1YLNA

The crystal structure of the protein of unknown function vca0042 from vibrio cholerae o1
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
226
structure length
225
Chain Sequence
TVSTINSTDALAMVEHSELTLSITTPVGTKFVCRTPFIGTHTDKFLLVEMPKISADDLQYFFQEGFWMNIRAISPRGEGALIHFRSQLMHILQEPVPMAFLSIPNTMQVSQLRKEPRFELNLAGKVLFDEHRGDCELRDLSRSGCRFITPPLGKTYQVGDLVALEIFSDLRGTKTFPPLTGKICNLQRSLHHARYGLEFNEEGRNNAKNLLAQLKFNGTKLTLNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein vca0042
publication title The crystal structure of the hypothetical protein vca0042 from Vibrio cholerae O1
rcsb
source organism Vibrio cholerae o1
molecule tags Structural genomics, unknown function
total genus 39
structure length 225
sequence length 226
ec nomenclature
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07238 PilZ PilZ domain
A PF12945 YcgR_2 Flagellar protein YcgR
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.110.10 Mainly Beta Roll Pnp Oxidase; Chain A Electron Transport, Fmn-binding Protein; Chain A 1ylnA01
2.40.10.220 Mainly Beta Beta Barrel Thrombin, subunit H predicted glycosyltransferase like domains 1ylnA02
1G79A 2FHQA 4L82A 3HY8A 4HMSA 2X1KA 1W9AA 5CHEC 1WLKA 1WV4A 3KYFA 3CNRA 1YWUA 1T9MA 5KGOA 5ESCA 1CI0A 5EJLA 3DMBA 2ASFA 4XHYA 3A20A 1RFEA 2HTIA 1WGBA 4Z85A 4HMVA 3F7EA 2D38A 2PTFA 2NR4A 3BA3A 2GJGA 1I0RA 3RH7A 4YWNA 2ED4A 4IRAA 3NFWA 2FG9A 2D37A 3VY5A 3KYGA 3BPKA 1XHNA 4QVBA 4RT1A 2OU5A 2HQ7A 3ZOCA 3R5ZA 3ZOGA 1G77A 1W3OA 5JABA 1W3RA 4F07A 3ZODA 2AQ6A 4R82A 2IG6A 1YOAA 2R6VA 3AMFA 1USFA 1VL7A 1W3QA 1XXOA 4HMTA 3A6RA 3GASA 3TGVA 5EIYA 2HHZA 2L74A 3ZOHA 5KECA 2Q9KA 5CHOA 1AXJA 4P02A 3FKHA 2RE7A 3R5PA 1Y30A 3A6QA 3IN6A 2ARZA 4XJ2A 1USCA 4HMUA 1W3PA 2RDEA 4HG6A 4HMXA 2HTDA 2D5MA 3K87A 2E83A 3CB0A 3FGEA 4N7RC 1DNLA 3BNKA 2I02A 3H96A 1EJEA 3VY2A 3ZOEA 2HQ9A 2ECUA 3HMZA 1FLMA 2X1JA 3R5LA 4ZKYA 4FOUC 4YBNA 3B5MA 2IMLA 2IABA 2I51A 2D36A 4Y9IA 3VYAA 4I86A 4HX6A 2QEAA 3E4VA 4HMWA 4RT0A 3SWJA 2R0XA 5EJ1A 3K88A 3U5WA 1JNWA 5KEDA 1YLNA 3DSGA 3R5RA 3U35A 2A2JA 2ECRA 3K86A 4XRNA 1RZ1A 2QCKA 4F48B 3R5YA 3CP3A 3AWHA 1WLIA 3DNHA 1I0SA 3U0IA 1G76A 5BNCA 3EC6A 1NRGA 1TY9A 5EJZA 4P00A 2VPAA 3DB0A 3PFTA 3R5WA 1RZ0A 3U34A 2OL5A 1G78A 3ZOFA 2FURA
chains in the Genus database with same CATH superfamily
4E06H 1ELEE 3LC3A 5PTPA 2FHQA 2JH5D 4UFDH 1HLTH 1HAOH 2X1KA 2VGCB 1F0TA 1EB2A 1TNLA 1CA8B 1GBMA 2VIDA 1O3IA 3LGVA 2IJD1 5LPFA 1TMBH 2HTIA 7GCHF 1WQSA 6CHAB 1AVGH 4NIWA 4TPIZ 3V7TA 4JZFH 3HE1A 1SB1H 4NIVA 1ELCA 2W26A 1LKBA 4MPUA 1YP9A 3OAAD 2QC2A 2EQNA 1Z8IB 1IHSH 1O3CA 4ZKNU 4TWYA 3VY5A 1FPHH 3ZZDA 1RIWC 2VWMA 3I78A 2SGFE 2ODPA 5F53A 1HAZB 1DLKB 1E79D 2RDLA 4KP0A 2QXHA 1ZYOA 1GHWH 2ZDVH 1DITH 1F5LA 1GJ5H 3TK9A 2R6VA 3TJNA 5I25A 1QBNA 2F9UA 2BDAA 3SU6A 1OWDA 2GDDA 1IOEA 1QJ6B 1TRMA 1IQFA 2UUJB 1TRYA 1FONA 1MBMA 2ZDKA 4RKOB 2OINA 3F68H 2RE7A 1K22H 1PQ8A 3DFLA 4Y0YE 2C8ZB 4B2AA 3VB6A 1SG8B 1WTGH 3ZZ3A 1NC6A 4HG6A 1GVKB 4NZLA 5GJ4B 3HGNA 3LPRA 1F7ZA 1O2JA 3V12A 4X8TH 1KXDA 1EP6A 1C5OH 1BTUA 2WYJA 2F9OA 3L33A 4CRFA 1T7CA 5K7RA 1BA8B 1NU7B 3LGYA 2ECUA 1KXFA 2ILNA 1P3EA 1RGQA 2WV9A 1GHYH 1GJ9B 1HAPH 1YPLH 3P8FA 1E38B 3ZV9A 4X6NA 1UVTH 2A5AA 3B9FH 1CGIE 5GXPA 3UTUH 3U35A 1VCWA 4I7YH 3K86A 4FUHA 4K1SA 1RZ1A 1TBQH 1SGFG 4F48B 2CXVA 1V2JT 1GMCG 1LHGH 3P70B 4X1SU 4GCHF 1G3CA 1ID5H 2ZGBH 3AW0A 3PMAB 2BLVA 3ZVDA 3QN7A 5C17A 1L4DA 3DSOA 1NTPA 1O2OA 2Y5HA 3B8JA 1KSNA 1EP5A 1BRBE 4BAMB 1LCYA 4WXIA 3SV8A 2R9PA 5BRRE 2B5TB 1BBRK 1S6FA 4BNRA 1P2KA 1QGFA 3BTDE 1KTSB 1T9MA 1UTNA 2PLXA 4MG3A 3QGJA 5T6FA 2BB4A 2BY9X 2IPQX 5E2OA 3GYMA 5FBEA 4D7GA 3QZQA 3F7EA 2G8TA 4QT8C 1UCYK 2UWLA 2J95A 3N7DA 2P93A 2ZDMA 4B76A 2FPZA 1LDTT 2GP9B 1H1BA 1H9LB 1NU9A 1ARCA 1SPJA 2XWBI 2ZG0H 3M7UA 1SGIB 2G81E 3BPKA 1S82A 5DP9A 1ZMNA 1HAIH 2Z6BD 3EAAA 4BXSA 5C94A 3V4HA 3ZOCA 2ODYB 2AGIX 5JABA 3RXUA 1NN6A 2GCHG 1TAWA 1ESTA 1H8ED 1OX1A 1SQAA 5GPIB 4HMTA 4INLA 4LXBH 2AIPA 3RMLH 1EFRD 1MKXH 1ZHRA 2ZTYA 5E8EH 2B9LA 3ZOHA 1Z6JH 3SQHE 3O8DA 5I46H 1ZSJA 4Y0ZE 3FANA 1DX5M 1OWIA 4XJ2A 3P17H 2G52A 2WUCA 4M7GA 5T1VA 2NU2E 1Y3YA 1EPTA 1V2PT 4WF8A 1QCPA 1BIOA 1FN6A 1H9HE 2UUKB 3QWCH 2P8OC 1EAWA 3KNXA 4H42U 1CHOF 4JK5A 3ZVBA 4HI3A 4DCDA 2I02A 2GV6A 2BD5A 2GMTB 3LU9B 1P11E 3GICB 1EZQA 1JIMA 3NXPA 1O39A 3VEQB 1W3CA 3I77A 5A8XA 4FU9A 1BTHH 2A4GA 1SSXA 1JWTA 1LTOA 2OCVB 4ZXXH 1F92A 1EOJA 1SGTA 1Z1JA 2A2JA 2ZFPH 4X2VA 1GHAG 1P9SA 1RS0A 2GZ9A 3RM2H 3S9CA 1ORFA 2QYIA 1HAGE 1EASA 4KTCA 3U8TH 3GY2A 1XVOA 5BNCA 2ZCLP 3L6PA 2FTMA 3TU7H 4P00A 3DB0A 1DSTA 3QX5H 2ZHWH 4UEHH 4Z1MD 1FY5A 3OY6U 3ZOFA 1YPHE 2FX4A 4HMSA 3VB4A 3HPTB 1AUJA 1YCPK 3KHVA 3Q3KA 1ZZZA 1NY22 4DOQA 1CI0A 1C1TA 1W0YH 3Q77A 3WW7A 5CHAC 2AEIH 1S85A 2YMSC 1MAYA 2CF9H 1N8OB 1GDQA 2CHAB 2H6MA 7ESTE 4DVAU 4YWNA 1VCQA 2CF8H 1LHFH 2WPKS 1YF4A 1ELBA 1FY1A 1DLEA 2AGEX 2EI8A 4NG9H 8GCHF 2XBWA 2F4LA 1FY8E 1Y5AT 3P8NA 3ZZ6A 3A7TA 3SI4H 4MPVA 3AVZA 4QVBA 2K0QA 3R5ZA 5FPTA 1HGTH 1HFDA 2VINA 3N99A 2DE9A 2UUYA 3CENA 2C8YB 2ZU4A 2ZDAH 2IG6A 4MVNA 1D3PB 2PW8H 2A5IA 1C5UA 1KXCA 2FOBA 1O3FA 1YGCH 1QB9A 1GVZA 1C9PA 4JZEH 4DT4A 1H8IH 2QF5A 1SGEE 1BHXF 4XBDA 2ZFQH 3KQEA 2VVVA 3MQKC 1THPB 5CHOA 4AB8A 1J16A 3QK1A 5HXFA 3SGAE 3GCHB 3ZVGA 3TGIE 1WQVH 3BF6H 3ZZAA 1SHYA 2QF4A 4I31A 1V2VT 2FYRA 2FP7B 1Y12A 4X2XA 2V6NA 3OFND 4K69A 2L1TA 1O36A 3RU4D 3PLBA 1CE5A 1GBFA 3M61U 2BY5X 1UK3A 1BITA 1AB9C 1S6HA 5JB8S 5JBAS 2PKSB 3EQ0H 3SN8A 1Y3XA 2XNIA 3SV9A 4BAKB 5DG6A 4A6LA 3KIDU 2RFKC 1GCDA 1CT0E 3MH5A 4NWKA 3U5WA 4AN7A 1BTWA 4AFUA 2FEQH 1VKYA 1P12E 3W94A 2K1QA 2SNWA 5C20A 3CP3A 1UVPA 2D2DA 1TYNA 2L6OA 1YC0A 1P2NA 4MNWA 3A80A 1UTOA 3SV7A 3ZIAD 1DANH 1P04A 1TPAE 2TIOA 3QUMP 5FPYA 4DIHH 2PUQH 3SOSA 1HJAB 1O5FH 1CGJE 1KYNA 1SOZA 1QBVH 1SQTA 2ZDNA 1HAXB 2GTBA 3O8BA 2GGVB 1W7XH 1O5BB 1SOTA 1T8LA 1CBWC 1V2MT 2F9BH 4LZ1H 1QJ7B 1I0RA 2A0QB 1E1RD 1MTNC 2Z7FE 4VGCC 2BXUH 1SGDE 2G5NA 2FG9A 3RXJA 1E36B 4OS5A 2XYAA 2HGTH 3GOVB 3LIWA 1HIAB 1XHNA 4FUEA 2XWAA 2BOKA 1XUIA 2GX4A 5GWZA 4Y8YA 1G2LA 5GNDA 1SGRE 2ANMH 1A7SA 4ABGA 1NZQH 3LT3A 2RCEA 3ZZ9A 1ZOMA 1BMLA 5ABWA 4MTBA 1L2EA 4NA8A 1GDNA 1TNGA 1TABE 3BV9B 1H8DH 2AMDA 1O5GH 3N7EA 2PKAB 3MH6A 2BY8X 2QF3A 2V35A 5KECA 3MHWU 1FDPA 3GCTF 2P3FH 2ZI2H 2Q9KA 3RXKA 1ETRH 3ODDA 4FU7A 5LGOA 1SMFE 4IC6A 5DGJA 5GDSH 1S83A 3M5LA 4DY7B 3NPSA 4ABDA 1SVPA 1TONA 2F3CE 4X8SH 2QCYA 2Z9JA 5L2YH 1OYTH 1DNLA 