1YLNA

The crystal structure of the protein of unknown function vca0042 from vibrio cholerae o1
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
226
structure length
225
Chain Sequence
TVSTINSTDALAMVEHSELTLSITTPVGTKFVCRTPFIGTHTDKFLLVEMPKISADDLQYFFQEGFWMNIRAISPRGEGALIHFRSQLMHILQEPVPMAFLSIPNTMQVSQLRKEPRFELNLAGKVLFDEHRGDCELRDLSRSGCRFITPPLGKTYQVGDLVALEIFSDLRGTKTFPPLTGKICNLQRSLHHARYGLEFNEEGRNNAKNLLAQLKFNGTKLTLNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the hypothetical protein vca0042 from Vibrio cholerae O1
rcsb
source organism Vibrio cholerae o1
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein vca0042
total genus 39
structure length 225
sequence length 226
ec nomenclature
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07238 PilZ PilZ domain
A PF12945 YcgR_2 Flagellar protein YcgR
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.110.10 Mainly Beta Roll Pnp Oxidase; Chain A Electron Transport, Fmn-binding Protein; Chain A 1ylnA01
2.40.10.220 Mainly Beta Beta Barrel Thrombin, subunit H predicted glycosyltransferase like domains 1ylnA02
1XHNA 3VY5A 2D36A 3R5YA 2I51A 1TY9A 2ECUA 2HQ9A 5JABA 2RDEA 5BNCA 3VY2A 2VPAA 2FURA 3K87A 3BA3A 2X1JA 3ZOEA 5KGOA 1USCA 4N7RC 1W3RA 3PFTA 4HMWA 3DNHA 4HMVA 4XRNA 2D38A 2HQ7A 1WGBA 3GASA 5CHEC 1NRGA 5EJ1A 3R5PA 1W3PA 1DNLA 3FGEA 3SWJA 3TGVA 3B5MA 3VYAA 1EJEA 3EC6A 2HTIA 2OL5A 2ECRA 4HMSA 2QCKA 3HY8A 2FG9A 2PTFA 1YOAA 1W9AA 3U5WA 2X1KA 1G78A 1G79A 3R5LA 4FOUC 5EIYA 3R5RA 2ED4A 2FHQA 5EJZA 1I0SA 2E83A 3ZOHA 1W3QA 3F7EA 4YWNA 3A6QA 1RFEA 4P02A 1RZ0A 4HMUA 3NFWA 3KYFA 4RT1A 3RH7A 3K86A 1G76A 3DSGA 1Y30A 4L82A 3ZOCA 4HG6A 4P00A 2D5MA 1YLNA 4I86A 2Q9KA 2R6VA 2QEAA 3ZODA 5CHOA 3FKHA 4Z85A 4F48B 3CP3A 4XJ2A 3A6RA 3IN6A 3E4VA 3R5WA 3BPKA 3KYGA 1WLIA 1RZ1A 3AMFA 3R5ZA 1I0RA 1G77A 3DB0A 3K88A 2AQ6A 2OU5A 3CNRA 4HMTA 4R82A 4ZKYA 3AWHA 2R0XA 3DMBA 2D37A 1VL7A 2L74A 4Y9IA 4HX6A 1T9MA 2IABA 1FLMA 1JNWA 2RE7A 5ESCA 5KECA 1USFA 2ARZA 1W3OA 1WLKA 2ASFA 2HTDA 1WV4A 4F07A 4XHYA 2IG6A 2IMLA 2I02A 3ZOFA 1XXOA 1AXJA 2GJGA 3A20A 4HMXA 3CB0A 2NR4A 3H96A 4IRAA 3ZOGA 4RT0A 5EJLA 3U34A 3BNKA 5KEDA 2HHZA 4YBNA 3U0IA 3U35A 1CI0A 3HMZA 4QVBA 2A2JA 1YWUA
chains in the Genus database with same CATH superfamily
1WUNH 3CP7A 3VY5A 3SNCA 4Z1MD 5HM9A 3SN8A 1BTYA 3UQVA 1Y5BT 1MU6B 3GDSA 1KDQA 2R3YA 2RDEA 1HAYB 4FUDA 3V12A 4AOQA 4FVDA 3UOUA 4MPWA 3FFGA 3QTOH 2YMSC 1A61H 1O3GA 2XBVA 1CGJE 3M3TA 3MU0A 2J94A 2V0BA 1QR3E 2D2DA 1ELVA 3MI4A 4IMQA 2FI3E 4FUEA 3HK3B 4FUHA 3D62A 3A84A 5GWZA 2HTIA 1ELCA 2SGQE 3UWJH 1FQ3A 1SBWA 2ZHEH 3VB6A 2FM2A 1C2IA 2QV1A 4ABFA 3GY5A 3A82A 1QNJA 2ASUB 1DOJA 1OP8A 4I8JA 2QXIA 1FXYA 1VGCB 4Q4LA 4JYVH 3WY8A 3ZZDA 2BXUH 1P05A 1CQQA 1D3PB 4LZ4B 3N7EA 3RDZA 2AGGX 2BY6X 1NM6A 1T7CA 3LH1A 1AWHB 1J8AA 1C5QA 1T32A 1GI3A 2W6ID 1AWFH 1D3TB 4FU8A 5CHOA 2IJOB 1ZGIA 5FBEA 1BMAA 4HFPB 2ZP0H 5DJ7A 3CS0A 4Z85A 1QL7A 4B2CA 4XJ2A 2VWMA 2FLBH 5C5OA 1GL1A 2KX4A 3O8CA 1JIRA 4AORA 1ETRH 3IITA 2VIWA 3GCHC 4K5ZA 4X2WA 3P17H 3SNEA 1T4UH 3OSYA 1OWKA 3B23B 2Z9IA 1J17T 1UTNA 1G30B 2QF0A 3A8BA 1C2MA 2OC0A 3QZQA 1IQLA 1H8DH 1EUFA 1EOLA 5AFYH 2R9PA 3U8TH 3F2GA 3UWIA 5A8XA 3ODFA 2QXHA 1OS8A 4TSFD 1O2MA 2I02A 4NWKA 4TT3D 1YCPK 3ZZBA 7KMEH 1P10A 1O3PB 5JPMH 3EE0B 3OE7D 8LPRA 1A5GH 3LC3A 5C94A 2ZTZA 2BD4A 4X6OA 1PQ7A 4BOHA 2A2JA 3EAAA 2SGFE 2A0QB 3W95A 1GI6A 1JRTA 2JETB 4XSKU 1O3FA 3QTVH 1ZHRA 1UJ1A 2EEKA 1TALA 1RTKA 1W10U 4X8VH 5BNCA 4D9QA 3VY2A 1TA2A 2XBXA 3F2HA 4Y0YE 3F1SB 1V3XA 3ZOEA 3E90B 5KGOA 1OWEA 2Y81A 2ZFPH 2AS9A 2FTMA 1ID5H 1KXEA 1C1PA 5JBAS 1A46H 2D1JA 4TYDA 1GBAA 2VJ1A 2XC5A 3NZIA 4R8TB 1GCTC 1YYY1 3KF2A 2PUXB 3EC6A 1GCTB 2QAAA 1FAXA 1HAOH 3BF6H 3R0FA 1ANBA 2HPPH 4AX9H 2ZU1A 1MTWA 4YZUA 3U5WA 1LQEA 1G78A 1Y12A 3RXBA 1XX9A 2CXVA 2WINI 1D3DB 1HPGA 1MKWH 4Q80A 2YNBA 4UEHH 1NC6A 4K60A 1GJDB 3IWMA 3F0OA 4JZIA 2A32A 3MMGA 3DSPA 3STIA 3E91A 2ZI2H 1JIMA 1KXCA 1A0HB 1GDQA 4AG1A 1Q3XA 3LGWA 3KEEA 1HUTH 2GZ8A 3SGAE 1YLNA 3SBKA 1PPCE 1DICA 1A1RA 1O2TA 1QB1A 1YP9A 5TCAA 4LOYH 2BVSH 1PPHE 1GMCG 1YLCA 2J98B 1V2LT 1GJAB 3FKHA 1TPSA 3UUZA 3SGQE 5F8ZA 4B2BA 2PHBA 3PROA 1O5BB 2KAIB 3TGIE 1TNIA 1O3KA 3AMFA 3TGJE 4NFFA 2LPRA 1NFXA 2FOHA 5ESTE 1V6DA 2RA0A 2D37A 2F9UA 1DM4B 2ZWLH 4JYUH 4HX6A 3TLOA 4AYYB 4B75A 1A5HA 4K3JA 1A3EH 4JK5A 3SU0A 3KL6A 3OTPA 1C4U2 1BHXB 2W6JD 5A8YA 3SOSA 1C9PA 1XUJA 4ZAEA 1CU1A 1UK3A 5DG6A 4DY7B 2IMLA 1HNEE 1GI1A 2CHAC 3ZVCA 1K1PA 5C5NA 1OP2A 5C17A 1F2SE 1ZSJA 4RT0A 2Y5GA 2WYGA 3TIUA 1O35A 1NO9H 3SJ8A 2BY7X 1C1RA 2PSYA 3GCNA 2A45B 5K0HA 3TH3H 2VGCB 3ZZ9A 4RN6A 1ZJDA 1G3EA 1MKXH 1ORFA 1FDPA 3A7VA 3QN7A 4O97A 1GBEA 2AHME 5JBCS 1E34B 2NU2E 5JABA 4I33A 2BLQA 2H6MA 5CHBA 1ESTA 1FNIA 4N7RC 7LPRA 8GCHG 1VJ9U 4ZKRU 1WOFA 1P8VC 3EA9A 5J4QA 4ABEA 5IK2D 2ODQA 1NT1A 1SMFE 5A0BA 3NPSA 1G3DA 1G37A 5T6GA 2G00A 4A92A 2PKAA 5C1UA 2G51A 3ZZ8A 3GCTG 1AB9C 1Y5AT 4YT6H 4X8TH 1EAXA 1DFPA 1T4VH 2HNTF 2GCHG 1P12E 2OLGA 4J1YA 1MBMA 1HBTH 4LXBH 2QF4A 1TGCA 2FOMB 3GY7A 1GBBA 3ZIAD 1E1QD 3PMAB 2R2WU 2V3MA 3BSQA 5HIZA 3FZZA 5AFZH 1YBWA 1RIWC 2WZQA 1BMNH 1P02A 2ZNKH 1QGFA 3QX5H 4B6FA 1C5LH 2BVRH 5L6NH 4I86A 2JJ2D 4WY3A 4FU9A 3PMHB 3V3MA 2BD3A 1SI5H 1DWBH 3FVFB 3ZODA 1EFRD 3RXVA 3LJJA 3CP3A 3NWUA 1NFWA 1W13U 2PTCE 3KYGA 1HXFH 1UW7A 4AGKA 1BMMH 1SGCA 1TMBH 2PV9B 3PTNA 1OOKB 1C2DA 1WLIA 1O5DH 3FOAA 2J5UA 1HAXB 3DB0A 3BTTE 4Y8ZA 1WYKA 1XUFA 1EX3A 2ZHFH 1C5UA 2L74A 1K1OA 1N6YA 2P3UB 1THRH 4DG4A 1S0QA 3TNSA 2JDID 3SV9A 1FLMA 1NU9A 3HGNA 4VGCB 2ASFA 