4 A;  3LU9 B;  3ODD A;  1WXR A;  1QGF A;  1ELB A;  4UEH H;  3GS9 A;  4HGC A;  4UON A;  2FWW A;  1Y59 T;  2ZPS A;  3ZZ8 A;  2AMD A;  3UFA A;  4I8L A;  3SU4 A;  2Z9K A;  1OXG A;  2AYW A;  1N1L A;  4U01 A;  1K21 H;  2C8X B;  2PTC E;  1MTU A;  1TBR H;  3GY2 A;  1F5R A;  4MPV A;  4ASU D;  4BOH A;  1CT0 E;  3F9H A;  2XXL A;  3KQC A;  4YBN A;  1GMD G;  2FOD A;  3FO8 D;  5DP4 A;  1ZSL A;  1ZTK A;  3RU4 T;  1RZ0 A;  1AI8 H;  1P2M A;  4IC6 A;  5ESB A;  4HFP B;  1XVO A;  4UFE H;  2BYA X;  1EP6 A;  1GJD B;  4X1N U;  3UAI C;  1P3E A;  3TJU A;  4AC9 A;  1CT2 E;  2BVX H;  4MTB A;  4GCH G;  3MU5 A;  1KMH B;  4MNV A;  1C1O A;  2YMS C;  1E38 B;  3BTD E;  1RTK A;  1TPO A;  4D76 A;  2SFA A;  2NU2 E;  3NZI A;  4AFS A;  1DPO A;  1RIW B;  3MU4 A;  2VH6 A;  2W7U A;  3RU4 E;  1OYT H;  4CH8 B;  4JK6 A;  3URD A;  2FXR A;  4OS4 A;  3EDX B;  1BTU A;  3U98 H;  1BBR K;  3VPK A;  3A7T A;  3GY8 A;  5C3N A;  4BAQ B;  3F2H A;  5HYO A;  1GI4 A;  4I8G A;  3RXQ A;  3W1E A;  2F83 A;  5CHE C;  1O34 A;  1T31 A;  4I32 A;  1C1U H;  3N99 A;  2NU4 E;  1I0S A;  1B0F A;  1ANC A;  1GCT C;  5FX6 A;  1TYN A;  3F68 H;  3ZZ6 A;  2I6Q A;  2B7D H;  2UWP A;  5JBB S;  1O3C A;  2HOB A;  3MH7 A;  1J14 A;  1ZMN A;  1UCY H;  1GDN A;  2TIO A;  2A7J A;  1O2Y A;  3KCG H;  2PW8 H;  3GCH B;  3TGJ E;  3DSO A;  1AND A;  2QF4 A;  2ZCH P;  4AX9 H;  3T5F H;  4BXW A;  1C2G A;  3RXU A;  2A5K A;  3HK6 B;  4INK A;  1O2T A;  1TGC A;  1AE5 A;  1G3E A;  4FU7 A;  3ELA H;  4HTC H;  2JIZ D;  1ZHR A;  1RFN A;  4Q7X A;  5FPY A;  4X1S U;  4B2A A;  3PRO A;  1C5T A;  4I86 A;  2P5Z X;  1OWH A;  2YMS B;  1DXW A;  3Q3Y A;  1O33 A;  1K1J A;  3E8L A;  4AFZ A;  3T26 A;  5FCK A;  2VIQ A;  7GCH F;  3PMB B;  1CGI E;  3PLP A;  3VB7 A;  3S9B A;  1RRK A;  1UO6 A;  2ZGC A;  3N7E A;  2BDB A;  1Y3Y A;  2FES H;  1V2R T;  3UWI A;  5J4Q A;  3PV2 A;  2K1Q A;  1UTO A;  2BZA A;  3KYF A;  5E0G A;  1S6H A;  2C3S A;  4CBN A;  1AQ7 A;  5EJL A;  5EIY A;  2HPQ H;  5L2Y H;  3S9A A;  1O3A A;  1A0H B;  1W3O A;  3LGY A;  2BLO A;  4I8K A;  4XOJ A;  4CR9 A;  4HG6 A;  1YCP H;  1S82 A;  4ZKN U;  2ASF A;  1H8I H;  2WYG A;  4FUE A;  1O2H A;  3EAA A;  2K8I A;  1LVB A;  4HMV A;  3GYL B;  2F9B H;  3VG8 A;  1O2S A;  2JKH A;  4YTA A;  1ELC A;  1N8O C;  1TNL A;  3LPR A;  1MU6 B;  3G01 A;  2Z9L A;  3OX7 U;  4M9F A;  1FDP A;  1GHW H;  3T27 A;  2BDC A;  1YPG H;  3SWJ A;  1YC0 A;  3QTV H;  