1FZZA 3OTJE 1J14A 1S6LA 1UTQA 2V7QD 3VY2A 1SBWA 4CRGA 3SYJA 4YOJA 2FOGA 3FP6E 2X1JA 4MNVA 1PFXC 3NZIA 1C1WH 1EAUA 4B74A 2BD8A 2YNAA 4FVDA 3A8AA 2GUJA 2A2QH 2SFAA 1UMAH 1BBRE 3BSQA 3BEFB 1AZZA 4K5ZA 2OLGA 4D9QA 3U8OH 4ACBA 2HRVA 3AAVA 3D62A 3BG8A 1MMJN 2B8OH 3H7OA 4DGJA 5L2ZH 4D8NA 3SV6A 1RZ0A 3PWBA 3PMJA 4B6EA 1IQIA 5HIYA 3RMOH 1QQUA 5B6LA 1O37A 1GCTB 1P0SH 1W9AA 1V2QT 4Y7AA 1BZXE 3FVFB 3BTFE 4M9FA 3SNBA 2PUXB 3LGIA 4HZHA 3DMBA 2VBCA 4CHAB 4WMEA 1NROH 5FCKA 3MMGA 3K65B 2Y5FA 3FKSD 1NRSH 2Y80A 5AFZH 4ISNA 1F5KU 1MTUA 1GMHG 4ZH8A 1J17T 1DE7H 4MNYA 2CGAA 3U69H 1DT2A 2G5VA 2W3IA 4NWLA 1ZSLA 2ALPA 1O5EH 4XFQA 3F9GA 2Z3CA 2GDEH 2EY4C 2FLBH 2QXIA 1P06A 1WCZA 5T6GA 1KLTA 1E34B 1QURH 3TIUA 1QBOA 1TNKA 2BLWA 4U30A 1A2CH 5C5NA 1MABB 1T8MA 1MKWH 1QNJA 4ABIA 3RXFA 5A09A 3FKHA 2TGPZ 9LPRA 1VGCC 1BTXA 1G36A 5C1XA 1AY6H 1A0HB 1WAYB 1W8BH 1TA6A 1NESE 1FY4A 1BOQA 1ZPCA 4ZAEA 5TJXA 3LKWA 3GY3A 3RXLA 4D9RA 2F9NA 3TH4H 2FDAA 1NS3A 1XX9A 1D6RA 4IGDA 2QY0B 2ZO3H 2WV5A 2FO9A 2ZHDA 1J15A 1SR5C 1CA0C 1T4VH 2IMLA 1PQ7A 3Q3XA 4DT7B 1F0RA 2Q6DA 3E8LA 3SJKA 3M5OA 5GCHG 1ABIH 1YBWA 1C2FA 4RT0A 4ESTE 1QIXB 3E0NB 1GGDC 1MQ5A 1DVAH 1XUHA 4NFFA 1DWBH 2CK3D 2BDCA 4JZIA 1O31A 1IQEA 3BIVH 1QHRB 3K6YA 4KTSA 1RJXB 2ZC9H 3AWHA 1HIAA 3OE7D 4Y71A 3ENSB 3EGKH 4ABFA 2SGQE 1QFKH 3FAOA 2XTTB 1DWCH 3SNCA 4DG4A 1PQAA 2WHXA 3RC6A 4NSYA 4I8GA 3BG4C 5IK2D 5DKMA 1DFPA 1UK2A 1TQ0B 5EQSA 1TQ7B 4UFEH 2R2MB 3PMBB 2ZFTA 1DUAA 5CHEC 2DE8A 3SU3A 4YT7H 3RLWH 1V2KT 5JPMH 5ESCA 2JETB 2VWNA 2ALVA 2XOKD 4CREA 2TPIZ 2IPHA 1C1UH 2VH6A 1B0FA 2VGCC 2Z9LA 2GCTB 1P2IA 3RH7A 3DD2H 1D4PB 1XUJA 4XDEA 1C5WB 3A8BA 2BDIA 1BJVA 5A2MH 4GSOA 6CHAC 1V2WT 1DXPA 4NGAH 3DUXH 2A32A 2AMPA 3S0NA 3RXDA 1CO7E 3FP7E 1LQDB 3S9AA 1J9CH 3MO6A 1NO9H 2O8MA 1GBIA 1S0QA 1DM4B 2AH4X 4IMQA 3BEUA 3MH4A 3UFAA 1PJPA 1L1JA 2ZU3A 5HM9A 1NFUA 3MNXA 2KFWA 3ATWA 1F0UA 1O34A 1O2UA 1Y3VA 3DA9B 5CMXH 1XXOA 3T29A 2BY7X 1AE8H 2EI7A 4BTIB 3W95A 1C5NH 1V2NT 3MO9A 3PRBA 1LPZB 1GHBF 5C5OA 2VIVA 1CT4E 2W6ID 1VCPA 3RXBA 4FU8A 5E0GA 4HMUA 1OP8A 4BXWA 3SUDA 2AGGX 2BQ7B 5FX6A 1C2EA 3KGPA 4K3JA 1LPGB 3PTBA 1V2RT 6ESTA 3EA7A 2UUFB 2GT7A 3EYDA 1WV7H 3QLPH 2VIQA 4MNXA 1MQ6A 3LH3A 3P92A 4O03A 1ZHPA 4YBNA 3T28A 1QRZA 3E3TA 4AGKA 4X2WA 1AMHA 2IABA 1TGBA 2EEKA 4Y9IA 4NA9H 2WPLS 5DP7A 4HKHA 4YLUA 1DICA 1SGNE 5ESBA 4E05H 4X8UH 4WH8A 1KLIH 1GG6B 2JJ2D 4GPGA 1RIWB 2ZIQH 1MTSA 4WJG2 5TCAA 1GI2A 3AASA 3SNDA 1I0SA 3ZZ7A 1HYLA 3LOXA 4Y8XA 1P2QA 1AU8A 5F6MA 3MH7A 1P8VC 3MTYA 1U6QA 3E0PB 4DW2U 4K60A 3A8CA 4H6SB 2OUAA 3PTNA 2BZ6H 4OGYA 5EW1H 4L82A 1YPHC 4KGAA 3HY8A 1Q3XA 3TJOA 1GI9B 3P95A 1O2KA 2XNDD 1W11U 2J94A 2P3TB 1K28D 1NFXA 1SLXB 3MNSA 3T27A 2OP9A 4A1VA 3DT0H 6GCHG 5HM2A 2P95A 1MU8B 4ISIH 1TX7A 5JBBS 4K2YA 3SO3A 3LJJA 1RTLA 1OXGA 4E7NA 3V0XA 1KMHB 5LH8A 1GWAA 1K0HA 1C2DA 3SJOA 1FN8A 1MZDA 2HPQH 5F8TA 5A8YA 4CRCA 2ZU5A 4CRAA 3F3BA 2Z9IA 4XBCA 2HNTC 2AS9A 3SJ9A 1G77A 3VB3A 2RG3A 4K1TA 1YPMH 2GVFA 3ZODA 1GBDA 4JYVH 2KCYA 5HGGA 1YOAA 1N1LA 2IJOB 2PSXA 5F03A 2SGDE 3NRLA 1SFQB 5EIYA 3GASA 2SGAA 4FVBA 2ZGCA 2HHZA 3SUGA 2FOHA 1G32B 1O2VA 2C3SA 1Z71A 1EQ9A 1HBTH 2L74A 3KL6A 4FXGH 2QGRA 2ZFFH 5JDUB 3IG6B 2QE7D 1C5RA 2Q6FA 3IN6A 2ARZA 4WMFA 1G2MA 4R0IA 2FOAA 4OGXA 3EAJA 2H2ZA 3FOAA 3OEED 4NA7A 4WVPE 1BMFD 1LMWB 2KCAA 1NPMA 5HKKD 4N7RC 3SU0A 5C1YA 2A4OA 3UWJH 2I6SA 3PV5A 2TGAA 1CSOE 1TALA 1C1QA 3UNRA 1GBCA 1TGCA 4GHQA 3NKKA 2BD9A 3ZYEA 2YOLA 2J5UA 2D36A 4INKA 1FAKH 1V2ST 5JYIA 2OTVA 2ZU2A 3TJUA 4XSKU 2R2WU 1SFIA 1ANBA 3VG8A 2PTNA 3SU2A 3F0PA 1V2OT 3Q00A 3R5YA 3T26A 1V2TT 3FP8E 4JCNA 3TLOA 4YESB 4UFFH 3MNBA 3M35A 2SGEE 4Y79A 2P94A 3PLPA 2WPHS 3A84A 1EZSC 4FETA 2QIQA 4B71A 1SQOA 1TE0A 2HLDD 1K1NA 2AMQA 4K1EA 3W1EA 1O2QA 3ZZBA 2F9VA 3SI3H 1TX8A 3ATKA 1QB1A 3Q76A 5EXNA 1Y3UA 2WV4A 5AF9H 1TB6H 4YZUA 2WPIS 2JKHA 2C90B 1XKBC 2PP6A 1BCUH 2VIOA 2FS8A 4U01A 4UDWH 1GI0A 1NBME 2ZCKP 2FOFA 3QTOH 3TK5A 3LH1A 4O3UA 3D49H 3HKIB 5HYOA 1OP0A 3UPEA 3PWCA 1CHGA 3F2GA 4X8VH 3NUMA 2P8OB 2CHAC 3SORA 1AUTC 3LC5A 4YOGA 1HAHH 1SL3A 1O35A 2XCNA 1L1GA 1ZLRA 1OKXA 4NZQA 5C67A 2SGPE 1AI8H 5FHTA 2AQ6A 2C4FH 1GL1A 1Q2WA 1FY3A 3GY5A 4CRBA 1AN1E 4OS1A 5DP4A 4ZKRU 1ELTA 1SGFA 3DSPA 2A7JA 4O97A 3URCA 1PPBH 4MLFB 1SI5H 1OWJA 1HAVA 2VIPA 3F2HA 1MBQA 4ZHAA 1XUKA 1OS8A 3SQEE 4WWYA 3O8RA 4AX9H 5EQQA 2FM2A 3M5MA 4TYDA 1DSUA 5DSFA 1JOUB 4GAWA 2OD3B 1NRNH 2FS9A 2HWLB 2PR3A 1WSSH 4ZUHA 3RXOA 1PPHE 3TH2H 1UJ1A 3MYWA 4JYTA 2ZZUH 1DDJA 2XBVA 4BAQB 1O38A 1KTTB 2Y7XA 5CHAB 3UOUA 2Q1JA 3BTME 1TOMH 2YMSB 1SHHB 4I86A 2HOBA 1OYQA 2QEAA 2FESH 1P3CA 1RRKA 2OC8A 2XBXA 2R0XA 5EJ1A 1O3DA 1O3KA 1AIXH 3K88A 2CN0H 3GY6A 5KEDA 2KM0A 2M5TA 1O5AB 1KIGH 3U98H 1GHVH 2ASUB 4Q4LA 3CS7A 1NRRH 5AVDA 1WLIA 3DNHA 3UY9A 1DS2E 1GBHA 1G76A 3A7YA 3E6PH 3VXEH 2FIRH 1IQJA 5EJZA 3RXCA 9ESTA 3BTEE 5EXLA 3U34A 1GHAF 1UTPA 3SW2B 4ASHA 4UONA 1ANEA 3M5NA 1RXPA 2STAE 3ZVCA 2G51A 2QN5T 3RC4A 2JH0D 4W64A 1AHTH 1UHBA 1YWUA 4Y11E 1C5XB 2O8WA 1MD8A 3I29A 1K1OA 4TSFD 1FLEE 4YM9A 1OWHA 1FPCH 1HJAC 4B6FA 2BZAA 8ESTE 1QL9A 1O3EA 1PPGE 2BXTH 1ZSKA 1FUJA 1LHEH 1P2JA 4ZCNA 1SQRA 1P2MA 3NWUA 3RXMA 3M3TA 5C3NA 3SZEA 3LGWA 1Z8RA 1C5ZB 1HPGA 1QR3E 1G30B 1IHTH 2BY6X 3RU4T 2PGBB 1W3OA 5EXMA 1W3RA 1AB9B 1O2YA 1O2MA 4F07A 1N6YA 1ELAA 1MCTA 2AYWA 3M37A 4WY3A 2FOMB 1GI6A 2NWNA 5J4SA 1O2IA 1USFA 1GBKA 4KELA 1DOJA 5DO4H 2H9TH 4E7RG 1IQKA 2XCFA 1F0SA 2Z3EA 1DY9A 1M9UA 2FI4E 4CRDA 1MKXK 2KZ4A 1MU6B 2UWOA 4U32A 1YPEH 3E16B 4B2CA 1P09A 5F8ZA 1QY6A 1TGSZ 3CB0A 1D9IA 3BNKA 4TPYA 4DJZB 2UWPA 1YKTA 1Z8GA 1BJUA 2VWLA 1CU1A 4ZKYA 1W14U 3PYHA 2CMYA 5ESTE 1E35B 1GMDG 1KXEA 3RXEA 5FXLA 1C1RA 1AQ7A 1P02A 4HMWA 1IQHA 4UE7H 2Q6GA 8KME2 1MTNB 2J38A 4VGCB 3A82A 3SHAH 3A7WA 2F43B 3UUZA 1Y5UT 1YY3A 3M7QA 2J4IA 1YM0A 3S7HB 1O3NA 1V2UT 1BMMH 3VGCC 1IAUA 2A1DB 1H9IE 1VJ9U 3M36A 1YYY1 5CDFE 1O3MA 3U9AH 4U2WA 4AORA 1O2NA 2BQ6B 2G55A 3KCGH 3F2FA 1BRAA 1LVBA 4OS6A 1BMAA 1S5SA 1CQQA 3JZ2B 1WU1A 2WZQA 1NBMD 5A0CA 3ELAH 4Q7YA 1WGBA 1AFQC 1GI4A 1EAXA 1EOLA 1WBGB 3P8OA 4Q80A 1OPHB 2QXGA 2WPDD 1TNHA 4IBLH 1W0JD 4IRAA 5C2ZA 4CHAC 3SJ8A 4FUIA 4X6PA 2H1UA 2ZFRH 1LO6A 1XUGA 2OC0A 3M3SA 4ABHA 3IWMA 3RXAA 4MDSA 4H4FA 2HQ7A 1ETTH 1GJCB 1T4UH 2J92A 3RXTA 1RFNA 3FZZA 1MD7A 1PPZA 4I33A 1O3AA 4UHVA 2BDYA 1V6DA 3AAUA 1HRTH 1PYTD 4F55A 3ZVEA 1P10A 3HATH 4K8YA 1ZRKA 1ARBA 2IN2A 2GKVE 8LPRA 2LPRA 3MO3A 5TCCA 1GL0E 1O30A 1XKAC 1ANDA 3MU1A 3VPKA 