1GPZA 2ZU4A 1XUKA 3ZYDA 2NU0E 3UAIC 2NR4A 1UTLM 3BTWE 1PJPA 4X8UH 3GY4A 3Q3KA 1UVUH 4BAQB 1EAUA 3SV7A 1WQVH 2ODPA 7GCHG 1XMNB 4KTSA 4YBNA 4CRAA 3DHKH 1QL9A 1P04A 3A7WA 2WPMS 1J16A 4ABDA 2W5EA 4AYVB 3CENA 1DPOA 1C5SA 1T8OA 5GDSH 4WJG2 4ABAA 3TNTA 5BPEA 4OS1A 5BRRE 1DVAH 2Y6TA 1EZUC 3GY6A 5CDFE 4WH8A 1ELDE 1HYLA 2SGPE 3AW0A 1TQ7B 3KCGH 3GASA 1Y3YA 3O8DA 3SU4A 3U9AH 1GBMA 3RXQA 1H8HD 4XBBA 4O03A 4K1TA 2BY9X 6LPRA 3SWJA 2PSXA 2BDIA 1O38A 1H1BA 2BM2A 3SU1A 5F6MA 1FIWA 2VIQA 5AF9H 4AC9A 1CHOF 2O8LA 3BTDE 5GCHF 5EIYA 4OS7A 4X1NU 1SQOA 2KCOA 3TK9A 2QN5T 5CMXH 1AZZA 2F3CE 2TGDA 3PMBB 4UFFH 2FO9A 1E36B 1VKYA 2VWOA 1HJAB 1GMDG 4FUJA 3VB7A 1P03A 5B6LA 2TPIZ 1V2NT 4L82A 5C67A 2BDGA 1JBUH 1UTJA 1KXFA 4AB8A 4BAOB 4ABHA 2NU3E 1S6LA 4ZKOU 2P5ZX 3ODDA 4Q2KA 1IQKA 5IDKA 4CR9A 1FI8A 2OQUA 1XM1A 1AN1E 1V2VT 3TU7H 1L2EA 4AFUA 1FV9A 4GVUA 5DP3A 2TIOA 4TY6A 1EZQA 2HOBA 1TYNA 3GYLB 1O3MA 2WPJS 3GOVB 2YMSD 1QJ7B 3SUDA 1HLTH 4K1SA 2Q1JA 4HMTA 1S85A 3LONA 4DOQA 3EQ0H 3LGYA 2AEIH 1VL7A 2RG3A 3RMMH 2Z9LA 2Q6FA 1D6WA 1YCPH 4TY7A 2ZCHP 4DT7B 2EI7A 2XBYA 3RXTA 3K9XB 1IHSH 2J38A 1V2TT 1FN8A 3LGTA 4E05H 3G01A 2HTDA 2G4TA 3K6YA 1WV4A 1TE0A 3SZEA 7ESTE 1A7SA 2BLVA 3MO3A 2B5TB 3QO6A 2ZA5A 3RXIA 4RSPA 2ZDLA 2ZHDA 3H96A 3M3VA 1QRZA 3N7OA 1FIZA 3BNKA 1KXBA 1DWDH 1UTQA 1SGQE 3H09A 2ULLA 4INHA 2JJ1D 2ALPA 1FPHH 5E0HA 2VIVA 2CF9H 4U32A 1O3BA 1TNJA 3KGPA 1C1WH 2AERH 3L33A 3ZZAA 2IJD1 4TPIZ 1ZTKA 3RXDA 5EGMA 3BA3A 1XXDA 2K1QA 5CHAB 4IGDA 4YO9A 1ZR0A 4Y7AA 1EASA 1GI8B 5EQSA 1GBFA 5EJ1A 2BVXH 2P8OB 1CA0B 5HKKD 4MNYA 5HIYA 1AVXA 2P3TB 1G9IE 2A7HA 3QDZB 3LGUA 5EPNA 1BRAA 1Z7KA 3VB5A 1TWXB 2A5KA 1P2QA 1C5MD 4CBNA 4Y76A 2VWLA 1W0KD 1Z8RA 2C8WB 1QTFA 4OM9A 1OWHA 5L2ZH 4MPUA 5EJZA 1ELBA 5GJ4B 3PLPA 1GMHG 3F7EA 1TGSZ 1GHAF 2VVCA 1QA0A 2AYWA 1SGDE 1L1NA 4KELA 4Y79A 2PP6A 2V3OH 1V2WT 3RXEA 4DVAU 3Q76A 4WH6A 3VG8A 3GYMA 1HAVA 3RUOA 2Z94A 4JZFH 4UFEH 1IQMA 4XBCA 1NROH 4CRBA 1NBMD 5C1YA 4B73A 3VB4A 4ISHH 3H7OA 2OC8A 1V2QT 1W2KH 4OS2A 1QY6A 2UUFB 1ESAA 4DT4A 1ZSKA 2ZPSA 6ESTA 2FP7B 3S9CA 1A4WH 1G77A 4K8BA 4LZ1H 1KDQB 3ATLA 2R0XA 4ZKNU 3T2NA 3V13A 2A7CA 1EPTB 1CHOG 3BG8A 4OS4A 2J98A 1T9MA 4NA8A 5FL7D 5PTPA 2B8OH 2ZFTA 2GTBA 1K1MA 1N8OC 4WF8A 3PRBA 2KCAA 4D76A 3D65E 1L0ZA 1O3IA 1W14U 4FUGA 1CGHA 4CREA 1V2UT 1UCYH 4GCHG 4WMFA 1COWD 2VINA 3D49H 3GDVA 3U1JB 5DO4H 3ZVBA 1O2QA 4FU7A 1KSNA 2UWLA 4BXSA 2FPZA 3WWBA 1KXDA 1NBME 2VWNA 1K1NA 3L3TA 4J2YB 5LPFA 1JRSA 2XYAA 1LKBA 4BXWA 4ISIH 1LHDH 2I51A 1Q31A 3EDXB 1Z6JH 2ZEBA 1SGFA 4IW4E 1WQSA 4F4OC 3K6ZA 4E7NA 2GDEH 2ZHQH 3RU4T 1YPMH 5L30H 3Q00A 3RXMA 3SJIA 1P9UA 3UIRA 1XXFA 1FMGA 3PYHA 1P2NA 1Z1JA 2VVVA 3AVZA 1AFEH 1AD8H 3T26A 3RM0H 3TGVA 1EJEA 2FX4A 3FO8D 3A8DA 1AVGH 1F0SA 2P3FH 3M5LA 5TCCA 2FG9A 2DUCA 5L2YH 1NESE 2CF8H 5EW1H 4XBDA 4WMDA 3A8AA 1EQ9A 1LMWB 6CHAC 1P2IA 2HLCA 4X6MA 5LH8A 2FHQA 1GJ7B 2BDYA 2M2AA 2XCFA 3RC6A 1AE5A 2E83A 1VCQA 3M61U 2A2XH 1LHFH 3V7TA 4JZDH 2EI8A 1EATA 4RT1A 2G52A 9ESTA 1GBKA 1AO5A 3QWCH 5GIBA 2FODA 4MVNA 5JB8S 1Y8TA 4INLA 1WTGH 3RM2H 4CRGA 1SGPE 1HB0B 2BD8A 2JETC 4Y8XA 2GD4B 5T3HA 1XKBC 2EY4C 1BRUP 1NS3A 5HYOA 3R5WA 1YKTA 1CT4E 1OP0A 3NUMA 3ZZ6A 2VU8E 1GGDB 2V6NA 4JZEH 2XNIA 2QGRA 2OXSA 3KHVA 3MOCA 2OU5A 2CHAB 3SJKA 1O3DA 1GI0A 1TOMH 1QBOA 3NCLA 2KM0A 2ZFRH 1C1NA 2F91A 1QFKH 2H9TH 3GCTF 1C2LA 4Y10E 5EPYA 1E38B 2ALVA 4M7GA 5KECA 1SKYE 2ARZA 1YPHC 2G5VA 3MU4A 4KTUA 3UNQA 1XXOA 4KP0A 4NSYA 3A7YA 4BAHB 3CB0A 1EAIA 2GUJA 5EJLA 2HNTE 1MUEB 2ZCKP 1OHHD 1TRNA 1QJ1B 2AGIX 3SNDA 1W0ZU 2RFKC 2VH0A 2P16A 3DSOA 5JDUB 2QXGA 5HGGA 2NU1E 3LKWA 1O3JA 4FUCA 5T6FA 1O0DH 3KQ5A 4D8NA 4ISNA 3F2FA 3GY8A 2CV3A 3STJA 2J4IA 1FLEE 4D7FA 1O2PA 2Y5FA 2A5AA 3TVJB 1GHYH 1NRGA 1SQRA 1GBJA 1XUGA 3E1XB 1TMUH 1SGIB 3QGJA 2KAIA 3LDXH 1SHYA 3RXOA 2OL5A 1BT7A 5DPAA 1XUHA 2ANWA 3NKKA 1YOAA 3QZRA 2KR7A 2ZCLP 5T6DA 1KLTA 1UK4A 4FOUC 3DCLA 2C4FH 4XD7D 1CBWB 1NPMA 2XCNA 2TGTA 3GICB 5K7RA 2ED4A 3E8LA 1SG8B 1WAYB 2LP6A 1DLEA 1S0RA 3TK5A 3A7TA 2ZU5A 4ASUD 2GMTB 1C5VA 3MNCA 2ZF0H 2UWOA 1EPTC 3JZ1B 3RXHA 1TPOA 5HM2A 3K86A 1YLDA 1HXEH 1C4Y2 3URDA 1XVOA 2Z3EA 4UD9H 1O37A 1QRWA 1EB2A 5DSFA 1X7AC 2AIQA 3NRLA 3U8RH 2O8TA 2UUKB 4IS5A 1E0FD 4NG9H 1HAHH 2DE8A 4SGBE 3R3GB 2ZPRA 4RI0A 4DIHH 1BTXA 2XBWA 1YC0A 1H4WA 3EA7A 4R0IA 2GZ7A 1ELFA 5F8TA 1UK2A 3E4VA 1F0RA 1GG6C 2FS9A 1EJAA 1Y3XA 1TX7A 1O3EA 4CRDA 2PKAB 3KQBA 4IC6A 2JH0D 1CO7E 2FDAA 1EOJA 1P3CA 2ZKSA 1UCYK 3BN9A 2A4RA 2OTVA 1DY8A 1HCGA 3HKJB 4CHAC 2GZ9A 3M35A 2VBCA 1G2LA 4BAKB 3GCOA 1ZMLA 1PQ8A 2VB0A 5LPRA 5LGOA 1TB6H 1YM0A 2G81E 2Z3DA 1DANH 4MPXA 1ZLRA 4ZCNA 3ZYEA 2BD5A 5FPSA 4NIWA 1K9OE 3T25A 3UTUH 3TK6A 1AB9B 3RMLH 1VCWA 3TGKE 4ZHLU 2A5IA 4YOGA 2YMSB 1EB1H 4MLFB 3DFLA 3ZZ3A 3UY9A 2WPIS 1MABB 4MQAA 1CI0A 1IQIA 1C2JA 1HAGE 2GGVB 1XHNA 4AGJA 1O3CA 3MNSA 2R0LA 1C1VH 3RC5A 3N7DA 1O2LA 1SPJA 2K0QA 4A5TS 2VPAA 2ODYB 3SU2A 3ZV9A 4I8GA 5E2PA 1RRKA 1W3RA 1MKXK 1GHVH 1OX1A 1TNGA 2TGPZ 3ATMA 1ZPCA 1O2NA 5A0CA 1O5GH 3R5PA 1ZZZA 1LKAA 4ACAA 2GT7A 1O2SA 2WUBA 4ZROA 3EE7A 4M9FA 2HVXA 1C2FA 3D23A 1C1SA 4HMSA 2XWAA 3AK5A 1QJ6B 3RXUA 3HK6B 2O9QA 3SI3H 2C8ZB 4YOIA 3KQCA 4ZUHA 2FEQH 1MKWK 3W1EA 1S84A 4X2YA 1TGNA 2Q6DA 1BTZA 1M9UA 2Z9KA 1O2GH 3U69H 2J9NA 4B76A 4X1SU 2OK5A 4VGCC 2WPDD 5FX5A 1WXRA 2GX4A 1AMHA 3SU5A 4I7YH 1TNKA 2AH4X 5JB9S 1SR5C 1GBTA 5H4IB 2BQWB 2ZQ1A 1FY8E 4GLYA 2FTLE 1LQDB 3ZOCA 1CBWC 4HG6A 1J15A 1S81A 4X6NA 1BOQA 4MPVA 5GXPA 1E37B 1RFNA 2ZDNA 2VH6A 2XC4A 2VIPA 1C1QA 2BDCA 4KGAA 1WTHD 1Z8GA 2ESTE 3M37A 2ANMH 1FY5A 3UR6A 4INKA 2GVFA 