1O3F A;  1SOT A;  4Q7Y A;  1YPM H;  4RI0 A;  5BRR E;  1WTG H;  4Y0Y E;  3AMF A;  2HRV A;  2BLV A;  2PKS C;  1QJ6 B;  4HX6 A;  1Z71 A;  2XWB I;  2ASU B;  3HE1 A;  4B76 A;  1HJ9 A;  1GBL A;  1O5B B;  1J9C H;  1MKW K;  1AMH A;  1GBC A;  1HAZ B;  4LOY H;  5T6G A;  4WF8 A;  1SFI A;  4OS6 A;  2CGA A;  3NPS A;  1BTX A;  3M61 U;  3TPI Z;  2H9H A;  3ZZ5 A;  1SLW B;  2QIQ A;  1GBE A;  4J2Y B;  2VWO A;  1LMW B;  5EGM A;  4HMU A;  3SO3 A;  2ZTY A;  3PB1 E;  1WAY B;  4PRO A;  3HKI B;  1GJ5 H;  1YM0 A;  4WH8 A;  4ZCN A;  2OQU A;  4B2C A;  2BLQ A;  2LNC A;  3F2G A;  2ZHE H;  3A7Z A;  2ZU4 A;  3TH3 H;  1ARC A;  2UUJ B;  3VXF H;  2HTD A;  5FHT A;  4F4O C;  3V12 A;  2FZZ A;  5F8T A;  3SV2 H;  1DY8 A;  1O36 A;  1GHY H;  3HGP A;  4IS5 A;  4RSP A;  3SUF A;  5CE1 A;  4INH A;  4CRG A;  1C5M D;  3SZE A;  4ABD A;  4E7N A;  5EJ1 A;  1SL3 A;  1ESB A;  2OBO A;  2BY8 X;  2W26 A;  1OP8 A;  2W6I D;  4DIH H;  2ZFT A;  1L1N A;  2AMP A;  2EY4 C;  3PRB A;  3PYH A;  3LH1 A;  3QZR A;  1UW7 A;  3A6Q A;  1O35 A;  2AGE X;  1FPH H;  2BXT H;  3SV7 A;  2VNT A;  2ZTZ A;  2OK5 A;  4B6E A;  3MFJ A;  1DY9 A;  3R5W A;  1N8O B;  3U8R H;  2P59 A;  2UWL A;  4FET A;  1USF A;  3PMH B;  4O3T A;  4D8N A;  1BMA A;  3NXP A;  2RA0 A;  3SUE A;  3WWF A;  4AOR A;  1SR5 C;  1ZZZ A;  4AB9 A;  4MLF B;  4F07 A;  1FAX A;  2VIW A;  1NY2 2;  1S0Q A;  1AWH B;  4WH6 A;  3RXI A;  5C1X A;  1K1O A;  1USC A;  1G37 A;  1SFQ B;  3V7T A;  2PP6 A;  2WHX A;  2B9L A;  1UHB A;  4BTU B;  1X7A C;  2BMG B;  2G51 A;  2BDG A;  4ZHA A;  3SGQ E;  3SV8 A;  1QJ1 B;  1C5V A;  2GUJ A;  3A88 A;  1EJE A;  1UJ1 A;  2WPL S;  1NRG A;  1INC A;  1HAV A;  2PKA A;  2ZEC A;  4BNR A;  1GPZ A;  2HQ7 A;  4TPI Z;  5DK1 A;  3TJO A;  2GZ7 A;  1O3J A;  2ZC9 H;  2PTF A;  2V6N A;  1T8M A;  1TGN A;  1UTQ A;  3EA9 A;  3OYP A;  1DFP A;  3U69 H;  3QGN B;  2O8U A;  1GVK B;  1YCP M;  1O32 A;  2XBV A;  1XUI A;  2ZKS A;  3UOU A;  3RC6 A;  2OU5 A;  2PR3 A;  2Q9K A;  4Y76 A;  1C1W H;  1EUF A;  5F6M A;  1WOF A;  1PQ8 A;  1AUJ A;  2P93 A;  5I46 H;  3F1S B;  2LEL A;  1UCY E;  5A2M H;  1NRR H;  1V2V T;  1HCG A;  2A4O A;  2IOT A;  1DWD H;  5C2Z A;  1VIT G;  4E05 H;  2O8L A;  3BTG E;  4ZXX H;  5EQS A;  2WPJ S;  2A5I A;  3SQH E;  1UTN A;  1SI5 H;  3ATK A;  4INL A;  1LQD B;  3A8A A;  6GCH G;  5EOK A;  2PTN A;  1AY6 H;  2ODP A;  1E35 B;  4A1T A;  3A7V A;  1GBT A;  4I31 A;  4YT6 H;  1QHR B;  