2VNTA 1BMNH 2XXLA 4KTUA 4AG1A 1LVOA 3F9HA 2QV1A 3DHKH 2F9PA 2J34A 2ZHFH 5CHBA 2RA3A 3PO1C 3A89A 1W3PA 2RDEA 1VJAU 2G4TA 3GDVA 2ZECA 2BLQA 1SGCA 2A5KA 2ZTXA 1O3OA 3H7TA 3U1IB 1A3BH 3HKJB 3DFJA 1GBJA 5K0HA 3RXRA 3K2UA 2VB0A 4X6MA 1VITG 1GBEA 5EOKA 3AK5A 3LGUA 1AZ8A 3HMZA 1FLMA 3ZZCA 2W6JD 2KCOA 3ODFA 5DP6A 1EKBB 1PPFE 4FUJA 2ZQ2A 2ZP0H 3KN2A 3H09A 2BD4A 2QA9E 2R3UA 3JZ1B 4H6TA 1QJ1B 4THNH 3MOCA 2K4QA 3WWFA 2KR7A 1YPJH 2JH6D 2F83A 4JK6A 2P16A 5EQRA 3K6ZA 3PFTA 3R5WA 1BBRH 2V0BA 2WPJS 2O9QA 2ZHEH 1G78A 5IYTA 1C1MA 2BD2A 2OBOA 2XRCA 7GCHG 1O5CB 1JXPA 2HLCA 2BDGA 4GLYA 1P05A 2GZ8A 1TBZH 2HVXA 5EJLA 4YOIA 1Z8JB 3A87A 1UCYH 1SGYE 5JB9S 1UVUH 2NU3E 3S69A 2OQ5A 1EZXC 3MNCA 1G3EA 1VGCB 4R8TB 2C8XB 2A2XH 1O0DH 1QRXA 3PB1E 1D3DB 2JETC 2ED4A 1F2SE 4LK4A 1HAYB 1LHDH 1XXFA 1DPOA 3QZRA 1AVXA 3BN9A 1WUNH 1W10U 3KYGA 1MTWA 2GCTC 1AWFH 1PPCE 2PTCE 2OU5A 1E1QD 4TV4A 2R0LA 1G3DA 2XBYA 5FAHA 3RLYH 5C0UA 1UTJA 3SUEA 5EGMA 4ABAA 1INCA 2FLRH 1O3GA 1CA0B 1KDQB 1EPTC 3OY5U 4MPWA 4X1QU 1BB0B 3BTKE 2LNCA 1UTLM 5DK1A 1C5PA 1GJ6A 4SGAE 2OQUA 2OC1A 1C1VH 1DWEH 1GGDB 3RMMH 1WYKA 4J1YA 5SGAE 1EZUC 1O2GH 4AC9A 4B2BA 2HPPH 1C5YB 3HGPA 1JRTA 2A31A 3A6QA 4K8BA 4IC5A 2V3MA 1ANCA 3N7OA 4ACAA 1LHCH 2TRMA 1YLCA 3QO6A 1USCA 3D65E 3LONA 5DP5A 4HMXA 1V3XA 1ZJDA 1A0JA 1C5SA 3FO8D 4I8KA 3BG4B 2ANYA 5DPAA 3QGNB 1EJNA 5L30H 4AZ2B 3WWBA 4O9VA 2Y82A 1ZRBA 4OS2A 5JBTA 1C4V2 3H96A 3E1XB 2BOHB 1AFEH 2LELA 2ANWA 1ESBA 3BTHE 3TJVA 4ZKSU 3T5FH 1EX3A 3P6ZB 1YPGH 2EC9H 4HGCA 1GHXH 1C5TA 4GCHG 2BX3A 2PSYA 1K21H 3ZZ5A 1HXEH 3DSGA 3TNTA 3U8RH 4DURA 1O2XA 3S9BA 4JZ1A 1ETSH 5FX5A 5GCHF 1J8AA 1BTPA 1TBRH 4DIIH 3QDZB 3SU5A 2G00A 2ZPQA 1E37B 2W7SA 1TIOA 3PROA 1FIWA 1YCPH 2BDBA 3GYLB 1GG6C 3C27B 5A0BA 1GI1A 2ZDLA 2FI3E 5DJ7A 3ESTA 4ZKOU 4ABBA 1ZHMA 1WV4A 2WSSD 1JMOH 3B23B 7KMEH 3UOPA 2VWOA 1T8NA 3LGTA 4Z85A 1HAVB 3D23A 4HMVA 2BHGA 1VITH 4J2YB 5FL7D 1C5VA 3RXPA 1P2OA 1C5LH 1P01A 2YNBA 4YT6H 2PFEA 1C1NA 4D76A 3MU4A 5EG4A 1SLUB 1GBTA 4ZROA 5FPSA 4RSPA 1GJDB 1ESAA 3E90B 2BD3A 1W0ZU 2BM2A 3GS9A 4FUBA 5G4BA 2C93B 4AFZA 1FMGA 1BUIA 2FWWA 3STIA 1GBAA 3GY8A 2FZZA 3E91A 3SZNA 2GD4B 3RXIA 1BTZA 3AMFA 2ZF0H 4A1XA 1Y3WA 1OWKA 1TNJA 1A5GH 1AD8H 1JIRA 2BTCE 2JIZD 2OXSA 4NIXA 5E0JA 3A6RA 2EA3A 1A3EH 3GCOA 5BPEA 1COWD 2BDHA 4AB9A 5J4QA 2A7CA 4P02A 2J2UA 1EB1H 1MKWK 1PYTC 1Z1IA 4Q63A 4JYUH 1SGQE 3Q3YA 5F8XA 3RU4E 3ZYDA 1ELGA 3SJIA 1TLDA 1S84A 1CHOG 2AFQB 1O2SA 3KF2A 4XE4A 1QQ4A 3GDSA 2LP6A 3ATMA 1PPEE 1QTFA 2STBE 3RXQA 3BTWE 3K9XB 3SNAA 5HIZA 4BTTB 1A5HA 3FN8A 2NU4E 4TT3D 1G37A 4D7FA 1UHBB 1ZJKA 3A7XA 3TVJB 4IN2A 4A1TA 2BVRH 3C1KA 3A88A 1A4WH 2A4RA 2KX4A 1JBUH 1C4Y2 1ZPBA 4XRNA 5C0TA 2QCKA 4IW4E 3UQVA 3VB7A 2W3KA 4Y76A 1IQMA 3MU5A 1MUEB 3U0IA 1GJBB 1HNEE 5EODA 1BRUP 4CR9A 2V3OH 1C2JA 1KDQA 4RN6A 1ACBE 2J98B 3OSYA 3RP2A 4X1PU 5E0HA 1O2TA 2WINI 3U28C 2FURA 1HXFH 2KAIB 1ZPZA 2P5ZX 3NCLA 1QL8A 1THRH 4FUDA 1BHXB 1AVWA 3CNRA 5EPNA 1QA0A 1FJSA 2GMTC 3UNQA 2D1JA 4ZXYH 1RFEA 2VVCA 8GCHG 2CV3A 4AFQA 3DCLA 4A7IB 2VVUA 3BA3A 2WPMS 5T6DA 1AO5A 1PQ5A 6GCHF 1GMCF 4ISOA 3F0OA 1O3JA 1O5DH 1Z6EA 2FI5E 1C1PA 2Y5GA 2RA0A 2BX4A 1O32A 1VR1H 1K1PA 3ZOGA 3PM3A 3PLKA 3F1SB 1AGJA 1B7XB 3A8DA 3TGJE 3OEHD 1C5QA 4B1TA 1IQLA 1GDUA 2JDID 1H4WA 3HK3B 1A61H 1W3QA 4B73A 3MU0A 4MPXA 1VZQH 4YLQH 5A0AE 1T31A 2ZA5A 1NFWA 1BRCE 2ZQ1A 4RKJB 4Z0KA 1EJAA 4ZMAH 1MH0A 3ZZ4A 1T8OA 1CVWH 1Y30A 1N8OC 2ZTZA 6LPRA 1GBBA 3A85A 1MTVA 3QTVH 4AYVB 1C1SA 3EA9A 4ISHH 3M7TA 3TH3H 3ZZ8A 4ABEA 1K1IA 1G9IE 1O33A 1WOFA 2ZFSA 1EATA 2P3UB 4RI0A 2C8WB 3FGEA 4GHTA 1OWEA 4BANB 3TITA 1W13U 4IS5A 1E0FD 1KY9A 3ITIA 1O2PA 2D26C 1XXDA 1EJMA 2BQWB 1NM6A 2GCHF 5DN6D 2HALA 4AYYB 4Y6DA 3UAIC 2I51A 4AGJA 4HX6A 1HV7A 2SNVA 3OX7U 2VJ1A 7LPRA 3TGKE 2H5CA 1GVLA 1K9OE 4WH6A 1RD3B 4UFGH 2QXJA 2ZNKH 2XC4A 2ZWLH 1GHZA 2ZEBA 1H8HD 1UVSH 3NK8A 1ELDE 1G3BA 3GCHC 3UNSA 3T2NA 1XVMA 1NRGA 1KXBA 2Z3DA 3FFGA 3MU8A 2OL5A 4JZDH 1O2WA 1HDTH 3KQ5A 3TPIZ 2HNTE 1G79A 3R3GB 2BVXH 2NU0E 1THSH 3KYFA 5C1UA 1NRPH 2HNTF 3GCNA 2PKSC 1NFYA 2R3YA 3PV4A 4Z6AH 1LPKB 5DP8A 3TK6A 5GIBA 2PHBA 3EE0B 2NR4A 2FTLE 2ZCHP 2FX6A 1C1OA 4XOJA 2VH0A 1D3QB 1AKSB 3V13A 3SU1A 1D3TB 2GT8A 1ZGVA 1QL7A 4Q2KA 4ZHMU 2WUBA 2THFB 1TOCB 4X1RU 3A86A 2D37A 1FAXA 1ZGIA 2PWXA 1A5IA 3RXSA 1ZMLA 3O8CA 4I8HA 2A7HA 2Y81A 4RT1A 5AHGH 4WMDA 1P9UA 1FQ3A 4CH2B 1C2LA 3EE7A 2XW9A 3KQCA 3F9FA 1TGTA 4R82A 1T32A 1W2KH 3LDXH 4WXVA 3GCTG 3ATIA 3PV2A 2OBQA 2BVSH 1C9TA 4FUCA 3TGVA 1L0ZA 1C4U2 3UB0A 2TGTA 2W7UA 1O3LA 4X1NU 2J9NA 4SGBE 4NIYA 4O3TA 4TWWA 1OP2A 1EUFA 1TRNA 3EA8A 1GI3A 2OK5A 2J98A 2GV7A 3CS0A 4XD7D 3T62A 3K87A 4BTUB 5EPYA 1HCGA 3A7VA 2KAIA 1TMUH 3ZVAA 1TPSA 4BAOB 2BLOA 1EJEA 3M3VA 1HJ8A 4XBBA 3UR9A 1W7GH 1O3BA 2HQ9A 4ZHLU 1YCPM 3R5LA 1SKYE 4FOUC 5EU8A 3RXGA 3B5MA 2H9EH 1QA7A 3SV2H 1C2GA 4B75A 2A45B 1RTKA 1N6XA 3WY8A 1O3PB 3GISB 1JNWA 2D8WA 3KEEA 4X0WU 2A4QA 3SU4A 3IITA 3OYPA 1CGHA 1UVOA 5H4IB 3SNEA 1ELFA 1FV9A 1Q31A 2PV9B 2O8TA 2ZGHA 2XC5A 1SLWB 5DP3A 5FCRA 1S81A 4F4OC 1NT1A 2O8UA 3G01A 3EC6A 1P57B 2VPAA 2H5DA 1A1RA 2QAAA 4X2YA 3VFEA 2O8LA 4INHA 1CBWB 1O2RA 2BYAX 1W0KD 3VXFH 1WLKA 3GY4A 3RUOA 2EI6A 1W12U 3P8GA 5KGOA 5T3HA 4MTKA 1BQYA 1TFXA 3PMHB 2KCPA 2ASFA 1K2I1 4YO9A 5B6OA 2Z9KA 1DXWA 1LVMA 2TGDA 2IOTA 1IQNA 2Z9GA 4Q7ZA 2M2AA 2V3HH 3L3TA 4JMYA 3PRDA 1IQGA 5LPRA 2VU8E 4Q7XA 1UO6A 2ODQA 3T25A 1TMTH 4AOQA 1BDAA 1O2ZA 5A8ZA 4FUGA 1AE5A 1ZR0A 4X6OA 1GI7B 2ZGXH 2K8IA 2ULLA 2AHME 3R0FA 3VB5A 3UQOA 2W5EA 1XM1A 3RM0H 1Y59T 1FNIA 2B7DH 5L6NH 3URDA 3CP7A 1VL7A 2FXRA 1GCTC 2JJ1D 3AW1A 4NSVA 4ISLA 1B0EA 1XUFA 1TPPA 3BTQE 3ATLA 1TGNA 3RXHA 1HJ9A 1C5MD 4FUFA 3SGBE 2B0FA 5IDKA 1GPZA 2WYGA 2P59A 3MFJA 2FMJA 2FOEA 4AG2A 2I6QA 5EW2H 2D5MA 3BEIB 1S0RA 4Y8ZA 3VGCB 1GBLA 2E83A 2BD7A 1KLJH 1EXFA 4OS4A 1FXYA 1GI8B 2QF0A 3H5CB 1C2HA 1D6WA 2ZU1A 4I8LA 1B5GH 3BTTE 3ZOEA 1UCYE 3KQDA 2R0KA 1OHHD 1AFQB 3F6UH 1GI5A 3MI4A 3STJA 1YLDA 3VYAA 4I8JA 1TX6A 1K1MA 4TY7A 2FYQA 1ZMJA 1AKSA 1QB6A 1WDIA 3SWJA 4IN1A 1TA2A 1NRQH 1MCVA 1EAIA 4GUXA 2AIQA 1GJ8B 3SUFA 2ANKH 1GMDF 4Y7BA 3V3MA 5LPEA 1ZTKA 1DUEA 3SBKA 4AFSA 3UWIA 1UTKA 3A83A 2FODA 1TY9A 2ZPSA 5ETXA 3SHCH 4A5TS 5JBCS 4YXWD 2Y6TA 3UIRA 1BTYA 1ABJH 3RDZA 3GDUA 4CH8B 1Y5BT 1MZAA 3GY7A 4XHYA 4HFPB 3A20A 3RMNH 1CT2E 3MWIU 3SGQE 1Z7KA 1C2KA 2D38A 2PTFA 3ZVFA 1HB0B 1WTHD 2ESTE 1TPOA 2GJGA 3PO1B 1ZTLA 3OTPA 4MQAA 1QZ8A 3NFWA 3KQBA 2OC7A 2BMGB 2FOCA 4NCYA 4UD9H 1QRWA 4LOYH 1DWDH 4HTCH 2NU1E 1OSSA 1RTFB 4BAHB 1FI8A 1MAXA 3BIUH 2H9HA 1BT7A 1SC8U 1X7AC 5E2PA 1K1JA 1KXAA 1LVYA 4CBNA 3LJOA 4TY6A 4A92A 3BTGE 3EDXB 3FZDA 1UTMA 1GHBG 2ZHQH 2PGQB 4KKDA 1ELVA 5AFYH 1AWHB 1L1NA 4F49A 4CR5A 1A0LA 4IMZA 1SLVB 3A81A 4ASUD 1GJAB 2G4UA 1A46H 4I32A 1AXJA 2DUCA 3R5PA 1YPKH 1TNIA 1LQEA 1O3HA 2F91A 4NFEA 1O2LA 1HUTH 1GMHF 2HTDA 2Z94A 4OM9A 4CBOA 3RXVA 2AERH 1UK4A 1ZTJA 5HMAA 2CJIA 1DY8A 1V2LT 4ABJA 2Y7ZA 3OU0A 3RC5A 4BOHA 3TNSA 2J97A 2ZPRA 4GVUA 3HK6B 1O2HA 5CE1A 1P03A 4OS7A 1LKAA 2GZ7A 1JRSA 4Y10E 2TBSA 4YTAA 3E4VA 2ZKSA 2XC0A 4LZ4B 1C2MA 1VITF 3F9EA 2HVYB 2PKAA 2VIWA 3S7KB 3UR6A 1YLNA 1C2IA 3R5RA 1F5RA 1OOKB 1SGPE 1XMNB 2ECRA 1L4ZA 1K1LA 1WXRA 1GJ7B 3A7ZA 5FBIA 1TWXB 3UREA 1Y8TA 1UW7A 2ZGJA 1FX0B 1GJ4H 3ZV8A 4PROA 3U1JB 1EPTB 1FIZA 2YMSD