5B6OA 3E0PB 1B0FA 4Y7BA 1G2MA 2QF5A 1PQ5A 3RU4E 2BLWA 4IC5A 3GDUA 2H9EH 3ATIA 2RCEA 4ACBA 1BTUA 1IQGA 1DX5M 3DMBA 1Y3WA 2R2MB 1A0LA 1LO6A 1TPPA 1ARCA 1ESBA 3OYPA 4SGAE 2JH5D 1UO6A 1A3BH 1IOEA 1C1OA 1AHTH 4D9RA 1IQNA 1UHBB 5ETXA 2GJGA 2WV4A 4KKDA 3ZV8A 4CRCA 1TRYA 3ZOGA 3MU8A 2FLRH 2KCPA 2XXLA 4A7IB 1PPEE 2GKVE 4MG3A 1LVYA 2XWBI 1K21H 3LJOA 1C4V2 5AHGH 2FOCA 1GMCF 2H5DA 3SU3A 3LT3A 1MQ6A 2FOFA 1BRCE 4MNWA 3KN2A 3RXSA 3RXCA 1QB6A 1P2MA 2A4GA 2B7DH 1O2OA 3OX7U 4X2XA 3K87A 1TX8A 1ZMJA 2H1UA 3KNXA 2BD2A 1CE5A 3DNHA 4HMVA 4RKOB 1P2KA 3BEUA 1O3HA 2D38A 3PV2A 1C1UH 4H42U 1GG6B 3E0NB 5E8EH 3A85A 3QUMP 1ANDA 1W3PA 1O2HA 3WWFA 2C8XB 2VNTA 2QCKA 2I6SA 1NRQH 3URCA 2V3HH 4NSVA 1W9AA 1GBHA 2A31A 1P57B 2JH6D 1NZQH 3UPEA 1AUTC 3L6PA 3PWBA 2PTNA 3F3BA 2VVUA 3O8RA 1KTTB 2FYQA 4O3TA 3ELAH 5DKMA 1O36A 3SGBE 1JXPA 2F9PA 1QB9A 3C27B 2QA9E 2AMDA 4K1EA 1P09A 1O30A 1W3CA 3S7HB 1VCPA 3F9GA 5A09A 2DE9A 2Q9KA 1GBCA 1SFIA 1O2YA 2FIRH 4AFQA 2C90B 3PO1B 2BD9A 1TAWA 1GWAA 2QXJA 1DDJA 3A6RA 1ZOMA 2C93B 2ZC9H 1QURH 3SJOA 1GHXH 1ZTJA 1GGDC 1K1LA 2ANKH 4MNVA 4R82A 1ETSH 5I46H 3M3SA 3VFEA 2OINA 1E79D 2QE7D 2AGEX 4TV4A 3VEQB 4W64A 3KQDA 4NZLA 1HJAC 1HAZB 1JNWA 2PUQH 3PM3A 3U28C 1G36A 2BDHA 4XHYA 1EZSC 5DGJA 1SLWB 4X1QU 4WMEA 6GCHG 7GCHF 2B0FA 1BUIA 5JBBS 4JCNA 5EODA 1DUAA 2F9VA 1QIXB 2WHXA 3ENSB 3LH3A 1E1RD 2CMYA 2WPKS 1HFDA 1PPGE 1N8OB 2B9LA 1GI7B 3U8OH 3I77A 1W7GH 3AW1A 1ZPZA 3AAUA 2L1TA 1OXGA 1AZ8A 4MTBA 2X1JA 1EKBB 3EGKH 3MH7A 1TX6A 2ZGXH 2ZZUH 1EJMA 2HQ7A 5CHEC 1VITF 1U6QA 1V2RT 4Y0ZE 8ESTE 1WCZA 1L1GA 1L4ZA 2BDAA 1BA8B 2TGAA 3BIVH 1Y3VA 4AB9A 2PTFA 1GJBB 1ELGA 1TABE 1MTNC 2Y5HA 1W0JD 2F83A 4MNXA 1AFQB 1CSOE 4JYTA 3ZOHA 1W3QA 2O8WA 3PO1C 1AUJA 3FZDA 1NRNH 3GY2A 1C5RA 2STBE 3TJNA 4XDEA 2K4QA 1YPGH 1UTMA 3CS7A 5DN6D 2PWXA 3MNXA 4BTIB 4DJZB 3SV8A 2THFB 2Y82A 2V7QD 2ZGCA 1SGRE 3VXEH 2NWNA 8KME2 2BZAA 2L6OA 3DFJA 2K8IA 1OPHB 1B7XB 1MZDA 1O3OA 4XOJA 4ZH8A 4ASHA 4GPGA 1KLJH 1MAXA 3PLBA 1XKAC 3SI4H 3BTHE 1SL3A 3RLWH 1T31A 3A7XA 2ZECA 4WXIA 1O2KA 1QHRB 1AKSA 1XUIA 1CA0C 5C20A 1Z6EA 1V2OT 1AI8H 4THNH 1IHTH 3ZZ7A 4OS6A 1DE7H 4ZKYA 3MTYA 1IQEA 1LHGH 1ZRBA 1P9SA 1O2JA 3LGIA 1A0JA 3F68H 3RXJA 4GUXA 1EP5A 3MWIU 1W3OA 4DCDA 4F07A 4Z6AH 1NFUA 2XTTB 3IG6B 3BTEE 1C9TA 1F0TA 4Q7XA 1C5XB 2ZHWH 3M5OA 2ZFFH 4ABBA 4IRAA 3M7TA 4OGXA 1KXAA 6GCHF 4ABGA 4B71A 3FN8A 4GHQA 2HHZA 4IMZA 1BCUH 1LPKB 3HMZA 3UQOA 1JOUB 4QVBA 2JIZD 1YWUA 2A7JA 1FZZA 3ZZ5A 2ZGBH 3MH4A 1ABJH 2CN0H 3LU9B 1FY1A 1GBDA 1TY9A 3I78A 1MD8A 2IPHA 2FOAA 1ZSLA 3ZZCA 2FURA 3UREA 1N1LA 2OBQA 1W8BH 3OAAD 1MQ5A 3S69A 3OU0A 1D6RA 3F6UH 2AMQA 5A2MH 1TIOA 2ZGHA 3OY5U 2ANYA 1E35B 1YGCH 1HIAA 5CHAC 1LVBA 1W11U 4AZ2B 4UDWH 4H4FA 3SJ9A 3U1IB 1O31A 1O3AA 2AMPA 2PGQB 1ZYOA 5DP9A 3EAJA 1C5YB 4ZHMU 1Y59T 1S5SA 2LNCA 5E0JA 1K22H 3BTKE 1I0SA 1L1JA 1IQJA 2FYRA 2Z7FE 2XOKD 5T1VA 1GJ9B 1O2IA 3KYFA 1FN6A 1GHAG 3UOPA 5JBTA 1AU8A 2G8TA 3SO3A 5C1XA 2KCYA 1P3EA 2YNAA 4RKJB 3RLYH 2GV6A 2PLXA 2BX4A 2WPLS 4CRFA 5EXMA 2SNWA 2IN2A 4Q63A 3M7UA 4YLUA 2M5TA 3A89A 3IN6A 2P8OC 3P70B 2NU4E 2W26A 2P93A 2QC2A 3Q3YA 2FESH 3SHCH 1GVLA 1F0UA 1UVSH 1ANCA 1BTWA 3KIDU 3FP7E 1H9HE 3MH5A 4X8SH 2BD7A 2GT8A 4NFEA 2XW9A 1MH0A 1EZXC 3RXLA 1A5IA 1B0EA 2BOHB 1THSH 2ZDVH 4PROA 1GVZA 2G55A 5DP6A 3RXGA 4NGAH 3Q3XA 2OBOA 3ZVDA 1T8LA 1OKXA 2ZFSA 1HDTH 1DS2E 1F5RA 1L4DA 4GAWA 2FX6A 2BY8X 1FX0B 4ISLA 1CT2E 2Z3CA 1MCVA 2FZZA 5EXLA 1H9IE 2BTCE 1DSTA 1SGEE 4NWLA 4Y11E 1RS0A 3PLKA 1GHWH 2OP9A 1O2XA 3LGVA 1PPZA 3I29A 4QT8C 3RXFA 1MMJN 1H9LB 1V2MT 3N99A 1GJCB 3SU6A 5F03A 2ZDKA 1C1TA 5AVDA 3HGPA 4WVPE 4B1TA 1SSXA 2W3IA 3H7TA 4ZXYH 3U98H 1QBNA 1P06A 1OYTH 3SNAA 3RU4D 2HVYB 3P92A 2CK3D 4HMWA 4I32A 4YT7H 5J4SA 2WYJA 2LELA 3A88A 5FCKA 1DSUA 3Q77A 1S83A 5C3NA 1Z8IB 1N6XA 1C5NH 1G3CA 1O2ZA 2Z9GA 3DUXH 2Q6GA 1IQFA 3HY8A 2G4UA 2OCVB 2HALA 1K1JA 9LPRA 1SQTA 1GCDA 1G79A 1SGNE 3SV6A 1YPEH 3LOXA 1Q2WA 2QCYA 1RXPA 2ZO3H 2GP9B 2ZU2A 4P02A 1VJAU 4HMUA 1BJUA 2F9OA 3NFWA 4YOJA 4Y71A 3SNBA 1PYTC 1Y30A 1LVOA 4ABJA 1NFYA 2Y80A 3C1KA 1SLXB 1F5LA 1WSSH 1UVOA 2GV7A 5GNDA 1Y3UA 1SHHB 1HV7A 5A8ZA 1BTPA 4IBLH 5GCHG 1T8NA 2BYAX 1BZXE 2WSSD 3BEFB 5DK1A 2GMTC 4I8HA 2BOKA 2BDBA 1DLKB 1P2JA 1Z71A 1C2KA 3BEIB 3PWCA 4O9VA 1FPCH 1HGTH 5E0GA 1QL8A 3AASA 3QGNB 2BX3A 5E2OA 4CHAB 3VGCC 1CVWH 1DITH 1HAVB 1GDUA 2STAE 3CNRA 2AQ6A 1ELTA 1GI4A 1OSSA 3A86A 3E6PH 4FVBA 3RMNH 3TJVA 1AY6H 4Y9IA 1CHGA 3SQHE 2A1DB 1DXWA 2D8WA 4NZQA 2IABA 5ESCA 4TPYA 3M5NA 4ZMAH 4UFGH 1O2UA 1RGQA 4DURA 1PYTD 1Z8JB 2QF3A 3OY6U 1VITG 3NXPA 1YY3A 1VR1H 1GL0E 5JYIA 1TBRH 3B9FH 2GCHF 3M7QA 4WWYA 1MBQA 5DP7A 1GMHF 1BBRH 1C5PA 4BAMB 1BIOA 1DY9A 1MU8B 3HATH 2D26C 2BY5X 4D7GA 2EA3A 4K69A 4BNRA 1BITA 1O2RA 1GI9B 1UVTH 1JWTA 1AE8H 2H9HA 2TBSA 3A8CA 4OGYA 3MHWU 3RXAA 4HI3A 5FX6A 3V4HA 1IQHA 2O8UA 3WW7A 3P95A 4NA9H 5F8XA 2PKSC 4YLQH 1KTSB 1QZ8A 4XRNA 5EXNA 3DD2H 1B5GH 3PV5A 3PB1E 3ATKA 3UR9A 1DUEA 3T27A 3T29A 1UTOA 3PTBA 2FS8A 3S9BA 4I8KA 4B74A 1HAPH 3PMJA 4K2YA 1RD3B 1WU1A 1V2JT 5FPYA 4GSOA 4ISOA 2X1KA 1TQ0B 1C2EA 3R5LA 3UB0A 4X1RU 1FAKH 1V2PT 2HWLB 4NIVA 3F9HA 2JKHA 3ATWA 4U2WA 5TJXA 4MTKA 2VGCC 3FAOA 4ZKSU 3A80A 1RFEA 1SOZA 3ZVEA 1UVPA 3GS9A 2HPQH 1BHXF 2FWWA 3HKIB 2RA3A 2Z6BD 5IYTA 1GJ5H 4P00A 1C2GA 5FAHA 3EA8A 3TJUA 3ESTA 2ZIQH 1GJ8B 4NIYA 3MNBA 1LPGB 1SGTA 1SB1H 3SHAH 4KTCA 2BZ6H 4H6TA 2HNTC 4JZ1A 1H8IH 3RC4A 3SUFA 1ABIH 3A7ZA 1SQAA 1O34A 1BDAA 1LTOA 3F0PA 1KYNA 4HKHA 3MFJA 1I0RA 1YPHE 1THPB 3FP8E 1F7ZA 2F4LA 1PPFE 1BJVA 5FHTA 1AKSB 1QRXA 1CT0E 1BMFD 2ZTYA 3ITIA 4K8YA 