2PUX B;  1LHG H;  1QJ7 B;  1PPZ A;  3A82 A;  2BX3 A;  3QUM P;  4NIW A;  1FV9 A;  4WXV A;  2OC7 A;  1SGI B;  5FPS A;  4KKD A;  1XUK A;  1IQH A;  3GY4 A;  4O97 A;  4LXB H;  1Y8T A;  4X1R U;  1DIC A;  1P9S A;  4GHT A;  1G2L A;  3BTQ E;  2QXH A;  1C5P A;  3UNQ A;  3OTP A;  3HMZ A;  1YP9 A;  4OS5 A;  2AFQ B;  1VJ9 U;  2ZI2 H;  5F8X A;  4Q63 A;  1P05 A;  1HXF H;  4XHY A;  3L6P A;  2G00 A;  1SHH B;  1P01 A;  2HNT E;  1W8B H;  1BML A;  1GBA A;  2QF5 A;  5EG4 A;  1MCT A;  4ABE A;  2OIN A;  5PTP A;  3VEQ B;  1GJ4 H;  2F43 B;  3AVZ A;  2A7C A;  3DMB A;  2STA E;  3MNC A;  2C93 B;  2ANK H;  5BNC A;  2A4R A;  3GCT G;  1HYL A;  1MQ6 A;  3SJI A; 
#chains in the Genus database with same CATH homology
 2OL5 A;  4YWN A;  1YOA A;  2ASF A;  4HMX A;  3BPK A;  2I02 A;  1VL7 A;  3DNH A;  4RT0 A;  3K86 A;  5CHO A;  4HMV A;  3ZOD A;  1I0R A;  1EJE A;  1NRG A;  2X1K A;  5KED A;  4F48 B;  2HQ7 A;  3R5R A;  3SWJ A;  4N7R C;  2D38 A;  2IG6 A;  2HQ9 A;  4XRN A;  2PTF A;  3K87 A;  2FHQ A;  3AMF A;  3HY8 A;  4ZKY A;  4HX6 A;  2FUR A;  1AXJ A;  2QEA A;  1W3Q A;  5KEC A;  3CNR A;  1WLI A;  3U5W A;  2OU5 A;  3ZOE A;  4P00 A;  2Q9K A;  2HTI A;  4R82 A;  2ECR A;  2AQ6 A;  3IN6 A;  5CHE C;  5KGO A;  3R5L A;  4Y9I A;  1G76 A;  1FLM A;  3A6R A;  4HMW A;  3U35 A;  1W3R A;  3K88 A;  1I0S A;  2D36 A;  3ZOG A;  2HHZ A;  2A2J A;  2RDE A;  3ZOF A;  3E4V A;  3RH7 A;  4HMU A;  3R5Z A;  1WGB A;  1YWU A;  1G78 A;  4L82 A;  1CI0 A;  1RZ1 A;  2GJG A;  2HTD A;  2ECU A;  2D5M A;  3F7E A;  5ESC A;  3ZOH A;  2IAB A;  1XXO A;  3NFW A;  1RFE A;  1YLN A;  3KYG A;  4XJ2 A;  3R5P A;  5EJ1 A;  2R0X A;  3DB0 A;  3DSG A;  1W3P A;  3AWH A;  4Z85 A;  3FKH A;  4RT1 A;  2FG9 A;  3PFT A;  2R6V A;  1TY9 A;  1DNL A;  2D37 A;  4QVB A;  2NR4 A;  4HMT A;  1G79 A;  2QCK A;  3TGV A;  3A6Q A;  3VY2 A;  4I86 A;  2ARZ A;  3HMZ A;  1XHN A;  3FGE A;  3EC6 A;  3R5W A;  5EJZ A;  1USF A;  2X1J A;  1G77 A;  3VYA A;  4P02 A;  4IRA A;  3H96 A;  4XHY A;  1WV4 A;  1WLK A;  3U34 A;  3B5M A;  2RE7 A;  4F07 A;  3A20 A;  3ZOC A;  2I51 A;  2IML A;  1T9M A;  3CP3 A;  5JAB A;  2E83 A;  4HMS A;  1USC A;  3KYF A;  3DMB A;  3R5Y A;  3GAS A;  3BNK A;  3BA3 A;  4YBN A;  4HG6 A;  5EJL A;  5BNC A;  5EIY A;  1W9A A;  2L74 A;  1RZ0 A;  1W3O A;  1JNW A;  4FOU C;  3CB0 A;  2VPA A;  1Y30 A;  3U0I A;  3VY5 A;  2ED4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...