chains in the Genus database with same CATH topology
1G79A 2FHQA 4L82A 3HY8A 4HMSA 2X1KA 1W9AA 5CHEC 1WLKA 1WV4A 3KYFA 3CNRA 1YWUA 1T9MA 5KGOA 5ESCA 1CI0A 5EJLA 3DMBA 2ASFA 4XHYA 3A20A 1RFEA 2HTIA 1WGBA 4Z85A 4HMVA 3F7EA 2D38A 2PTFA 2NR4A 3BA3A 2GJGA 1I0RA 3RH7A 4YWNA 2ED4A 4IRAA 3NFWA 2FG9A 2D37A 3VY5A 3KYGA 3BPKA 1XHNA 4QVBA 4RT1A 2OU5A 2HQ7A 3ZOCA 3R5ZA 3ZOGA 1G77A 1W3OA 5JABA 1W3RA 4F07A 3ZODA 2AQ6A 4R82A 2IG6A 1YOAA 2R6VA 3AMFA 1USFA 1VL7A 1W3QA 1XXOA 4HMTA 3A6RA 3GASA 3TGVA 5EIYA 2HHZA 2L74A 3ZOHA 5KECA 2Q9KA 5CHOA 1AXJA 4P02A 3FKHA 2RE7A 3R5PA 1Y30A 3A6QA 3IN6A 2ARZA 4XJ2A 1USCA 4HMUA 1W3PA 2RDEA 4HG6A 4HMXA 2HTDA 2D5MA 3K87A 2E83A 3CB0A 3FGEA 4N7RC 1DNLA 3BNKA 2I02A 3H96A 1EJEA 3VY2A 3ZOEA 2HQ9A 2ECUA 3HMZA 1FLMA 2X1JA 3R5LA 4ZKYA 4FOUC 4YBNA 3B5MA 2IMLA 2IABA 2I51A 2D36A 4Y9IA 3VYAA 4I86A 4HX6A 2QEAA 3E4VA 4HMWA 4RT0A 3SWJA 2R0XA 5EJ1A 3K88A 3U5WA 1JNWA 5KEDA 1YLNA 3DSGA 3R5RA 3U35A 2A2JA 2ECRA 3K86A 4XRNA 1RZ1A 2QCKA 4F48B 3R5YA 3CP3A 3AWHA 1WLIA 3DNHA 1I0SA 3U0IA 1G76A 5BNCA 3EC6A 1NRGA 1TY9A 5EJZA 4P00A 2VPAA 3DB0A 3PFTA 3R5WA 1RZ0A 3U34A 2OL5A 1G78A 3ZOFA 2FURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G79 A;  2FHQ A;  4L82 A;  3HY8 A;  4HMS A;  2X1K A;  1W9A A;  5CHE C;  1WLK A;  1WV4 A;  3KYF A;  3CNR A;  1YWU A;  1T9M A;  5KGO A;  5ESC A;  1CI0 A;  5EJL A;  3DMB A;  2ASF A;  4XHY A;  3A20 A;  1RFE A;  2HTI A;  1WGB A;  4Z85 A;  4HMV A;  3F7E A;  2D38 A;  2PTF A;  2NR4 A;  3BA3 A;  2GJG A;  1I0R A;  3RH7 A;  4YWN A;  2ED4 A;  4IRA A;  3NFW A;  2FG9 A;  2D37 A;  3VY5 A;  3KYG A;  3BPK A;  1XHN A;  4QVB A;  4RT1 A;  2OU5 A;  2HQ7 A;  3ZOC A;  3R5Z A;  3ZOG A;  1G77 A;  1W3O A;  5JAB A;  1W3R A;  4F07 A;  3ZOD A;  2AQ6 A;  4R82 A;  2IG6 A;  1YOA A;  2R6V A;  3AMF A;  1USF A;  1VL7 A;  1W3Q A;  1XXO A;  4HMT A;  3A6R A;  3GAS A;  3TGV A;  5EIY A;  2HHZ A;  2L74 A;  3ZOH A;  5KEC A;  2Q9K A;  5CHO A;  1AXJ A;  4P02 A;  3FKH A;  2RE7 A;  3R5P A;  1Y30 A;  3A6Q A;  3IN6 A;  2ARZ A;  4XJ2 A;  1USC A;  4HMU A;  1W3P A;  2RDE A;  4HG6 A;  4HMX A;  2HTD A;  2D5M A;  3K87 A;  2E83 A;  3CB0 A;  3FGE A;  4N7R C;  1DNL A;  3BNK A;  2I02 A;  3H96 A;  1EJE A;  3VY2 A;  3ZOE A;  2HQ9 A;  2ECU A;  3HMZ A;  1FLM A;  2X1J A;  3R5L A;  4ZKY A;  4FOU C;  4YBN A;  3B5M A;  2IML A;  2IAB A;  2I51 A;  2D36 A;  4Y9I A;  3VYA A;  4I86 A;  4HX6 A;  2QEA A;  3E4V A;  4HMW A;  4RT0 A;  3SWJ A;  2R0X A;  5EJ1 A;  3K88 A;  3U5W A;  1JNW A;  5KED A;  1YLN A;  3DSG A;  3R5R A;  3U35 A;  2A2J A;  2ECR A;  3K86 A;  4XRN A;  1RZ1 A;  2QCK A;  4F48 B;  3R5Y A;  3CP3 A;  3AWH A;  1WLI A;  3DNH A;  1I0S A;  3U0I A;  1G76 A;  5BNC A;  3EC6 A;  1NRG A;  1TY9 A;  5EJZ A;  4P00 A;  2VPA A;  3DB0 A;  3PFT A;  3R5W A;  1RZ0 A;  3U34 A;  2OL5 A;  1G78 A;  3ZOF A;  2FUR A; 
#chains in the Genus database with same CATH topology
 4E06 H;  1ELE E;  3LC3 A;  5PTP A;  2FHQ A;  2JH5 D;  4UFD H;  1HLT H;  1HAO H;  2X1K A;  2VGC B;  1F0T A;  1EB2 A;  1TNL A;  1CA8 B;  1GBM A;  2VID A;  1O3I A;  3LGV A;  2IJD 1;  5LPF A;  1TMB H;  2HTI A;  7GCH F;  1WQS A;  6CHA B;  1AVG H;  4NIW A;  4TPI Z;  3V7T A;  4JZF H;  3HE1 A;  1SB1 H;  4NIV A;  1ELC A;  2W26 A;  1LKB A;  4MPU A;  1YP9 A;  3OAA D;  2QC2 A;  2EQN A;  1Z8I B;  1IHS H;  1O3C A;  4ZKN U;  4TWY A;  3VY5 A;  1FPH H;  3ZZD A;  1RIW C;  2VWM A;  3I78 A;  2SGF E;  2ODP A;  5F53 A;  1HAZ B;  1DLK B;  1E79 D;  2RDL A;  4KP0 A;  2QXH A;  1ZYO A;  1GHW H;  2ZDV H;  1DIT H;  1F5L A;  1GJ5 H;  3TK9 A;  2R6V A;  3TJN A;  5I25 A;  1QBN A;  2F9U A;  2BDA A;  3SU6 A;  1OWD A;  2GDD A;  1IOE A;  1QJ6 B;  1TRM A;  1IQF A;  2UUJ B;  1TRY A;  1FON A;  1MBM A;  2ZDK A;  4RKO B;  2OIN A;  3F68 H;  2RE7 A;  1K22 H;  1PQ8 A;  3DFL A;  4Y0Y E;  2C8Z B;  4B2A A;  3VB6 A;  1SG8 B;  1WTG H;  3ZZ3 A;  1NC6 A;  4HG6 A;  1GVK B;  4NZL A;  5GJ4 B;  3HGN A;  3LPR A;  1F7Z A;  1O2J A;  3V12 A;  4X8T H;  1KXD A;  1EP6 A;  1C5O H;  1BTU A;  2WYJ A;  2F9O A;  3L33 A;  4CRF A;  1T7C A;  5K7R A;  1BA8 B;  1NU7 B;  3LGY A;  2ECU A;  1KXF A;  2ILN A;  1P3E A;  1RGQ A;  2WV9 A;  1GHY H;  1GJ9 B;  1HAP H;  1YPL H;  3P8F A;  1E38 B;  3ZV9 A;  4X6N A;  1UVT H;  2A5A A;  3B9F H;  1CGI E;  5GXP A;  3UTU H;  3U35 A;  1VCW A;  4I7Y H;  3K86 A;  4FUH A;  4K1S A;  1RZ1 A;  1TBQ H;  1SGF G;  4F48 B;  2CXV A;  1V2J T;  1GMC G;  1LHG H;  3P70 B;  4X1S U;  4GCH F;  1G3C A;  1ID5 H;  2ZGB H;  3AW0 A;  3PMA B;  2BLV A;  3ZVD A;  3QN7 A;  5C17 A;  1L4D A;  3DSO A;  1NTP A;  1O2O A;  2Y5H A;  3B8J A;  1KSN A;  1EP5 A;  1BRB E;  4BAM B;  1LCY A;  4WXI A;  3SV8 A;  2R9P A;  5BRR E;  2B5T B;  1BBR K;  1S6F A;  4BNR A;  1P2K A;  1QGF A;  3BTD E;  1KTS B;  1T9M A;  1UTN A;  2PLX A;  4MG3 A;  3QGJ A;  5T6F A;  2BB4 A;  2BY9 X;  2IPQ X;  5E2O A;  3GYM A;  5FBE A;  4D7G A;  3QZQ A;  3F7E A;  2G8T A;  4QT8 C;  1UCY K;  2UWL A;  2J95 A;  3N7D A;  2P93 A;  2ZDM A;  4B76 A;  2FPZ A;  1LDT T;  2GP9 B;  1H1B A;  1H9L B;  1NU9 A;  1ARC A;  1SPJ A;  2XWB I;  2ZG0 H;  3M7U A;  1SGI B;  2G81 E;  3BPK A;  1S82 A;  5DP9 A;  1ZMN A;  1HAI H;  2Z6B D;  3EAA A;  4BXS A;  5C94 A;  3V4H A;  3ZOC A;  2ODY B;  2AGI X;  5JAB A;  3RXU A;  1NN6 A;  2GCH G;  1TAW A;  1EST A;  1H8E D;  1OX1 A;  1SQA A;  5GPI B;  4HMT A;  4INL A;  4LXB H;  2AIP A;  3RML H;  1EFR D;  1MKX H;  1ZHR A;  2ZTY A;  5E8E H;  2B9L A;  3ZOH A;  1Z6J H;  3SQH E;  3O8D A;  5I46 H;  1ZSJ A;  4Y0Z E;  3FAN A;  1DX5 M;  1OWI A;  4XJ2 A;  3P17 H;  2G52 A;  2WUC A;  4M7G A;  5T1V A;  