3RXPA 2BQ6B 5FXLA 2RE7A 4BTTB 2EC9H 3F9EA 1BB0B 1BMLA 4U01A 4A1XA 1EXFA 1G32B 1ZGVA 4Y8YA 2RDLA 3GY3A 3A87A 3JZ2B 3ZOFA 2QIQA 2UWPA 4E06H 1J14A 1YF4A 1S6FA 1D9IA 3A20A 3OFND 1OWJA 1O5AB 4I8LA 4FETA 4GHTA 3VPKA 1LHEH 3U34A 4CBOA 3NK8A 1GMDF 4X6PA 4UHVA 3SW2B 5KEDA 1UCYE 5LPEA 3U35A 3V0XA 1Y5UT 5C2ZA 3BTGE 1DT2A 3PV4A 1RTLA 4TWWA 3P8OA 4YM9A 1ANEA 1ACBE 3BV9B 1O3LA 3R5YA 3MQKC 1MCTA 1SGYE 3FP6E 1TPAE 1MAYA 4Z0KA 1S82A 1INCA 2ZU3A 4FUIA 4U30A 5FPTA 1CA8B 1QCPA 1TLDA 2XNDD 2HGTH 1HIAB 1NN6A 5F53A 3GCHB 6CHAB 3LPRA 3BG4C 3LIWA 3W94A 1WGBA 2ZDAH 4Q7ZA 4DW2U 1QBVH 1CGIE 2PR3A 1GJ4H 1SLVB 2A4OA 3FGEA 2CGAA 2CJIA 3B5MA 3SORA 1HAIH 4H6SB 2ECRA 1WBGB 2H5CA 2ZG0H 3M5MA 2PGBB 1ETTH 2FOBA 2SGEE 4XFQA 4F49A 1O32A 2Y7XA 5EG4A 1LPZB 3MYWA 4X1PU 1SFQB 1MD7A 1MTUA 1RJXB 1EJNA 3A6QA 3M36A 1O5EH 1UHBA 2J92A 1NRPH 2HLDD 1F5KU 2OQ5A 1P11E 3DSGA 1KY9A 4ZXXH 5HXFA 2UUJB 3O8BA 2J34A 4A1TA 4UE7H 5HMAA 5DP8A 2QEAA 3VGCB 1QQUA 1ZRKA 1LDTT 1K2I1 2O8MA 4UFDH 3DA9B 2I6QA 1TFXA 3SUEA 1NU7B 2ZDMA 8GCHF 1ELEE 4OS5A 2UUYA 2FI4E 1AIXH 3R5ZA 1VITH 2VIDA 2ZTXA 1ZHMA 2WV9A 3K88A 1A2CH 1YPKH 2VIOA 3BIUH 4GCHF 1K28D 2ZQ2A 1O3NA 3MO6A 4AFZA 1PPBH 3AWHA 3BTME 1DXPA 4NCYA 2A2QH 4FXGH 1MTNB 2W3KA 1VZQH 2XRCA 3A83A 1QA7A 4A6LA 1SVPA 1WLKA 2OD3B 4JK6A 4AN7A 3MH6A 3GISB 1SLUB 1C5OH 2ZFQH 1ZPBA 2SFAA 3HE1A 3QLPH 4HMXA 1C5TA 3SQEE 1FONA 1AQ7A 1C2HA 1DWCH 2P59A 1GDNA 1HJ8A 1EPTA 2P94A 2XC0A 3ZVGA 2SNVA 3P8FA 5ABWA 1J9CH 2D36A 4JMYA 3VB3A 5EU8A 4LK4A 3TPIZ 3OTJE 1D4PB 1GHZA 2OUAA 1P01A 1SOTA 2PFEA 2SGDE 1TMTH 1AFQC 1W12U 3SZNA 4E7RG 3T62A 3VYAA 4NIXA 4BANB 3FANA 1UTKA 3MU1A 1YPLH 4YTAA 1C5WB 5DP5A 1QQ4A 3R5RA 4X0WU 1GBLA 4A1VA 3TH4H 1TBQH 4DGJA 4Q7YA 1DWEH 1TBZH 1RZ0A 5EQRA 1F92A 1VGCC 3RH7A 1O5CB 1ZMNA 1G76A 4XE4A 4I31A 1W7XH 1MTSA 2G5NA 1P0SH 2Z9JA 4HTCH 4AFSA 2AIPA 5FBIA 4O3UA 2R6VA 1GVKB 2KFWA 4FUFA 4YXWD 1ZJKA 1D3QB 1S6HA 1JMOH 2FOGA 3S9AA 1GHBF 1MZAA 4ZHAA 3P8GA 1EP6A 1YPJH 3S0NA 1TOCB 3BTFE 4CH8B 1BRBE 1K1IA 1RZ1A 3VXFH 2BXTH 2C3SA 5I25A 3TJOA 1WV7H 2TRMA 1K0HA 5EQQA 1GJ6A 5CE1A 2R0KA 3UFAA 4F55A 4TWYA 3T5FH 3TITA 3LC5A 2J95A 3B8JA 4NA7A 3SUGA 2FXRA 2P95A 2IOTA 1O33A 3PRDA 2HRVA 2IPQX 1NRRH 5SGAE 5G4BA 3ZVFA 4FUBA 1AXJA 4X2VA 2J2UA 1NTPA 1G3BA 4HZHA 4ESTE 3U0IA 4CR5A 1TGBA 1PQAA 3E16B 2EI6A 1FUJA 2PW8H 2F9NA 3RXRA 1IAUA 3BG4B 1LCYA 2F43B 2BLOA 1WDIA 1BTHH 2PKSB 2HQ9A 2ECUA 3AAVA 1V2ST 1W0YH 1BQYA 5EW2H 1BBRE 2YOLA 1TNHA 1USCA 3OEHD 2GCTB 3PFTA 3K65B 1PFXC 1LHCH 1T8MA 1FY4A 1P2OA 3MU5A 3MO9A 5EOKA 4MDSA 1SGFG 1Z1IA 2OC1A 1EAWA 5C0TA 1DNLA 4B2AA 1OYQA 1ZTLA 4AG2A 3UNSA 3P6ZB 2W7UA 3QK1A 1GI2A 2BHGA 1O2WA 3SYJA 3S7KB 1FY3A 1TGTA 3P8NA 1ZHPA 2FOEA 2ZGJA 1KMHB 1H8ED 2R3UA 3H5CB 3TH2H 1TNLA 3T28A 3RMOH 4WXVA 3A81A 1O5FH 4HGCA 4YESB 4B6EA 4YWNA 2OC7A 1O39A 2GDDA 3RXKA 2A4QA 1O2VA 1FJSA 4Y6DA 4UONA 2WUCA 1NY22 3BTQE 1MTVA 3E3TA 4BTUB 2WV5A 3RP2A 1NRSH 2D5MA 3FKSD 2SGAA 1RIWB 2Y7ZA 1ELAA 1UTPA 3SV2H 4IN2A 2FI5E 5A0AE 4F48B 5C0UA 2C8YB 2H2ZA 3BPKA 1RTFB 2QYIA 4ABIA 1GHBG 1BBRK 2V35A 1TRMA 5ESBA 2GCTC 5FCRA 1YCPM 2BMGB 2EQNA 1OWDA 4DIIH 1GI5A 1XVMA 1GBIA 1UMAH 1HJ9A 3DT0H 1OWIA 1AGJA 5GPIB 2QY0B 2WPHS 1ARBA 3HPTB 3UNRA 1USFA 2ILNA 3ZZ4A 1V2KT 2IG6A 4IN1A 1AVWA 1TONA 2FMJA 1SC8U 1TA6A 3OEED 5DP4A 2BQ7B 2AFQB 2ZPQA 1LVMA 2W7SA 2F9BH 2KZ4A 1C1MA 2BB4A 2J97A 3KQEA 3K2UA 3EYDA 3ZVAA 1C5ZB 1HRTH 4CH2B 3F9FA 1KIGH 1KLIH
chains in the Genus database with same CATH topology
1XHNA 3VY5A 2D36A 3R5YA 2I51A 1TY9A 2ECUA 2HQ9A 5JABA 2RDEA 5BNCA 3VY2A 2VPAA 2FURA 3K87A 3BA3A 2X1JA 3ZOEA 5KGOA 1USCA 4N7RC 1W3RA 3PFTA 4HMWA 3DNHA 4HMVA 4XRNA 2D38A 2HQ7A 1WGBA 3GASA 5CHEC 1NRGA 5EJ1A 3R5PA 1W3PA 1DNLA 3FGEA 3SWJA 3TGVA 3B5MA 3VYAA 1EJEA 3EC6A 2HTIA 2OL5A 2ECRA 4HMSA 2QCKA 3HY8A 2FG9A 2PTFA 1YOAA 1W9AA 3U5WA 2X1KA 1G78A 1G79A 3R5LA 4FOUC 5EIYA 3R5RA 2ED4A 2FHQA 5EJZA 1I0SA 2E83A 3ZOHA 1W3QA 3F7EA 4YWNA 3A6QA 1RFEA 4P02A 1RZ0A 4HMUA 3NFWA 3KYFA 4RT1A 3RH7A 3K86A 1G76A 3DSGA 1Y30A 4L82A 3ZOCA 4HG6A 4P00A 2D5MA 1YLNA 4I86A 2Q9KA 2R6VA 2QEAA 3ZODA 5CHOA 3FKHA 4Z85A 4F48B 3CP3A 4XJ2A 3A6RA 3IN6A 3E4VA 3R5WA 3BPKA 3KYGA 1WLIA 1RZ1A 3AMFA 3R5ZA 1I0RA 1G77A 3DB0A 3K88A 2AQ6A 2OU5A 3CNRA 4HMTA 4R82A 4ZKYA 3AWHA 2R0XA 3DMBA 2D37A 1VL7A 2L74A 4Y9IA 4HX6A 1T9MA 2IABA 1FLMA 1JNWA 2RE7A 5ESCA 5KECA 1USFA 2ARZA 1W3OA 1WLKA 2ASFA 2HTDA 1WV4A 4F07A 4XHYA 2IG6A 2IMLA 2I02A 3ZOFA 1XXOA 1AXJA 2GJGA 3A20A 4HMXA 3CB0A 2NR4A 3H96A 4IRAA 3ZOGA 4RT0A 5EJLA 3U34A 3BNKA 5KEDA 2HHZA 4YBNA 3U0IA 3U35A 1CI0A 3HMZA 4QVBA 2A2JA 1YWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XHN A;  3VY5 A;  2D36 A;  3R5Y A;  2I51 A;  1TY9 A;  2ECU A;  2HQ9 A;  5JAB A;  2RDE A;  5BNC A;  3VY2 A;  2VPA A;  2FUR A;  3K87 A;  3BA3 A;  2X1J A;  3ZOE A;  5KGO A;  1USC A;  4N7R C;  1W3R A;  3PFT A;  4HMW A;  3DNH A;  4HMV A;  4XRN A;  2D38 A;  2HQ7 A;  1WGB A;  3GAS A;  5CHE C;  1NRG A;  5EJ1 A;  3R5P A;  1W3P A;  1DNL A;  3FGE A;  3SWJ A;  3TGV A;  3B5M A;  3VYA A;  1EJE A;  3EC6 A;  2HTI A;  2OL5 A;  2ECR A;  4HMS A;  2QCK A;  3HY8 A;  2FG9 A;  2PTF A;  1YOA A;  1W9A A;  3U5W A;  2X1K A;  1G78 A;  1G79 A;  3R5L A;  4FOU C;  5EIY A;  3R5R A;  2ED4 A;  2FHQ A;  5EJZ A;  1I0S A;  2E83 A;  3ZOH A;  1W3Q A;  3F7E A;  4YWN A;  3A6Q A;  1RFE A;  4P02 A;  1RZ0 A;  4HMU A;  3NFW A;  3KYF A;  4RT1 A;  3RH7 A;  3K86 A;  1G76 A;  3DSG A;  1Y30 A;  4L82 A;  3ZOC A;  4HG6 A;  4P00 A;  2D5M A;  1YLN A;  4I86 A;  2Q9K A;  2R6V A;  2QEA A;  3ZOD A;  5CHO A;  3FKH A;  4Z85 A;  4F48 B;  3CP3 A;  4XJ2 A;  3A6R A;  3IN6 A;  3E4V A;  3R5W A;  3BPK A;  3KYG A;  1WLI A;  1RZ1 A;  3AMF A;  3R5Z A;  1I0R A;  1G77 A;  3DB0 A;  3K88 A;  2AQ6 A;  2OU5 A;  3CNR A;  4HMT A;  4R82 A;  4ZKY A;  3AWH A;  2R0X A;  3DMB A;  2D37 A;  1VL7 A;  2L74 A;  4Y9I A;  4HX6 A;  1T9M A;  2IAB A;  1FLM A;  1JNW A;  2RE7 A;  5ESC A;  5KEC A;  1USF A;  2ARZ A;  1W3O A;  1WLK A;  2ASF A;  2HTD A;  1WV4 A;  4F07 A;  4XHY A;  2IG6 A;  2IML A;  2I02 A;  3ZOF A;  1XXO A;  1AXJ A;  2GJG A;  3A20 A;  4HMX A;  3CB0 A;  2NR4 A;  3H96 A;  4IRA A;  3ZOG A;  4RT0 A;  5EJL A;  3U34 A;  3BNK A;  5KED A;  2HHZ A;  4YBN A;  3U0I A;  3U35 A;  1CI0 A;  3HMZ A;  4QVB A;  2A2J A;  1YWU A; 