2NU2 E;  1Y3Y A;  1EPT A;  1V2P T;  4WF8 A;  1QCP A;  1BIO A;  1FN6 A;  1H9H E;  2UUK B;  3QWC H;  2P8O C;  1EAW A;  3KNX A;  4H42 U;  1CHO F;  4JK5 A;  3ZVB A;  4HI3 A;  4DCD A;  2I02 A;  2GV6 A;  2BD5 A;  2GMT B;  3LU9 B;  1P11 E;  3GIC B;  1EZQ A;  1JIM A;  3NXP A;  1O39 A;  3VEQ B;  1W3C A;  3I77 A;  5A8X A;  4FU9 A;  1BTH H;  2A4G A;  1SSX A;  1JWT A;  1LTO A;  2OCV B;  4ZXX H;  1F92 A;  1EOJ A;  1SGT A;  1Z1J A;  2A2J A;  2ZFP H;  4X2V A;  1GHA G;  1P9S A;  1RS0 A;  2GZ9 A;  3RM2 H;  3S9C A;  1ORF A;  2QYI A;  1HAG E;  1EAS A;  4KTC A;  3U8T H;  3GY2 A;  1XVO A;  5BNC A;  2ZCL P;  3L6P A;  2FTM A;  3TU7 H;  4P00 A;  3DB0 A;  1DST A;  3QX5 H;  2ZHW H;  4UEH H;  4Z1M D;  1FY5 A;  3OY6 U;  3ZOF A;  1YPH E;  2FX4 A;  4HMS A;  3VB4 A;  3HPT B;  1AUJ A;  1YCP K;  3KHV A;  3Q3K A;  1ZZZ A;  1NY2 2;  4DOQ A;  1CI0 A;  1C1T A;  1W0Y H;  3Q77 A;  3WW7 A;  5CHA C;  2AEI H;  1S85 A;  2YMS C;  1MAY A;  2CF9 H;  1N8O B;  1GDQ A;  2CHA B;  2H6M A;  7EST E;  4DVA U;  4YWN A;  1VCQ A;  2CF8 H;  1LHF H;  2WPK S;  1YF4 A;  1ELB A;  1FY1 A;  1DLE A;  2AGE X;  2EI8 A;  4NG9 H;  8GCH F;  2XBW A;  2F4L A;  1FY8 E;  1Y5A T;  3P8N A;  3ZZ6 A;  3A7T A;  3SI4 H;  4MPV A;  3AVZ A;  4QVB A;  2K0Q A;  3R5Z A;  5FPT A;  1HGT H;  1HFD A;  2VIN A;  3N99 A;  2DE9 A;  2UUY A;  3CEN A;  2C8Y B;  2ZU4 A;  2ZDA H;  2IG6 A;  4MVN A;  1D3P B;  2PW8 H;  2A5I A;  1C5U A;  1KXC A;  2FOB A;  1O3F A;  1YGC H;  1QB9 A;  1GVZ A;  1C9P A;  4JZE H;  4DT4 A;  1H8I H;  2QF5 A;  1SGE E;  1BHX F;  4XBD A;  2ZFQ H;  3KQE A;  2VVV A;  3MQK C;  1THP B;  5CHO A;  4AB8 A;  1J16 A;  3QK1 A;  5HXF A;  3SGA E;  3GCH B;  3ZVG A;  3TGI E;  1WQV H;  3BF6 H;  3ZZA A;  1SHY A;  2QF4 A;  4I31 A;  1V2V T;  2FYR A;  2FP7 B;  1Y12 A;  4X2X A;  2V6N A;  3OFN D;  4K69 A;  2L1T A;  1O36 A;  3RU4 D;  3PLB A;  1CE5 A;  1GBF A;  3M61 U;  2BY5 X;  1UK3 A;  1BIT A;  1AB9 C;  1S6H A;  5JB8 S;  5JBA S;  2PKS B;  3EQ0 H;  3SN8 A;  1Y3X A;  2XNI A;  3SV9 A;  4BAK B;  5DG6 A;  4A6L A;  3KID U;  2RFK C;  1GCD A;  1CT0 E;  3MH5 A;  4NWK A;  3U5W A;  4AN7 A;  1BTW A;  4AFU A;  2FEQ H;  1VKY A;  1P12 E;  3W94 A;  2K1Q A;  2SNW A;  5C20 A;  3CP3 A;  1UVP A;  2D2D A;  1TYN A;  2L6O A;  1YC0 A;  1P2N A;  4MNW A;  3A80 A;  1UTO A;  3SV7 A;  3ZIA D;  1DAN H;  1P04 A;  1TPA E;  2TIO A;  3QUM P;  5FPY A;  4DIH H;  2PUQ H;  3SOS A;  1HJA B;  1O5F H;  1CGJ E;  1KYN A;  1SOZ A;  1QBV H;  1SQT A;  2ZDN A;  1HAX B;  2GTB A;  3O8B A;  2GGV B;  1W7X H;  1O5B B;  1SOT A;  1T8L A;  1CBW C;  1V2M T;  2F9B H;  4LZ1 H;  1QJ7 B;  1I0R A;  2A0Q B;  1E1R D;  1MTN C;  2Z7F E;  4VGC C;  2BXU H;  1SGD E;  2G5N A;  2FG9 A;  3RXJ A;  1E36 B;  4OS5 A;  2XYA A;  2HGT H;  3GOV B;  3LIW A;  1HIA B;  1XHN A;  4FUE A;  2XWA A;  2BOK A;  1XUI A;  2GX4 A;  5GWZ A;  4Y8Y A;  1G2L A;  5GND A;  1SGR E;  2ANM H;  1A7S A;  4ABG A;  1NZQ H;  3LT3 A;  2RCE A;  3ZZ9 A;  1ZOM A;  1BML A;  5ABW A;  4MTB A;  1L2E A;  4NA8 A;  1GDN A;  1TNG A;  1TAB E;  3BV9 B;  1H8D H;  2AMD A;  1O5G H;  3N7E A;  2PKA B;  3MH6 A;  2BY8 X;  2QF3 A;  2V35 A;  5KEC A;  3MHW U;  1FDP A;  3GCT F;  2P3F H;  2ZI2 H;  2Q9K A;  3RXK A;  1ETR H;  3ODD A;  4FU7 A;  5LGO A;  1SMF E;  4IC6 A;  5DGJ A;  5GDS H;  1S83 A;  3M5L A;  4DY7 B;  3NPS A;  4ABD A;  1SVP A;  1TON A;  2F3C E;  4X8S H;  2QCY A;  2Z9J A;  5L2Y H;  1OYT H;  1DNL A;  1FZZ A;  3OTJ E;  1J14 A;  1S6L A;  1UTQ A;  2V7Q D;  3VY2 A;  1SBW A;  4CRG A;  3SYJ A;  4YOJ A;  2FOG A;  3FP6 E;  2X1J A;  4MNV A;  1PFX C;  3NZI A;  1C1W H;  1EAU A;  4B74 A;  2BD8 A;  2YNA A;  4FVD A;  3A8A A;  2GUJ A;  2A2Q H;  2SFA A;  1UMA H;  1BBR E;  3BSQ A;  3BEF B;  1AZZ A;  4K5Z A;  2OLG A;  4D9Q A;  3U8O H;  4ACB A;  2HRV A;  3AAV A;  3D62 A;  3BG8 A;  1MMJ N;  2B8O H;  3H7O A;  4DGJ A;  5L2Z H;  4D8N A;  3SV6 A;  1RZ0 A;  3PWB A;  3PMJ A;  4B6E A;  1IQI A;  5HIY A;  3RMO H;  1QQU A;  5B6L A;  1O37 A;  1GCT B;  1P0S H;  1W9A A;  1V2Q T;  4Y7A A;  1BZX E;  3FVF B;  3BTF E;  4M9F A;  3SNB A;  2PUX B;  3LGI A;  4HZH A;  3DMB A;  2VBC A;  4CHA B;  4WME A;  1NRO H;  5FCK A;  3MMG A;  3K65 B;  2Y5F A;  3FKS D;  1NRS H;  2Y80 A;  5AFZ H;  4ISN A;  1F5K U;  1MTU A;  1GMH G;  4ZH8 A;  1J17 T;  1DE7 H;  4MNY A;  2CGA A;  3U69 H;  1DT2 A;  2G5V A;  2W3I A;  4NWL A;  1ZSL A;  2ALP A;  1O5E H;  4XFQ A;  3F9G A;  2Z3C A;  2GDE H;  2EY4 C;  2FLB H;  2QXI A;  1P06 A;  1WCZ A;  5T6G A;  1KLT A;  1E34 B;  1QUR H;  3TIU A;  1QBO A;  1TNK A;  2BLW A;  4U30 A;  1A2C H;  5C5N A;  1MAB B;  1T8M A;  1MKW H;  1QNJ A;  4ABI A;  3RXF A;  5A09 A;  3FKH A;  2TGP Z;  9LPR A;  1VGC C;  1BTX A;  1G36 A;  5C1X A;  1AY6 H;  1A0H B;  1WAY B;  1W8B H;  1TA6 A;  1NES E;  1FY4 A;  1BOQ A;  1ZPC A;  4ZAE A;  5TJX A;  3LKW A;  3GY3 A;  3RXL A;  4D9R A;  2F9N A;  3TH4 H;  2FDA A;  1NS3 A;  1XX9 A;  1D6R A;  4IGD A;  2QY0 B;  2ZO3 H;  2WV5 A;  2FO9 A;  2ZHD A;  1J15 A;  1SR5 C;  1CA0 C;  1T4V H;  2IML A;  1PQ7 A;  3Q3X A;  4DT7 B;  1F0R A;  2Q6D A;  3E8L A;  3SJK A;  3M5O A;  5GCH G;  1ABI H;  1YBW A;  1C2F A;  4RT0 A;  4EST E;  1QIX B;  3E0N B;  1GGD C;  1MQ5 A;  1DVA H;  1XUH A;  4NFF A;  1DWB H;  2CK3 D;  2BDC A;  4JZI A;  1O31 A;  1IQE A;  3BIV H;  1QHR B;  3K6Y A;  4KTS A;  1RJX B;  2ZC9 H;  3AWH A;  1HIA A;  3OE7 D;  4Y71 A;  3ENS B;  3EGK H;  4ABF A;  2SGQ E;  1QFK H;  3FAO A;  2XTT B;  1DWC H;  3SNC A;  4DG4 A;  1PQA A;  2WHX A;  3RC6 A;  4NSY A;  4I8G A;  3BG4 C;  5IK2 D;  5DKM A;  1DFP A;  1UK2 A;  1TQ0 B;  5EQS A;  1TQ7 B;  4UFE H;  2R2M B;  3PMB B;  2ZFT A;  1DUA A;  5CHE C;  2DE8 A;  3SU3 A;  4YT7 H;  3RLW H;  1V2K T;  5JPM H;  5ESC A;  2JET B;  2VWN A;  2ALV A;  2XOK D;  4CRE A;  2TPI Z;  2IPH A;  1C1U H;  2VH6 A;  1B0F A;  2VGC C;  2Z9L A;  2GCT B;  1P2I A;  3RH7 A;  3DD2 H;  1D4P B;  1XUJ A;  4XDE A;  1C5W B;  3A8B A;  2BDI A;  1BJV A;  5A2M H;  4GSO A;  6CHA C;  1V2W T;  1DXP A;  4NGA H;  3DUX H;  2A32 A;  2AMP A;  3S0N A;  3RXD A;  1CO7 E;  3FP7 E;  1LQD B;  3S9A A;  1J9C H;  3MO6 A;  1NO9 H;  2O8M A;  1GBI A;  1S0Q A;  1DM4 B;  2AH4 X;  4IMQ A;  3BEU A;  3MH4 A;  3UFA A;  1PJP A;  1L1J A;  2ZU3 A;  5HM9 A;  1NFU A;  3MNX A;  2KFW A;  3ATW A;  1F0U A;  1O34 A;  1O2U A;  1Y3V A;  3DA9 B;  5CMX H;  1XXO A;  3T29 A;  2BY7 X;  1AE8 H;  2EI7 A;  4BTI B;  3W95 A;  1C5N H;  1V2N T;  3MO9 