#chains in the Genus database with same CATH topology
 1WUN H;  3CP7 A;  3VY5 A;  3SNC A;  4Z1M D;  5HM9 A;  3SN8 A;  1BTY A;  3UQV A;  1Y5B T;  1MU6 B;  3GDS A;  1KDQ A;  2R3Y A;  2RDE A;  1HAY B;  4FUD A;  3V12 A;  4AOQ A;  4FVD A;  3UOU A;  4MPW A;  3FFG A;  3QTO H;  2YMS C;  1A61 H;  1O3G A;  2XBV A;  1CGJ E;  3M3T A;  3MU0 A;  2J94 A;  2V0B A;  1QR3 E;  2D2D A;  1ELV A;  3MI4 A;  4IMQ A;  2FI3 E;  4FUE A;  3HK3 B;  4FUH A;  3D62 A;  3A84 A;  5GWZ A;  2HTI A;  1ELC A;  2SGQ E;  3UWJ H;  1FQ3 A;  1SBW A;  2ZHE H;  3VB6 A;  2FM2 A;  1C2I A;  2QV1 A;  4ABF A;  3GY5 A;  3A82 A;  1QNJ A;  2ASU B;  1DOJ A;  1OP8 A;  4I8J A;  2QXI A;  1FXY A;  1VGC B;  4Q4L A;  4JYV H;  3WY8 A;  3ZZD A;  2BXU H;  1P05 A;  1CQQ A;  1D3P B;  4LZ4 B;  3N7E A;  3RDZ A;  2AGG X;  2BY6 X;  1NM6 A;  1T7C A;  3LH1 A;  1AWH B;  1J8A A;  1C5Q A;  1T32 A;  1GI3 A;  2W6I D;  1AWF H;  1D3T B;  4FU8 A;  5CHO A;  2IJO B;  1ZGI A;  5FBE A;  1BMA A;  4HFP B;  2ZP0 H;  5DJ7 A;  3CS0 A;  4Z85 A;  1QL7 A;  4B2C A;  4XJ2 A;  2VWM A;  2FLB H;  5C5O A;  1GL1 A;  2KX4 A;  3O8C A;  1JIR A;  4AOR A;  1ETR H;  3IIT A;  2VIW A;  3GCH C;  4K5Z A;  4X2W A;  3P17 H;  3SNE A;  1T4U H;  3OSY A;  1OWK A;  3B23 B;  2Z9I A;  1J17 T;  1UTN A;  1G30 B;  2QF0 A;  3A8B A;  1C2M A;  2OC0 A;  3QZQ A;  1IQL A;  1H8D H;  1EUF A;  1EOL A;  5AFY H;  2R9P A;  3U8T H;  3F2G A;  3UWI A;  5A8X A;  3ODF A;  2QXH A;  1OS8 A;  4TSF D;  1O2M A;  2I02 A;  4NWK A;  4TT3 D;  1YCP K;  3ZZB A;  7KME H;  1P10 A;  1O3P B;  5JPM H;  3EE0 B;  3OE7 D;  8LPR A;  1A5G H;  3LC3 A;  5C94 A;  2ZTZ A;  2BD4 A;  4X6O A;  1PQ7 A;  4BOH A;  2A2J A;  3EAA A;  2SGF E;  2A0Q B;  3W95 A;  1GI6 A;  1JRT A;  2JET B;  4XSK U;  1O3F A;  3QTV H;  1ZHR A;  1UJ1 A;  2EEK A;  1TAL A;  1RTK A;  1W10 U;  4X8V H;  5BNC A;  4D9Q A;  3VY2 A;  1TA2 A;  2XBX A;  3F2H A;  4Y0Y E;  3F1S B;  1V3X A;  3ZOE A;  3E90 B;  5KGO A;  1OWE A;  2Y81 A;  2ZFP H;  2AS9 A;  2FTM A;  1ID5 H;  1KXE A;  1C1P A;  5JBA S;  1A46 H;  2D1J A;  4TYD A;  1GBA A;  2VJ1 A;  2XC5 A;  3NZI A;  4R8T B;  1GCT C;  1YYY 1;  3KF2 A;  2PUX B;  3EC6 A;  1GCT B;  2QAA A;  1FAX A;  1HAO H;  3BF6 H;  3R0F A;  1ANB A;  2HPP H;  4AX9 H;  2ZU1 A;  1MTW A;  4YZU A;  3U5W A;  1LQE A;  1G78 A;  1Y12 A;  3RXB A;  1XX9 A;  2CXV A;  2WIN I;  1D3D B;  1HPG A;  1MKW H;  4Q80 A;  2YNB A;  4UEH H;  1NC6 A;  4K60 A;  1GJD B;  3IWM A;  3F0O A;  4JZI A;  2A32 A;  3MMG A;  3DSP A;  3STI A;  3E91 A;  2ZI2 H;  1JIM A;  1KXC A;  1A0H B;  1GDQ A;  4AG1 A;  1Q3X A;  3LGW A;  3KEE A;  1HUT H;  2GZ8 A;  3SGA E;  1YLN A;  3SBK A;  1PPC E;  1DIC A;  1A1R A;  1O2T A;  1QB1 A;  1YP9 A;  5TCA A;  4LOY H;  2BVS H;  1PPH E;  1GMC G;  1YLC A;  2J98 B;  1V2L T;  1GJA B;  3FKH A;  1TPS A;  3UUZ A;  3SGQ E;  5F8Z A;  4B2B A;  2PHB A;  3PRO A;  1O5B B;  2KAI B;  3TGI E;  1TNI A;  1O3K A;  3AMF A;  3TGJ E;  4NFF A;  2LPR A;  1NFX A;  2FOH A;  5EST E;  1V6D A;  2RA0 A;  2D37 A;  2F9U A;  1DM4 B;  2ZWL H;  4JYU H;  4HX6 A;  3TLO A;  4AYY B;  4B75 A;  1A5H A;  4K3J A;  1A3E H;  4JK5 A;  3SU0 A;  3KL6 A;  3OTP A;  1C4U 2;  1BHX B;  2W6J D;  5A8Y A;  3SOS A;  1C9P A;  1XUJ A;  4ZAE A;  1CU1 A;  1UK3 A;  5DG6 A;  4DY7 B;  2IML A;  1HNE E;  1GI1 A;  2CHA C;  3ZVC A;  1K1P A;  5C5N A;  1OP2 A;  5C17 A;  1F2S E;  1ZSJ A;  4RT0 A;  2Y5G A;  2WYG A;  3TIU A;  1O35 A;  1NO9 H;  3SJ8 A;  2BY7 X;  1C1R A;  2PSY A;  3GCN A;  2A45 B;  5K0H A;  3TH3 H;  2VGC B;  3ZZ9 A;  4RN6 A;  1ZJD A;  1G3E A;  1MKX H;  1ORF A;  1FDP A;  3A7V A;  3QN7 A;  4O97 A;  1GBE A;  2AHM E;  5JBC S;  1E34 B;  2NU2 E;  5JAB A;  4I33 A;  2BLQ A;  2H6M A;  5CHB A;  1EST A;  1FNI A;  4N7R C;  7LPR A;  8GCH G;  1VJ9 U;  4ZKR U;  1WOF A;  1P8V C;  3EA9 A;  5J4Q A;  4ABE A;  5IK2 D;  2ODQ A;  1NT1 A;  1SMF E;  5A0B A;  3NPS A;  1G3D A;  1G37 A;  5T6G A;  2G00 A;  4A92 A;  2PKA A;  5C1U A;  2G51 A;  3ZZ8 A;  3GCT G;  1AB9 C;  1Y5A T;  4YT6 H;  4X8T H;  1EAX A;  1DFP A;  1T4V H;  2HNT F;  2GCH G;  1P12 E;  2OLG A;  4J1Y A;  1MBM A;  1HBT H;  4LXB H;  2QF4 A;  1TGC A;  2FOM B;  3GY7 A;  1GBB A;  3ZIA D;  1E1Q D;  3PMA B;  2R2W U;  2V3M A;  3BSQ A;  5HIZ A;  3FZZ A;  5AFZ H;  1YBW A;  1RIW C;  2WZQ A;  1BMN H;  1P02 A;  2ZNK H;  1QGF A;  3QX5 H;  4B6F A;  1C5L H;  2BVR H;  5L6N H;  4I86 A;  2JJ2 D;  4WY3 A;  4FU9 A;  3PMH B;  3V3M A;  2BD3 A;  1SI5 H;  1DWB H;  3FVF B;  3ZOD A;  1EFR D;  3RXV A;  3LJJ A;  3CP3 A;  3NWU A;  1NFW A;  1W13 U;  2PTC E;  3KYG A;  1HXF H;  1UW7 A;  4AGK A;  1BMM H;  1SGC A;  1TMB H;  2PV9 B;  3PTN A;  1OOK B;  1C2D A;  1WLI A;  1O5D H;  3FOA A;  2J5U A;  1HAX B;  3DB0 A;  3BTT E;  4Y8Z A;  1WYK A;  1XUF A;  1EX3 A;  2ZHF H;  1C5U A;  2L74 A;  1K1O A;  1N6Y A;  2P3U B;  1THR H;  