A;  3PRB A;  1LPZ B;  1GHB F;  5C5O A;  2VIV A;  1CT4 E;  2W6I D;  1VCP A;  3RXB A;  4FU8 A;  5E0G A;  4HMU A;  1OP8 A;  4BXW A;  3SUD A;  2AGG X;  2BQ7 B;  5FX6 A;  1C2E A;  3KGP A;  4K3J A;  1LPG B;  3PTB A;  1V2R T;  6EST A;  3EA7 A;  2UUF B;  2GT7 A;  3EYD A;  1WV7 H;  3QLP H;  2VIQ A;  4MNX A;  1MQ6 A;  3LH3 A;  3P92 A;  4O03 A;  1ZHP A;  4YBN A;  3T28 A;  1QRZ A;  3E3T A;  4AGK A;  4X2W A;  1AMH A;  2IAB A;  1TGB A;  2EEK A;  4Y9I A;  4NA9 H;  2WPL S;  5DP7 A;  4HKH A;  4YLU A;  1DIC A;  1SGN E;  5ESB A;  4E05 H;  4X8U H;  4WH8 A;  1KLI H;  1GG6 B;  2JJ2 D;  4GPG A;  1RIW B;  2ZIQ H;  1MTS A;  4WJG 2;  5TCA A;  1GI2 A;  3AAS A;  3SND A;  1I0S A;  3ZZ7 A;  1HYL A;  3LOX A;  4Y8X A;  1P2Q A;  1AU8 A;  5F6M A;  3MH7 A;  1P8V C;  3MTY A;  1U6Q A;  3E0P B;  4DW2 U;  4K60 A;  3A8C A;  4H6S B;  2OUA A;  3PTN A;  2BZ6 H;  4OGY A;  5EW1 H;  4L82 A;  1YPH C;  4KGA A;  3HY8 A;  1Q3X A;  3TJO A;  1GI9 B;  3P95 A;  1O2K A;  2XND D;  1W11 U;  2J94 A;  2P3T B;  1K28 D;  1NFX A;  1SLX B;  3MNS A;  3T27 A;  2OP9 A;  4A1V A;  3DT0 H;  6GCH G;  5HM2 A;  2P95 A;  1MU8 B;  4ISI H;  1TX7 A;  5JBB S;  4K2Y A;  3SO3 A;  3LJJ A;  1RTL A;  1OXG A;  4E7N A;  3V0X A;  1KMH B;  5LH8 A;  1GWA A;  1K0H A;  1C2D A;  3SJO A;  1FN8 A;  1MZD A;  2HPQ H;  5F8T A;  5A8Y A;  4CRC A;  2ZU5 A;  4CRA A;  3F3B A;  2Z9I A;  4XBC A;  2HNT C;  2AS9 A;  3SJ9 A;  1G77 A;  3VB3 A;  2RG3 A;  4K1T A;  1YPM H;  2GVF A;  3ZOD A;  1GBD A;  4JYV H;  2KCY A;  5HGG A;  1YOA A;  1N1L A;  2IJO B;  2PSX A;  5F03 A;  2SGD E;  3NRL A;  1SFQ B;  5EIY A;  3GAS A;  2SGA A;  4FVB A;  2ZGC A;  2HHZ A;  3SUG A;  2FOH A;  1G32 B;  1O2V A;  2C3S A;  1Z71 A;  1EQ9 A;  1HBT H;  2L74 A;  3KL6 A;  4FXG H;  2QGR A;  2ZFF H;  5JDU B;  3IG6 B;  2QE7 D;  1C5R A;  2Q6F A;  3IN6 A;  2ARZ A;  4WMF A;  1G2M A;  4R0I A;  2FOA A;  4OGX A;  3EAJ A;  2H2Z A;  3FOA A;  3OEE D;  4NA7 A;  4WVP E;  1BMF D;  1LMW B;  2KCA A;  1NPM A;  5HKK D;  4N7R C;  3SU0 A;  5C1Y A;  2A4O A;  3UWJ H;  2I6S A;  3PV5 A;  2TGA A;  1CSO E;  1TAL A;  1C1Q A;  3UNR A;  1GBC A;  1TGC A;  4GHQ A;  3NKK A;  2BD9 A;  3ZYE A;  2YOL A;  2J5U A;  2D36 A;  4INK A;  1FAK H;  1V2S T;  5JYI A;  2OTV A;  2ZU2 A;  3TJU A;  4XSK U;  2R2W U;  1SFI A;  1ANB A;  3VG8 A;  2PTN A;  3SU2 A;  3F0P A;  1V2O T;  3Q00 A;  3R5Y A;  3T26 A;  1V2T T;  3FP8 E;  4JCN A;  3TLO A;  4YES B;  4UFF H;  3MNB A;  3M35 A;  2SGE E;  4Y79 A;  2P94 A;  3PLP A;  2WPH S;  3A84 A;  1EZS C;  4FET A;  2QIQ A;  4B71 A;  1SQO A;  1TE0 A;  2HLD D;  1K1N A;  2AMQ A;  4K1E A;  3W1E A;  1O2Q A;  3ZZB A;  2F9V A;  3SI3 H;  1TX8 A;  3ATK A;  1QB1 A;  3Q76 A;  5EXN A;  1Y3U A;  2WV4 A;  5AF9 H;  1TB6 H;  4YZU A;  2WPI S;  2JKH A;  2C90 B;  1XKB C;  2PP6 A;  1BCU H;  2VIO A;  2FS8 A;  4U01 A;  4UDW H;  1GI0 A;  1NBM E;  2ZCK P;  2FOF A;  3QTO H;  3TK5 A;  3LH1 A;  4O3U A;  3D49 H;  3HKI B;  5HYO A;  1OP0 A;  3UPE A;  3PWC A;  1CHG A;  3F2G A;  4X8V H;  3NUM A;  2P8O B;  2CHA C;  3SOR A;  1AUT C;  3LC5 A;  4YOG A;  1HAH H;  1SL3 A;  1O35 A;  2XCN A;  1L1G A;  1ZLR A;  1OKX A;  4NZQ A;  5C67 A;  2SGP E;  1AI8 H;  5FHT A;  2AQ6 A;  2C4F H;  1GL1 A;  1Q2W A;  1FY3 A;  3GY5 A;  4CRB A;  1AN1 E;  4OS1 A;  5DP4 A;  4ZKR U;  1ELT A;  1SGF A;  3DSP A;  2A7J A;  4O97 A;  3URC A;  1PPB H;  4MLF B;  1SI5 H;  1OWJ A;  1HAV A;  2VIP A;  3F2H A;  1MBQ A;  4ZHA A;  1XUK A;  1OS8 A;  3SQE E;  4WWY A;  3O8R A;  4AX9 H;  5EQQ A;  2FM2 A;  3M5M A;  4TYD A;  1DSU A;  5DSF A;  1JOU B;  4GAW A;  2OD3 B;  1NRN H;  2FS9 A;  2HWL B;  2PR3 A;  1WSS H;  4ZUH A;  3RXO A;  1PPH E;  3TH2 H;  1UJ1 A;  3MYW A;  4JYT A;  2ZZU H;  1DDJ A;  2XBV A;  4BAQ B;  1O38 A;  1KTT B;  2Y7X A;  5CHA B;  3UOU A;  2Q1J A;  3BTM E;  1TOM H;  2YMS B;  1SHH B;  4I86 A;  2HOB A;  1OYQ A;  2QEA A;  2FES H;  1P3C A;  1RRK A;  2OC8 A;  2XBX A;  2R0X A;  5EJ1 A;  1O3D A;  1O3K A;  1AIX H;  3K88 A;  2CN0 H;  3GY6 A;  5KED A;  2KM0 A;  2M5T A;  1O5A B;  1KIG H;  3U98 H;  1GHV H;  2ASU B;  4Q4L A;  3CS7 A;  1NRR H;  5AVD A;  1WLI A;  3DNH A;  3UY9 A;  1DS2 E;  1GBH A;  1G76 A;  3A7Y A;  3E6P H;  3VXE H;  2FIR H;  1IQJ A;  5EJZ A;  3RXC A;  9EST A;  3BTE E;  5EXL A;  3U34 A;  1GHA F;  1UTP A;  3SW2 B;  4ASH A;  4UON A;  1ANE A;  3M5N A;  1RXP A;  2STA E;  3ZVC A;  2G51 A;  2QN5 T;  3RC4 A;  2JH0 D;  4W64 A;  1AHT H;  1UHB A;  1YWU A;  4Y11 E;  1C5X B;  2O8W A;  1MD8 A;  3I29 A;  1K1O A;  4TSF D;  1FLE E;  4YM9 A;  1OWH A;  1FPC H;  1HJA C;  4B6F A;  2BZA A;  8EST E;  1QL9 A;  1O3E A;  1PPG E;  2BXT H;  1ZSK A;  1FUJ A;  1LHE H;  1P2J A;  4ZCN A;  1SQR A;  1P2M A;  3NWU A;  3RXM A;  3M3T A;  5C3N A;  3SZE A;  3LGW A;  1Z8R A;  1C5Z B;  1HPG A;  1QR3 E;  1G30 B;  1IHT H;  2BY6 X;  3RU4 T;  2PGB B;  1W3O A;  5EXM A;  1W3R A;  1AB9 B;  1O2Y A;  1O2M A;  4F07 A;  1N6Y A;  1ELA A;  1MCT A;  2AYW A;  3M37 A;  4WY3 A;  2FOM B;  1GI6 A;  2NWN A;  5J4S A;  1O2I A;  1USF A;  1GBK A;  4KEL A;  1DOJ A;  5DO4 H;  2H9T H;  4E7R G;  1IQK A;  2XCF A;  1F0S A;  2Z3E A;  1DY9 A;  1M9U A;  2FI4 E;  4CRD A;  1MKX K;  2KZ4 A;  1MU6 B;  2UWO A;  4U32 A;  1YPE H;  3E16 B;  4B2C A;  1P09 A;  5F8Z A;  1QY6 A;  1TGS Z;  3CB0 A;  1D9I A;  3BNK A;  4TPY A;  4DJZ B;  2UWP A;  1YKT A;  1Z8G A;  1BJU A;  2VWL A;  1CU1 A;  4ZKY A;  1W14 U;  3PYH A;  2CMY A;  5EST E;  1E35 B;  1GMD G;  1KXE A;  3RXE A;  5FXL A;  1C1R A;  1AQ7 A;  1P02 A;  4HMW A;  1IQH A;  4UE7 H;  2Q6G A;  8KME 2;  1MTN B;  2J38 A;  4VGC B;  3A82 A;  3SHA H;  3A7W A;  2F43 B;  3UUZ A;  1Y5U T;  1YY3 A;  3M7Q A;  2J4I A;  1YM0 A;  3S7H B;  1O3N A;  1V2U T;  1BMM H;  3VGC C;  1IAU A;  2A1D B;  1H9I E;  1VJ9 U;  3M36 A;  1YYY 1;  5CDF E;  1O3M A;  3U9A H;  4U2W A;  4AOR A;  1O2N A;  2BQ6 B;  2G55 A;  3KCG H;  3F2F A;  1BRA A;  1LVB A;  4OS6 A;  1BMA A;  1S5S A;  1CQQ A;  3JZ2 B;  1WU1 A;  2WZQ A;  1NBM D;  5A0C A;  3ELA H;  4Q7Y A;  1WGB A;  1AFQ C;  1GI4 A;  1EAX A;  1EOL A;  1WBG B;  3P8O A;  4Q80 A;  1OPH B;  2QXG A;  2WPD D;  1TNH A;  4IBL H;  1W0J D;  4IRA A;  5C2Z A;  4CHA C;  3SJ8 A;  4FUI A;  4X6P A;  2H1U A;  2ZFR H;  1LO6 A;  1XUG A;  2OC0 A;  3M3S A;  4ABH A;  3IWM A;  3RXA A;  4MDS A;  4H4F A;  2HQ7 A;  1ETT H;  1GJC B;  1T4U H;  2J92 A;  3RXT A;  1RFN A;  3FZZ A;  1MD7 A;  1PPZ A;  4I33 A;  1O3A A;  4UHV A;  2BDY A;  