4DG4 A;  1S0Q A;  3TNS A;  2JDI D;  3SV9 A;  1FLM A;  1NU9 A;  3HGN A;  4VGC B;  2ASF A;  1GPZ A;  2ZU4 A;  1XUK A;  3ZYD A;  2NU0 E;  3UAI C;  2NR4 A;  1UTL M;  3BTW E;  1PJP A;  4X8U H;  3GY4 A;  3Q3K A;  1UVU H;  4BAQ B;  1EAU A;  3SV7 A;  1WQV H;  2ODP A;  7GCH G;  1XMN B;  4KTS A;  4YBN A;  4CRA A;  3DHK H;  1QL9 A;  1P04 A;  3A7W A;  2WPM S;  1J16 A;  4ABD A;  2W5E A;  4AYV B;  3CEN A;  1DPO A;  1C5S A;  1T8O A;  5GDS H;  4WJG 2;  4ABA A;  3TNT A;  5BPE A;  4OS1 A;  5BRR E;  1DVA H;  2Y6T A;  1EZU C;  3GY6 A;  5CDF E;  4WH8 A;  1ELD E;  1HYL A;  2SGP E;  3AW0 A;  1TQ7 B;  3KCG H;  3GAS A;  1Y3Y A;  3O8D A;  3SU4 A;  3U9A H;  1GBM A;  3RXQ A;  1H8H D;  4XBB A;  4O03 A;  4K1T A;  2BY9 X;  6LPR A;  3SWJ A;  2PSX A;  2BDI A;  1O38 A;  1H1B A;  2BM2 A;  3SU1 A;  5F6M A;  1FIW A;  2VIQ A;  5AF9 H;  4AC9 A;  1CHO F;  2O8L A;  3BTD E;  5GCH F;  5EIY A;  4OS7 A;  4X1N U;  1SQO A;  2KCO A;  3TK9 A;  2QN5 T;  5CMX H;  1AZZ A;  2F3C E;  2TGD A;  3PMB B;  4UFF H;  2FO9 A;  1E36 B;  1VKY A;  2VWO A;  1HJA B;  1GMD G;  4FUJ A;  3VB7 A;  1P03 A;  5B6L A;  2TPI Z;  1V2N T;  4L82 A;  5C67 A;  2BDG A;  1JBU H;  1UTJ A;  1KXF A;  4AB8 A;  4BAO B;  4ABH A;  2NU3 E;  1S6L A;  4ZKO U;  2P5Z X;  3ODD A;  4Q2K A;  1IQK A;  5IDK A;  4CR9 A;  1FI8 A;  2OQU A;  1XM1 A;  1AN1 E;  1V2V T;  3TU7 H;  1L2E A;  4AFU A;  1FV9 A;  4GVU A;  5DP3 A;  2TIO A;  4TY6 A;  1EZQ A;  2HOB A;  1TYN A;  3GYL B;  1O3M A;  2WPJ S;  3GOV B;  2YMS D;  1QJ7 B;  3SUD A;  1HLT H;  4K1S A;  2Q1J A;  4HMT A;  1S85 A;  3LON A;  4DOQ A;  3EQ0 H;  3LGY A;  2AEI H;  1VL7 A;  2RG3 A;  3RMM H;  2Z9L A;  2Q6F A;  1D6W A;  1YCP H;  4TY7 A;  2ZCH P;  4DT7 B;  2EI7 A;  2XBY A;  3RXT A;  3K9X B;  1IHS H;  2J38 A;  1V2T T;  1FN8 A;  3LGT A;  4E05 H;  3G01 A;  2HTD A;  2G4T A;  3K6Y A;  1WV4 A;  1TE0 A;  3SZE A;  7EST E;  1A7S A;  2BLV A;  3MO3 A;  2B5T B;  3QO6 A;  2ZA5 A;  3RXI A;  4RSP A;  2ZDL A;  2ZHD A;  3H96 A;  3M3V A;  1QRZ A;  3N7O A;  1FIZ A;  3BNK A;  1KXB A;  1DWD H;  1UTQ A;  1SGQ E;  3H09 A;  2ULL A;  4INH A;  2JJ1 D;  2ALP A;  1FPH H;  5E0H A;  2VIV A;  2CF9 H;  4U32 A;  1O3B A;  1TNJ A;  3KGP A;  1C1W H;  2AER H;  3L33 A;  3ZZA A;  2IJD 1;  4TPI Z;  1ZTK A;  3RXD A;  5EGM A;  3BA3 A;  1XXD A;  2K1Q A;  5CHA B;  4IGD A;  4YO9 A;  1ZR0 A;  4Y7A A;  1EAS A;  1GI8 B;  5EQS A;  1GBF A;  5EJ1 A;  2BVX H;  2P8O B;  1CA0 B;  5HKK D;  4MNY A;  5HIY A;  1AVX A;  2P3T B;  1G9I E;  2A7H A;  3QDZ B;  3LGU A;  5EPN A;  1BRA A;  1Z7K A;  3VB5 A;  1TWX B;  2A5K A;  1P2Q A;  1C5M D;  4CBN A;  4Y76 A;  2VWL A;  1W0K D;  1Z8R A;  2C8W B;  1QTF A;  4OM9 A;  1OWH A;  5L2Z H;  4MPU A;  5EJZ A;  1ELB A;  5GJ4 B;  3PLP A;  1GMH G;  3F7E A;  1TGS Z;  1GHA F;  2VVC A;  1QA0 A;  2AYW A;  1SGD E;  1L1N A;  4KEL A;  4Y79 A;  2PP6 A;  2V3O H;  1V2W T;  3RXE A;  4DVA U;  3Q76 A;  4WH6 A;  3VG8 A;  3GYM A;  1HAV A;  3RUO A;  2Z94 A;  4JZF H;  4UFE H;  1IQM A;  4XBC A;  1NRO H;  4CRB A;  1NBM D;  5C1Y A;  4B73 A;  3VB4 A;  4ISH H;  3H7O A;  2OC8 A;  1V2Q T;  1W2K H;  4OS2 A;  1QY6 A;  2UUF B;  1ESA A;  4DT4 A;  1ZSK A;  2ZPS A;  6EST A;  2FP7 B;  3S9C A;  1A4W H;  1G77 A;  4K8B A;  4LZ1 H;  1KDQ B;  3ATL A;  2R0X A;  4ZKN U;  3T2N A;  3V13 A;  2A7C A;  1EPT B;  1CHO G;  3BG8 A;  4OS4 A;  2J98 A;  1T9M A;  4NA8 A;  5FL7 D;  5PTP A;  2B8O H;  2ZFT A;  2GTB A;  1K1M A;  1N8O C;  4WF8 A;  3PRB A;  2KCA A;  4D76 A;  3D65 E;  1L0Z A;  1O3I A;  1W14 U;  4FUG A;  1CGH A;  4CRE A;  1V2U T;  1UCY H;  4GCH G;  4WMF A;  1COW D;  2VIN A;  3D49 H;  3GDV A;  3U1J B;  5DO4 H;  3ZVB A;  1O2Q A;  4FU7 A;  1KSN A;  2UWL A;  4BXS A;  2FPZ A;  3WWB A;  1KXD A;  1NBM E;  2VWN A;  1K1N A;  3L3T A;  4J2Y B;  5LPF A;  1JRS A;  2XYA A;  1LKB A;  4BXW A;  4ISI H;  1LHD H;  2I51 A;  1Q31 A;  3EDX B;  1Z6J H;  2ZEB A;  1SGF A;  4IW4 E;  1WQS A;  4F4O C;  3K6Z A;  4E7N A;  2GDE H;  2ZHQ H;  3RU4 T;  1YPM H;  5L30 H;  3Q00 A;  3RXM A;  3SJI A;  1P9U A;  3UIR A;  1XXF A;  1FMG A;  3PYH A;  1P2N A;  1Z1J A;  2VVV A;  3AVZ A;  1AFE H;  1AD8 H;  3T26 A;  3RM0 H;  3TGV A;  1EJE A;  2FX4 A;  3FO8 D;  3A8D A;  1AVG H;  1F0S A;  2P3F H;  3M5L A;  5TCC A;  2FG9 A;  2DUC A;  5L2Y H;  1NES E;  2CF8 H;  5EW1 H;  4XBD A;  4WMD A;  3A8A A;  1EQ9 A;  1LMW B;  6CHA C;  1P2I A;  2HLC A;  4X6M A;  5LH8 A;  2FHQ A;  1GJ7 B;  2BDY A;  2M2A A;  2XCF A;  3RC6 A;  1AE5 A;  2E83 A;  1VCQ A;  3M61 U;  2A2X H;  1LHF H;  3V7T A;  4JZD H;  2EI8 A;  1EAT A;  4RT1 A;  2G52 A;  9EST A;  1GBK A;  1AO5 A;  3QWC H;  5GIB A;  2FOD A;  4MVN A;  5JB8 S;  1Y8T A;  4INL A;  1WTG H;  3RM2 H;  4CRG A;  1SGP E;  1HB0 B;  2BD8 A;  2JET C;  4Y8X A;  2GD4 B;  5T3H A;  1XKB C;  2EY4 C;  1BRU P;  1NS3 A;  5HYO A;  3R5W A;  1YKT A;  1CT4 E;  1OP0 A;  3NUM A;  3ZZ6 A;  2VU8 E;  1GGD B;  2V6N A;  4JZE H;  2XNI A;  2QGR A;  2OXS A;  3KHV A;  3MOC A;  2OU5 A;  2CHA B;  3SJK A;  1O3D A;  1GI0 A;  1TOM H;  1QBO A;  3NCL A;  2KM0 A;  2ZFR H;  1C1N A;  2F91 A;  1QFK H;  2H9T H;  3GCT F;  1C2L A;  4Y10 E;  5EPY A;  1E38 B;  2ALV A;  4M7G A;  5KEC A;  1SKY E;  2ARZ A;  1YPH C;  2G5V A;  3MU4 A;  4KTU A;  3UNQ A;  1XXO A;  4KP0 A;  4NSY A;  3A7Y A;  4BAH B;  3CB0 A;  1EAI A;  2GUJ A;  5EJL A;  2HNT E;  1MUE B;  2ZCK P;  1OHH D;  1TRN A;  1QJ1 B;  2AGI X;  3SND A;  1W0Z U;  2RFK C;  2VH0 A;  2P16 A;  3DSO A;  5JDU B;  2QXG A;  5HGG A;  2NU1 E;  3LKW A;  1O3J A;  4FUC A;  5T6F A;  1O0D H;  3KQ5 A;  4D8N