1V6D A;  3AAU A;  1HRT H;  1PYT D;  4F55 A;  3ZVE A;  1P10 A;  3HAT H;  4K8Y A;  1ZRK A;  1ARB A;  2IN2 A;  2GKV E;  8LPR A;  2LPR A;  3MO3 A;  5TCC A;  1GL0 E;  1O30 A;  1XKA C;  1AND A;  3MU1 A;  3VPK A;  2VNT A;  1BMN H;  2XXL A;  4KTU A;  4AG1 A;  1LVO A;  3F9H A;  2QV1 A;  3DHK H;  2F9P A;  2J34 A;  2ZHF H;  5CHB A;  2RA3 A;  3PO1 C;  3A89 A;  1W3P A;  2RDE A;  1VJA U;  2G4T A;  3GDV A;  2ZEC A;  2BLQ A;  1SGC A;  2A5K A;  2ZTX A;  1O3O A;  3H7T A;  3U1I B;  1A3B H;  3HKJ B;  3DFJ A;  1GBJ A;  5K0H A;  3RXR A;  3K2U A;  2VB0 A;  4X6M A;  1VIT G;  1GBE A;  5EOK A;  3AK5 A;  3LGU A;  1AZ8 A;  3HMZ A;  1FLM A;  3ZZC A;  2W6J D;  2KCO A;  3ODF A;  5DP6 A;  1EKB B;  1PPF E;  4FUJ A;  2ZQ2 A;  2ZP0 H;  3KN2 A;  3H09 A;  2BD4 A;  2QA9 E;  2R3U A;  3JZ1 B;  4H6T A;  1QJ1 B;  4THN H;  3MOC A;  2K4Q A;  3WWF A;  2KR7 A;  1YPJ H;  2JH6 D;  2F83 A;  4JK6 A;  2P16 A;  5EQR A;  3K6Z A;  3PFT A;  3R5W A;  1BBR H;  2V0B A;  2WPJ S;  2O9Q A;  2ZHE H;  1G78 A;  5IYT A;  1C1M A;  2BD2 A;  2OBO A;  2XRC A;  7GCH G;  1O5C B;  1JXP A;  2HLC A;  2BDG A;  4GLY A;  1P05 A;  2GZ8 A;  1TBZ H;  2HVX A;  5EJL A;  4YOI A;  1Z8J B;  3A87 A;  1UCY H;  1SGY E;  5JB9 S;  1UVU H;  2NU3 E;  3S69 A;  2OQ5 A;  1EZX C;  3MNC A;  1G3E A;  1VGC B;  4R8T B;  2C8X B;  2A2X H;  1O0D H;  1QRX A;  3PB1 E;  1D3D B;  2JET C;  2ED4 A;  1F2S E;  4LK4 A;  1HAY B;  1LHD H;  1XXF A;  1DPO A;  3QZR A;  1AVX A;  3BN9 A;  1WUN H;  1W10 U;  3KYG A;  1MTW A;  2GCT C;  1AWF H;  1PPC E;  2PTC E;  2OU5 A;  1E1Q D;  4TV4 A;  2R0L A;  1G3D A;  2XBY A;  5FAH A;  3RLY H;  5C0U A;  1UTJ A;  3SUE A;  5EGM A;  4ABA A;  1INC A;  2FLR H;  1O3G A;  1CA0 B;  1KDQ B;  1EPT C;  3OY5 U;  4MPW A;  4X1Q U;  1BB0 B;  3BTK E;  2LNC A;  1UTL M;  5DK1 A;  1C5P A;  1GJ6 A;  4SGA E;  2OQU A;  2OC1 A;  1C1V H;  1DWE H;  1GGD B;  3RMM H;  1WYK A;  4J1Y A;  5SGA E;  1EZU C;  1O2G H;  4AC9 A;  4B2B A;  2HPP H;  1C5Y B;  3HGP A;  1JRT A;  2A31 A;  3A6Q A;  4K8B A;  4IC5 A;  2V3M A;  1ANC A;  3N7O A;  4ACA A;  1LHC H;  2TRM A;  1YLC A;  3QO6 A;  1USC A;  3D65 E;  3LON A;  5DP5 A;  4HMX A;  1V3X A;  1ZJD A;  1A0J A;  1C5S A;  3FO8 D;  4I8K A;  3BG4 B;  2ANY A;  5DPA A;  3QGN B;  1EJN A;  5L30 H;  4AZ2 B;  3WWB A;  4O9V A;  2Y82 A;  1ZRB A;  4OS2 A;  5JBT A;  1C4V 2;  3H96 A;  3E1X B;  2BOH B;  1AFE H;  2LEL A;  2ANW A;  1ESB A;  3BTH E;  3TJV A;  4ZKS U;  3T5F H;  1EX3 A;  3P6Z B;  1YPG H;  2EC9 H;  4HGC A;  1GHX H;  1C5T A;  4GCH G;  2BX3 A;  2PSY A;  1K21 H;  3ZZ5 A;  1HXE H;  3DSG A;  3TNT A;  3U8R H;  4DUR A;  1O2X A;  3S9B A;  4JZ1 A;  1ETS H;  5FX5 A;  5GCH F;  1J8A A;  1BTP A;  1TBR H;  4DII H;  3QDZ B;  3SU5 A;  2G00 A;  2ZPQ A;  1E37 B;  2W7S A;  1TIO A;  3PRO A;  1FIW A;  1YCP H;  2BDB A;  3GYL B;  1GG6 C;  3C27 B;  5A0B A;  1GI1 A;  2ZDL A;  2FI3 E;  5DJ7 A;  3EST A;  4ZKO U;  4ABB A;  1ZHM A;  1WV4 A;  2WSS D;  1JMO H;  3B23 B;  7KME H;  3UOP A;  2VWO A;  1T8N A;  3LGT A;  4Z85 A;  1HAV B;  3D23 A;  4HMV A;  2BHG A;  1VIT H;  4J2Y B;  5FL7 D;  1C5V A;  3RXP A;  1P2O A;  1C5L H;  1P01 A;  2YNB A;  4YT6 H;  2PFE A;  1C1N A;  4D76 A;  3MU4 A;  5EG4 A;  1SLU B;  1GBT A;  4ZRO A;  5FPS A;  4RSP A;  1GJD B;  1ESA A;  3E90 B;  2BD3 A;  1W0Z U;  2BM2 A;  3GS9 A;  4FUB A;  5G4B A;  2C93 B;  4AFZ A;  1FMG A;  1BUI A;  2FWW A;  3STI A;  1GBA A;  3GY8 A;  2FZZ A;  3E91 A;  3SZN A;  2GD4 B;  3RXI A;  1BTZ A;  3AMF A;  2ZF0 H;  4A1X A;  1Y3W A;  1OWK A;  1TNJ A;  1A5G H;  1AD8 H;  1JIR A;  2BTC E;  2JIZ D;  2OXS A;  4NIX A;  5E0J A;  3A6R A;  2EA3 A;  1A3E H;  3GCO A;  5BPE A;  1COW D;  2BDH A;  4AB9 A;  5J4Q A;  2A7C A;  4P02 A;  2J2U A;  1EB1 H;  1MKW K;  1PYT C;  1Z1I A;  4Q63 A;  4JYU H;  1SGQ E;  3Q3Y A;  5F8X A;  3RU4 E;  3ZYD A;  1ELG A;  3SJI A;  1TLD A;  1S84 A;  1CHO G;  2AFQ B;  1O2S A;  3KF2 A;  4XE4 A;  1QQ4 A;  3GDS A;  2LP6 A;  3ATM A;  1PPE E;  1QTF A;  2STB E;  3RXQ A;  3BTW E;  3K9X B;  3SNA A;  5HIZ A;  4BTT B;  1A5H A;  3FN8 A;  2NU4 E;  4TT3 D;  1G37 A;  4D7F A;  1UHB B;  1ZJK A;  3A7X A;  3TVJ B;  4IN2 A;  4A1T A;  2BVR H;  3C1K A;  3A88 A;  1A4W H;  2A4R A;  2KX4 A;  1JBU H;  1C4Y 2;  1ZPB A;  4XRN A;  5C0T A;  2QCK A;  4IW4 E;  3UQV A;  3VB7 A;  2W3K A;  4Y76 A;  1IQM A;  3MU5 A;  1MUE B;  3U0I A;  1GJB B;  1HNE E;  5EOD A;  1BRU P;  4CR9 A;  2V3O H;  1C2J A;  1KDQ A;  4RN6 A;  1ACB E;  2J98 B;  3OSY A;  3RP2 A;  4X1P U;  5E0H A;  1O2T A;  2WIN I;  3U28 C;  2FUR A;  1HXF H;  2KAI B;  1ZPZ A;  2P5Z X;  3NCL A;  1QL8 A;  1THR H;  4FUD A;  1BHX B;  1AVW A;  3CNR A;  5EPN A;  1QA0 A;  1FJS A;  2GMT C;  3UNQ A;  2D1J A;  4ZXY H;  1RFE A;  2VVC A;  8GCH G;  2CV3 A;  4AFQ A;  3DCL A;  4A7I B;  2VVU A;  3BA3 A;  2WPM S;  5T6D A;  1AO5 A;  1PQ5 A;  6GCH F;  1GMC F;  4ISO A;  3F0O A;  1O3J A;  1O5D H;  1Z6E A;  2FI5 E;  1C1P A;  2Y5G A;  2RA0 A;  2BX4 A;  1O32 A;  1VR1 H;  1K1P A;  3ZOG A;  3PM3 A;  3PLK A;  3F1S B;  1AGJ A;  1B7X B;  3A8D A;  3TGJ E;  3OEH D;  1C5Q A;  4B1T A;  1IQL A;  1GDU A;  2JDI D;  1H4W A;  3HK3 B;  1A61 H;  1W3Q A;  4B73 A;  3MU0 A;  4MPX A;  1VZQ H;  4YLQ H;  5A0A E;  1T31 A;  2ZA5 A;  1NFW A;  1BRC E;  2ZQ1 A;  4RKJ B;  4Z0K A;  1EJA A;  4ZMA H;  1MH0 A;  3ZZ4 A;  1T8O A;  1CVW H;  1Y30 A;  1N8O C;  2ZTZ A;  6LPR A;  1GBB A;  3A85 A;  1MTV A;  3QTV H;  4AYV B;  1C1S A;  3EA9 A;  4ISH H;  3M7T A;  3TH3 H;  3ZZ8 A;  4ABE A;  1K1I A;  1G9I E;  1O33 A;  1WOF A;  2ZFS A;  1EAT A;  2P3U B;  4RI0 A;  2C8W B;  3FGE A;  4GHT A;  1OWE A;  4BAN B;  3TIT A;  1W13 U;  4IS5 A;  1E0F D;  1KY9 A;  3ITI A;  1O2P A;  2D26 C;  1XXD A;  1EJM A;  2BQW B;  1NM6 A;  2GCH F;  5DN6 D;  2HAL A;  4AYY B;  4Y6D A;  3UAI C;  2I51 A;  4AGJ A;  4HX6 A;  1HV7 A;  2SNV A;  3OX7 U;  2VJ1 A;  7LPR A;  3TGK E;  2H5C A;  1GVL A;  1K9O E;  4WH6 A;  1RD3 B;  4UFG H;  2QXJ A;  2ZNK H;  2XC4 A;  2ZWL H;  1GHZ A;  2ZEB A;  1H8H D;  1UVS H;  3NK8 A;  1ELD E;  1G3B A;  3GCH C;  3UNS A;  3T2N A;  1XVM A;  1NRG A;  1KXB A;  2Z3D A;  3FFG A;  3MU8 A;  2OL5 A;  4JZD H;  1O2W A;  1HDT H;  3KQ5 A;  3TPI Z;  2HNT E;  1G79 A;  3R3G B;  2BVX H;  2NU0 E;  1THS H;  3KYF A;  5C1U A;  1NRP H;  2HNT F;  3GCN A;  2PKS C;  1NFY A;  2R3Y A;  3PV4 A;  4Z6A H;  1LPK B;  5DP8 A;  3TK6 A;  5GIB A;  2PHB A;  3EE0 B;  2NR4 A;  2FTL E;  2ZCH P;  2FX6 A;  1C1O