A;  4ISN A;  3F2F A;  3GY8 A;  2CV3 A;  3STJ A;  2J4I A;  1FLE E;  4D7F A;  1O2P A;  2Y5F A;  2A5A A;  3TVJ B;  1GHY H;  1NRG A;  1SQR A;  1GBJ A;  1XUG A;  3E1X B;  1TMU H;  1SGI B;  3QGJ A;  2KAI A;  3LDX H;  1SHY A;  3RXO A;  2OL5 A;  1BT7 A;  5DPA A;  1XUH A;  2ANW A;  3NKK A;  1YOA A;  3QZR A;  2KR7 A;  2ZCL P;  5T6D A;  1KLT A;  1UK4 A;  4FOU C;  3DCL A;  2C4F H;  4XD7 D;  1CBW B;  1NPM A;  2XCN A;  2TGT A;  3GIC B;  5K7R A;  2ED4 A;  3E8L A;  1SG8 B;  1WAY B;  2LP6 A;  1DLE A;  1S0R A;  3TK5 A;  3A7T A;  2ZU5 A;  4ASU D;  2GMT B;  1C5V A;  3MNC A;  2ZF0 H;  2UWO A;  1EPT C;  3JZ1 B;  3RXH A;  1TPO A;  5HM2 A;  3K86 A;  1YLD A;  1HXE H;  1C4Y 2;  3URD A;  1XVO A;  2Z3E A;  4UD9 H;  1O37 A;  1QRW A;  1EB2 A;  5DSF A;  1X7A C;  2AIQ A;  3NRL A;  3U8R H;  2O8T A;  2UUK B;  4IS5 A;  1E0F D;  4NG9 H;  1HAH H;  2DE8 A;  4SGB E;  3R3G B;  2ZPR A;  4RI0 A;  4DIH H;  1BTX A;  2XBW A;  1YC0 A;  1H4W A;  3EA7 A;  4R0I A;  2GZ7 A;  1ELF A;  5F8T A;  1UK2 A;  3E4V A;  1F0R A;  1GG6 C;  2FS9 A;  1EJA A;  1Y3X A;  1TX7 A;  1O3E A;  4CRD A;  2PKA B;  3KQB A;  4IC6 A;  2JH0 D;  1CO7 E;  2FDA A;  1EOJ A;  1P3C A;  2ZKS A;  1UCY K;  3BN9 A;  2A4R A;  2OTV A;  1DY8 A;  1HCG A;  3HKJ B;  4CHA C;  2GZ9 A;  3M35 A;  2VBC A;  1G2L A;  4BAK B;  3GCO A;  1ZML A;  1PQ8 A;  2VB0 A;  5LPR A;  5LGO A;  1TB6 H;  1YM0 A;  2G81 E;  2Z3D A;  1DAN H;  4MPX A;  1ZLR A;  4ZCN A;  3ZYE A;  2BD5 A;  5FPS A;  4NIW A;  1K9O E;  3T25 A;  3UTU H;  3TK6 A;  1AB9 B;  3RML H;  1VCW A;  3TGK E;  4ZHL U;  2A5I A;  4YOG A;  2YMS B;  1EB1 H;  4MLF B;  3DFL A;  3ZZ3 A;  3UY9 A;  2WPI S;  1MAB B;  4MQA A;  1CI0 A;  1IQI A;  1C2J A;  1HAG E;  2GGV B;  1XHN A;  4AGJ A;  1O3C A;  3MNS A;  2R0L A;  1C1V H;  3RC5 A;  3N7D A;  1O2L A;  1SPJ A;  2K0Q A;  4A5T S;  2VPA A;  2ODY B;  3SU2 A;  3ZV9 A;  4I8G A;  5E2P A;  1RRK A;  1W3R A;  1MKX K;  1GHV H;  1OX1 A;  1TNG A;  2TGP Z;  3ATM A;  1ZPC A;  1O2N A;  5A0C A;  1O5G H;  3R5P A;  1ZZZ A;  1LKA A;  4ACA A;  2GT7 A;  1O2S A;  2WUB A;  4ZRO A;  3EE7 A;  4M9F A;  2HVX A;  1C2F A;  3D23 A;  1C1S A;  4HMS A;  2XWA A;  3AK5 A;  1QJ6 B;  3RXU A;  3HK6 B;  2O9Q A;  3SI3 H;  2C8Z B;  4YOI A;  3KQC A;  4ZUH A;  2FEQ H;  1MKW K;  3W1E A;  1S84 A;  4X2Y A;  1TGN A;  2Q6D A;  1BTZ A;  1M9U A;  2Z9K A;  1O2G H;  3U69 H;  2J9N A;  4B76 A;  4X1S U;  2OK5 A;  4VGC C;  2WPD D;  5FX5 A;  1WXR A;  2GX4 A;  1AMH A;  3SU5 A;  4I7Y H;  1TNK A;  2AH4 X;  5JB9 S;  1SR5 C;  1GBT A;  5H4I B;  2BQW B;  2ZQ1 A;  1FY8 E;  4GLY A;  2FTL E;  1LQD B;  3ZOC A;  1CBW C;  4HG6 A;  1J15 A;  1S81 A;  4X6N A;  1BOQ A;  4MPV A;  5GXP A;  1E37 B;  1RFN A;  2ZDN A;  2VH6 A;  2XC4 A;  2VIP A;  1C1Q A;  2BDC A;  4KGA A;  1WTH D;  1Z8G A;  2EST E;  3M37 A;  2ANM H;  1FY5 A;  3UR6 A;  4INK A;  2GVF A;  5B6O A;  3E0P B;  1B0F A;  4Y7B A;  1G2M A;  2QF5 A;  1PQ5 A;  3RU4 E;  2BLW A;  4IC5 A;  3GDU A;  2H9E H;  3ATI A;  2RCE A;  4ACB A;  1BTU A;  1IQG A;  1DX5 M;  3DMB A;  1Y3W A;  2R2M B;  1A0L A;  1LO6 A;  1TPP A;  1ARC A;  1ESB A;  3OYP A;  4SGA E;  2JH5 D;  1UO6 A;  1A3B H;  1IOE A;  1C1O A;  1AHT H;  4D9R A;  1IQN A;  1UHB B;  5ETX A;  2GJG A;  2WV4 A;  4KKD A;  3ZV8 A;  4CRC A;  1TRY A;  3ZOG A;  3MU8 A;  2FLR H;  2KCP A;  2XXL A;  4A7I B;  1PPE E;  2GKV E;  4MG3 A;  1LVY A;  2XWB I;  1K21 H;  3LJO A;  1C4V 2;  5AHG H;  2FOC A;  1GMC F;  2H5D A;  3SU3 A;  3LT3 A;  1MQ6 A;  2FOF A;  1BRC E;  4MNW A;  3KN2 A;  3RXS A;  3RXC A;  1QB6 A;  1P2M A;  2A4G A;  2B7D H;  1O2O A;  3OX7 U;  4X2X A;  3K87 A;  1TX8 A;  1ZMJ A;  2H1U A;  3KNX A;  2BD2 A;  1CE5 A;  3DNH A;  4HMV A;  4RKO B;  1P2K A;  3BEU A;  1O3H A;  2D38 A;  3PV2 A;  1C1U H;  4H42 U;  1GG6 B;  3E0N B;  5E8E H;  3A85 A;  3QUM P;  1AND A;  1W3P A;  1O2H A;  3WWF A;  2C8X B;  2VNT A;  2QCK A;  2I6S A;  1NRQ H;  3URC A;  2V3H H;  4NSV A;  1W9A A;  1GBH A;  2A31 A;  1P57 B;  2JH6 D;  1NZQ H;  3UPE A;  1AUT C;  3L6P A;  3PWB A;  2PTN A;  3F3B A;  2VVU A;  3O8R A;  1KTT B;  2FYQ A;  4O3T A;  3ELA H;  5DKM A;  1O36 A;  3SGB E;  1JXP A;  2F9P A;  1QB9 A;  3C27 B;  2QA9 E;  2AMD A;  4K1E A;  1P09 A;  1O30 A;  1W3C A;  3S7H B;  1VCP A;  3F9G A;  5A09 A;  2DE9 A;  2Q9K A;  1GBC A;  1SFI A;  1O2Y A;  2FIR H;  4AFQ A;  2C90 B;  3PO1 B;  2BD9 A;  1TAW A;  1GWA A;  2QXJ A;  1DDJ A;  3A6R A;  1ZOM A;  2C93 B;  2ZC9 H;  1QUR H;  3SJO A;  1GHX H;  1ZTJ A;  1GGD C;  1K1L A;  2ANK H;  4MNV A;  4R82 A;  1ETS H;  5I46 H;  3M3S A;  3VFE A;  2OIN A;  1E79 D;  2QE7 D;  2AGE X;  4TV4 A;  3VEQ B;  4W64 A;  3KQD A;  4NZL A;  1HJA C;  1HAZ B;  1JNW A;  2PUQ H;  3PM3 A;  3U28 C;  1G36 A;  2BDH A;  4XHY A;  1EZS C;  5DGJ A;  1SLW B;  4X1Q U;  4WME A;  6GCH G;  7GCH F;  2B0F A;  1BUI A;  5JBB S;  4JCN A;  5EOD A;  1DUA A;  2F9V A;  1QIX B;  2WHX A;  3ENS B;  3LH3 A;  1E1R D;  2CMY A;  2WPK S;  1HFD A;  1PPG E;  1N8O B;  2B9L A;  1GI7 B;  3U8O H;  3I77 A;  1W7G H;  3AW1 A;  1ZPZ A;  3AAU A;  2L1T A;  1OXG A;  1AZ8 A;  4MTB A;  2X1J A;  1EKB B;  3EGK H;  3MH7 A;  1TX6 A;  2ZGX H;  2ZZU H;  1EJM A;  2HQ7 A;  5CHE C;  1VIT F;  1U6Q A;  1V2R T;  4Y0Z E;  8EST E;  1WCZ A;  1L1G A;  1L4Z A;  2BDA A;  1BA8 B;  2TGA A;  3BIV H;  1Y3V A;  4AB9 A;  2PTF A;  1GJB B;  1ELG A;  1TAB E;  1MTN C;  2Y5H A;  1W0J D;  2F83 A;  4MNX A;  1AFQ B;  1CSO E;  4JYT A;  3ZOH A;  1W3Q A;  2O8W A;  3PO1 C;  1AUJ A;  3FZD A;  1NRN H;  3GY2 A;  1C5R A;  2STB E;  3TJN A;  4XDE A;  2K4Q