A;  4XOJ A;  2VH0 A;  1D3Q B;  1AKS B;  3V13 A;  3SU1 A;  1D3T B;  2GT8 A;  1ZGV A;  1QL7 A;  4Q2K A;  4ZHM U;  2WUB A;  2THF B;  1TOC B;  4X1R U;  3A86 A;  2D37 A;  1FAX A;  1ZGI A;  2PWX A;  1A5I A;  3RXS A;  1ZML A;  3O8C A;  4I8H A;  2A7H A;  2Y81 A;  4RT1 A;  5AHG H;  4WMD A;  1P9U A;  1FQ3 A;  4CH2 B;  1C2L A;  3EE7 A;  2XW9 A;  3KQC A;  3F9F A;  1TGT A;  4R82 A;  1T32 A;  1W2K H;  3LDX H;  4WXV A;  3GCT G;  3ATI A;  3PV2 A;  2OBQ A;  2BVS H;  1C9T A;  4FUC A;  3TGV A;  1L0Z A;  1C4U 2;  3UB0 A;  2TGT A;  2W7U A;  1O3L A;  4X1N U;  2J9N A;  4SGB E;  4NIY A;  4O3T A;  4TWW A;  1OP2 A;  1EUF A;  1TRN A;  3EA8 A;  1GI3 A;  2OK5 A;  2J98 A;  2GV7 A;  3CS0 A;  4XD7 D;  3T62 A;  3K87 A;  4BTU B;  5EPY A;  1HCG A;  3A7V A;  2KAI A;  1TMU H;  3ZVA A;  1TPS A;  4BAO B;  2BLO A;  1EJE A;  3M3V A;  1HJ8 A;  4XBB A;  3UR9 A;  1W7G H;  1O3B A;  2HQ9 A;  4ZHL U;  1YCP M;  3R5L A;  1SKY E;  4FOU C;  5EU8 A;  3RXG A;  3B5M A;  2H9E H;  1QA7 A;  3SV2 H;  1C2G A;  4B75 A;  2A45 B;  1RTK A;  1N6X A;  3WY8 A;  1O3P B;  3GIS B;  1JNW A;  2D8W A;  3KEE A;  4X0W U;  2A4Q A;  3SU4 A;  3IIT A;  3OYP A;  1CGH A;  1UVO A;  5H4I B;  3SNE A;  1ELF A;  1FV9 A;  1Q31 A;  2PV9 B;  2O8T A;  2ZGH A;  2XC5 A;  1SLW B;  5DP3 A;  5FCR A;  1S81 A;  4F4O C;  1NT1 A;  2O8U A;  3G01 A;  3EC6 A;  1P57 B;  2VPA A;  2H5D A;  1A1R A;  2QAA A;  4X2Y A;  3VFE A;  2O8L A;  4INH A;  1CBW B;  1O2R A;  2BYA X;  1W0K D;  3VXF H;  1WLK A;  3GY4 A;  3RUO A;  2EI6 A;  1W12 U;  3P8G A;  5KGO A;  5T3H A;  4MTK A;  1BQY A;  1TFX A;  3PMH B;  2KCP A;  2ASF A;  1K2I 1;  4YO9 A;  5B6O A;  2Z9K A;  1DXW A;  1LVM A;  2TGD A;  2IOT A;  1IQN A;  2Z9G A;  4Q7Z A;  2M2A A;  2V3H H;  3L3T A;  4JMY A;  3PRD A;  1IQG A;  5LPR A;  2VU8 E;  4Q7X A;  1UO6 A;  2ODQ A;  3T25 A;  1TMT H;  4AOQ A;  1BDA A;  1O2Z A;  5A8Z A;  4FUG A;  1AE5 A;  1ZR0 A;  4X6O A;  1GI7 B;  2ZGX H;  2K8I A;  2ULL A;  2AHM E;  3R0F A;  3VB5 A;  3UQO A;  2W5E A;  1XM1 A;  3RM0 H;  1Y59 T;  1FNI A;  2B7D H;  5L6N H;  3URD A;  3CP7 A;  1VL7 A;  2FXR A;  1GCT C;  2JJ1 D;  3AW1 A;  4NSV A;  4ISL A;  1B0E A;  1XUF A;  1TPP A;  3BTQ E;  3ATL A;  1TGN A;  3RXH A;  1HJ9 A;  1C5M D;  4FUF A;  3SGB E;  2B0F A;  5IDK A;  1GPZ A;  2WYG A;  2P59 A;  3MFJ A;  2FMJ A;  2FOE A;  4AG2 A;  2I6Q A;  5EW2 H;  2D5M A;  3BEI B;  1S0R A;  4Y8Z A;  3VGC B;  1GBL A;  2E83 A;  2BD7 A;  1KLJ H;  1EXF A;  4OS4 A;  1FXY A;  1GI8 B;  2QF0 A;  3H5C B;  1C2H A;  1D6W A;  2ZU1 A;  4I8L A;  1B5G H;  3BTT E;  3ZOE A;  1UCY E;  3KQD A;  2R0K A;  1OHH D;  1AFQ B;  3F6U H;  1GI5 A;  3MI4 A;  3STJ A;  1YLD A;  3VYA A;  4I8J A;  1TX6 A;  1K1M A;  4TY7 A;  2FYQ A;  1ZMJ A;  1AKS A;  1QB6 A;  1WDI A;  3SWJ A;  4IN1 A;  1TA2 A;  1NRQ H;  1MCV A;  1EAI A;  4GUX A;  2AIQ A;  1GJ8 B;  3SUF A;  2ANK H;  1GMD F;  4Y7B A;  3V3M A;  5LPE A;  1ZTK A;  1DUE A;  3SBK A;  4AFS A;  3UWI A;  1UTK A;  3A83 A;  2FOD A;  1TY9 A;  2ZPS A;  5ETX A;  3SHC H;  4A5T S;  5JBC S;  4YXW D;  2Y6T A;  3UIR A;  1BTY A;  1ABJ H;  3RDZ A;  3GDU A;  4CH8 B;  1Y5B T;  1MZA A;  3GY7 A;  4XHY A;  4HFP B;  3A20 A;  3RMN H;  1CT2 E;  3MWI U;  3SGQ E;  1Z7K A;  1C2K A;  2D38 A;  2PTF A;  3ZVF A;  1HB0 B;  1WTH D;  2EST E;  1TPO A;  2GJG A;  3PO1 B;  1ZTL A;  3OTP A;  4MQA A;  1QZ8 A;  3NFW A;  3KQB A;  2OC7 A;  2BMG B;  2FOC A;  4NCY A;  4UD9 H;  1QRW A;  4LOY H;  1DWD H;  4HTC H;  2NU1 E;  1OSS A;  1RTF B;  4BAH B;  1FI8 A;  1MAX A;  3BIU H;  2H9H A;  1BT7 A;  1SC8 U;  1X7A C;  5E2P A;  1K1J A;  1KXA A;  1LVY A;  4CBN A;  3LJO A;  4TY6 A;  4A92 A;  3BTG E;  3EDX B;  3FZD A;  1UTM A;  1GHB G;  2ZHQ H;  2PGQ B;  4KKD A;  1ELV A;  5AFY H;  1AWH B;  1L1N A;  4F49 A;  4CR5 A;  1A0L A;  4IMZ A;  1SLV B;  3A81 A;  4ASU D;  1GJA B;  2G4U A;  1A46 H;  4I32 A;  1AXJ A;  2DUC A;  3R5P A;  1YPK H;  1TNI A;  1LQE A;  1O3H A;  2F91 A;  4NFE A;  1O2L A;  1HUT H;  1GMH F;  2HTD A;  2Z94 A;  4OM9 A;  4CBO A;  3RXV A;  2AER H;  1UK4 A;  1ZTJ A;  5HMA A;  2CJI A;  1DY8 A;  1V2L T;  4ABJ A;  2Y7Z A;  3OU0 A;  3RC5 A;  4BOH A;  3TNS A;  2J97 A;  2ZPR A;  4GVU A;  3HK6 B;  1O2H A;  5CE1 A;  1P03 A;  4OS7 A;  1LKA A;  2GZ7 A;  1JRS A;  4Y10 E;  2TBS A;  4YTA A;  3E4V A;  2ZKS A;  2XC0 A;  4LZ4 B;  1C2M A;  1VIT F;  3F9E A;  2HVY B;  2PKA A;  2VIW A;  3S7K B;  3UR6 A;  1YLN A;  1C2I A;  3R5R A;  1F5R A;  1OOK B;  1SGP E;  1XMN B;  2ECR A;  1L4Z A;  1K1L A;  1WXR A;  1GJ7 B;  3A7Z A;  5FBI A;  1TWX B;  3URE A;  1Y8T A;  1UW7 A;  2ZGJ A;  1FX0 B;  1GJ4 H;  3ZV8 A;  4PRO A;  3U1J B;  1EPT B;  1FIZ A;  2YMS D; 
#chains in the Genus database with same CATH homology
 1G79 A;  2FHQ A;  4L82 A;  3HY8 A;  4HMS A;  2X1K A;  1W9A A;  5CHE C;  1WLK A;  1WV4 A;  3KYF A;  3CNR A;  1YWU A;  1T9M A;  5KGO A;  5ESC A;  1CI0 A;  5EJL A;  3DMB A;  2ASF A;  4XHY A;  3A20 A;  1RFE A;  2HTI A;  1WGB A;  4Z85 A;  4HMV A;  3F7E A;  2D38 A;  2PTF A;  2NR4 A;  3BA3 A;  2GJG A;  1I0R A;  3RH7 A;  4YWN A;  2ED4 A;  4IRA A;  3NFW A;  2FG9 A;  2D37 A;  3VY5 A;  3KYG A;  3BPK A;  1XHN A;  4QVB A;  4RT1 A;  2OU5 A;  2HQ7 A;  3ZOC A;  3R5Z A;  3ZOG A;  1G77 A;  1W3O A;  5JAB A;  1W3R A;  4F07 A;  3ZOD A;  2AQ6 A;  4R82 A;  2IG6 A;  1YOA A;  2R6V A;  3AMF A;  1USF A;  1VL7 A;  1W3Q A;  1XXO A;  4HMT A;  3A6R A;  3GAS A;  3TGV A;  5EIY A;  2HHZ A;  2L74 A;  3ZOH A;  5KEC A;  2Q9K A;  5CHO A;  1AXJ A;  4P02 A;  3FKH A;  2RE7 A;  3R5P A;  1Y30 A;  3A6Q A;  3IN6 A;  2ARZ A;  4XJ2 A;  1USC A;  4HMU A;  1W3P A;  2RDE A;  4HG6 A;  4HMX A;  2HTD A;  2D5M A;  3K87 A;  2E83 A;  3CB0 A;  3FGE A;  4N7R C;  1DNL A;  3BNK A;  2I02 A;  3H96 A;  1EJE A;  3VY2 A;  3ZOE A;  2HQ9 A;  2ECU A;  3HMZ A;  1FLM A;  2X1J A;  3R5L A;  4ZKY A;  4FOU C;  4YBN A;  3B5M A;  2IML A;  2IAB A;  2I51 A;  2D36 A;  4Y9I A;  3VYA A;  4I86 A;  4HX6 A;  2QEA A;  3E4V A;  4HMW A;  4RT0 A;  3SWJ A;  2R0X A;  5EJ1 A;  3K88 A;  3U5W A;  1JNW A;  5KED A;  1YLN A;  3DSG A;  3R5R A;  3U35 A;  2A2J A;  2ECR A;  3K86 A;  4XRN A;  1RZ1 A;  2QCK A;  4F48 B;  3R5Y A;  3CP3 A;  3AWH A;  1WLI A;  3DNH A;  1I0S A;  3U0I A;  1G76 A;  5BNC A;  3EC6 A;  1NRG A;  1TY9 A;  5EJZ A;  4P00 A;  2VPA A;  3DB0 A;  3PFT A;  3R5W A;  1RZ0 A;  3U34 A;  2OL5 A;  1G78 A;  3ZOF A;  2FUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...