A;  1YPG H;  1UTM A;  3CS7 A;  5DN6 D;  2PWX A;  3MNX A;  4BTI B;  4DJZ B;  3SV8 A;  2THF B;  2Y82 A;  2V7Q D;  2ZGC A;  1SGR E;  3VXE H;  2NWN A;  8KME 2;  2BZA A;  2L6O A;  3DFJ A;  2K8I A;  1OPH B;  1B7X B;  1MZD A;  1O3O A;  4XOJ A;  4ZH8 A;  4ASH A;  4GPG A;  1KLJ H;  1MAX A;  3PLB A;  1XKA C;  3SI4 H;  3BTH E;  1SL3 A;  3RLW H;  1T31 A;  3A7X A;  2ZEC A;  4WXI A;  1O2K A;  1QHR B;  1AKS A;  1XUI A;  1CA0 C;  5C20 A;  1Z6E A;  1V2O T;  1AI8 H;  4THN H;  1IHT H;  3ZZ7 A;  4OS6 A;  1DE7 H;  4ZKY A;  3MTY A;  1IQE A;  1LHG H;  1ZRB A;  1P9S A;  1O2J A;  3LGI A;  1A0J A;  3F68 H;  3RXJ A;  4GUX A;  1EP5 A;  3MWI U;  1W3O A;  4DCD A;  4F07 A;  4Z6A H;  1NFU A;  2XTT B;  3IG6 B;  3BTE E;  1C9T A;  1F0T A;  4Q7X A;  1C5X B;  2ZHW H;  3M5O A;  2ZFF H;  4ABB A;  4IRA A;  3M7T A;  4OGX A;  1KXA A;  6GCH F;  4ABG A;  4B71 A;  3FN8 A;  4GHQ A;  2HHZ A;  4IMZ A;  1BCU H;  1LPK B;  3HMZ A;  3UQO A;  1JOU B;  4QVB A;  2JIZ D;  1YWU A;  2A7J A;  1FZZ A;  3ZZ5 A;  2ZGB H;  3MH4 A;  1ABJ H;  2CN0 H;  3LU9 B;  1FY1 A;  1GBD A;  1TY9 A;  3I78 A;  1MD8 A;  2IPH A;  2FOA A;  1ZSL A;  3ZZC A;  2FUR A;  3URE A;  1N1L A;  2OBQ A;  1W8B H;  3OAA D;  1MQ5 A;  3S69 A;  3OU0 A;  1D6R A;  3F6U H;  2AMQ A;  5A2M H;  1TIO A;  2ZGH A;  3OY5 U;  2ANY A;  1E35 B;  1YGC H;  1HIA A;  5CHA C;  1LVB A;  1W11 U;  4AZ2 B;  4UDW H;  4H4F A;  3SJ9 A;  3U1I B;  1O31 A;  1O3A A;  2AMP A;  2PGQ B;  1ZYO A;  5DP9 A;  3EAJ A;  1C5Y B;  4ZHM U;  1Y59 T;  1S5S A;  2LNC A;  5E0J A;  1K22 H;  3BTK E;  1I0S A;  1L1J A;  1IQJ A;  2FYR A;  2Z7F E;  2XOK D;  5T1V A;  1GJ9 B;  1O2I A;  3KYF A;  1FN6 A;  1GHA G;  3UOP A;  5JBT A;  1AU8 A;  2G8T A;  3SO3 A;  5C1X A;  2KCY A;  1P3E A;  2YNA A;  4RKJ B;  3RLY H;  2GV6 A;  2PLX A;  2BX4 A;  2WPL S;  4CRF A;  5EXM A;  2SNW A;  2IN2 A;  4Q63 A;  3M7U A;  4YLU A;  2M5T A;  3A89 A;  3IN6 A;  2P8O C;  3P70 B;  2NU4 E;  2W26 A;  2P93 A;  2QC2 A;  3Q3Y A;  2FES H;  3SHC H;  1GVL A;  1F0U A;  1UVS H;  1ANC A;  1BTW A;  3KID U;  3FP7 E;  1H9H E;  3MH5 A;  4X8S H;  2BD7 A;  2GT8 A;  4NFE A;  2XW9 A;  1MH0 A;  1EZX C;  3RXL A;  1A5I A;  1B0E A;  2BOH B;  1THS H;  2ZDV H;  4PRO A;  1GVZ A;  2G55 A;  5DP6 A;  3RXG A;  4NGA H;  3Q3X A;  2OBO A;  3ZVD A;  1T8L A;  1OKX A;  2ZFS A;  1HDT H;  1DS2 E;  1F5R A;  1L4D A;  4GAW A;  2FX6 A;  2BY8 X;  1FX0 B;  4ISL A;  1CT2 E;  2Z3C A;  1MCV A;  2FZZ A;  5EXL A;  1H9I E;  2BTC E;  1DST A;  1SGE E;  4NWL A;  4Y11 E;  1RS0 A;  3PLK A;  1GHW H;  2OP9 A;  1O2X A;  3LGV A;  1PPZ A;  3I29 A;  4QT8 C;  3RXF A;  1MMJ N;  1H9L B;  1V2M T;  3N99 A;  1GJC B;  3SU6 A;  5F03 A;  2ZDK A;  1C1T A;  5AVD A;  3HGP A;  4WVP E;  4B1T A;  1SSX A;  2W3I A;  3H7T A;  4ZXY H;  3U98 H;  1QBN A;  1P06 A;  1OYT H;  3SNA A;  3RU4 D;  2HVY B;  3P92 A;  2CK3 D;  4HMW A;  4I32 A;  4YT7 H;  5J4S A;  2WYJ A;  2LEL A;  3A88 A;  5FCK A;  1DSU A;  3Q77 A;  1S83 A;  5C3N A;  1Z8I B;  1N6X A;  1C5N H;  1G3C A;  1O2Z A;  2Z9G A;  3DUX H;  2Q6G A;  1IQF A;  3HY8 A;  2G4U A;  2OCV B;  2HAL A;  1K1J A;  9LPR A;  1SQT A;  1GCD A;  1G79 A;  1SGN E;  3SV6 A;  1YPE H;  3LOX A;  1Q2W A;  2QCY A;  1RXP A;  2ZO3 H;  2GP9 B;  2ZU2 A;  4P02 A;  1VJA U;  4HMU A;  1BJU A;  2F9O A;  3NFW A;  4YOJ A;  4Y71 A;  3SNB A;  1PYT C;  1Y30 A;  1LVO A;  4ABJ A;  1NFY A;  2Y80 A;  3C1K A;  1SLX B;  1F5L A;  1WSS H;  1UVO A;  2GV7 A;  5GND A;  1Y3U A;  1SHH B;  1HV7 A;  5A8Z A;  1BTP A;  4IBL H;  5GCH G;  1T8N A;  2BYA X;  1BZX E;  2WSS D;  3BEF B;  5DK1 A;  2GMT C;  4I8H A;  2BOK A;  2BDB A;  1DLK B;  1P2J A;  1Z71 A;  1C2K A;  3BEI B;  3PWC A;  4O9V A;  1FPC H;  1HGT H;  5E0G A;  1QL8 A;  3AAS A;  3QGN B;  2BX3 A;  5E2O A;  4CHA B;  3VGC C;  1CVW H;  1DIT H;  1HAV B;  1GDU A;  2STA E;  3CNR A;  2AQ6 A;  1ELT A;  1GI4 A;  1OSS A;  3A86 A;  3E6P H;  4FVB A;  3RMN H;  3TJV A;  1AY6 H;  4Y9I A;  1CHG A;  3SQH E;  2A1D B;  1DXW A;  2D8W A;  4NZQ A;  2IAB A;  5ESC A;  4TPY A;  3M5N A;  4ZMA H;  4UFG H;  1O2U A;  1RGQ A;  4DUR A;  1PYT D;  1Z8J B;  2QF3 A;  3OY6 U;  1VIT G;  3NXP A;  1YY3 A;  1VR1 H;  1GL0 E;  5JYI A;  1TBR H;  3B9F H;  2GCH F;  3M7Q A;  4WWY A;  1MBQ A;  5DP7 A;  1GMH F;  1BBR H;  1C5P A;  4BAM B;  1BIO A;  1DY9 A;  1MU8 B;  3HAT H;  2D26 C;  2BY5 X;  4D7G A;  2EA3 A;  4K69 A;  4BNR A;  1BIT A;  1O2R A;  1GI9 B;  1UVT H;  1JWT A;  1AE8 H;  2H9H A;  2TBS A;  3A8C A;  4OGY A;  3MHW U;  3RXA A;  4HI3 A;  5FX6 A;  3V4H A;  1IQH A;  2O8U A;  3WW7 A;  3P95 A;  4NA9 H;  5F8X A;  2PKS C;  4YLQ H;  1KTS B;  1QZ8 A;  4XRN A;  5EXN A;  3DD2 H;  1B5G H;  3PV5 A;  3PB1 E;  3ATK A;  3UR9 A;  1DUE A;  3T27 A;  3T29 A;  1UTO A;  3PTB A;  2FS8 A;  3S9B A;  4I8K A;  4B74 A;  1HAP H;  3PMJ A;  4K2Y A;  1RD3 B;  1WU1 A;  1V2J T;  5FPY A;  4GSO A;  4ISO A;  2X1K A;  1TQ0 B;  1C2E A;  3R5L A;  3UB0 A;  4X1R U;  1FAK H;  1V2P T;  2HWL B;  4NIV A;  3F9H A;  2JKH A;  3ATW A;  4U2W A;  5TJX A;  4MTK A;  2VGC C;  3FAO A;  4ZKS U;  3A80 A;  1RFE A;  1SOZ A;  3ZVE A;  1UVP A;  3GS9 A;  2HPQ H;  1BHX F;  2FWW A;  3HKI B;  2RA3 A;  2Z6B D;  5IYT A;  1GJ5 H;  4P00 A;  1C2G A;  5FAH A;  3EA8 A;  3TJU A;  3EST A;  2ZIQ H;  1GJ8 B;  4NIY A;  3MNB A;  1LPG B;  1SGT A;  1SB1 H;  3SHA H;  4KTC A;  2BZ6 H;  4H6T A;  2HNT C;  4JZ1 A;  1H8I H;  3RC4 A;  3SUF A;  1ABI H;  3A7Z A;  1SQA A;  1O34 A;  1BDA A;  1LTO A;  3F0P A;  1KYN A;  4HKH A;  3MFJ A;  1I0R A;  1YPH E;  1THP B;  3FP8 E;  1F7Z A;  2F4L A;  1PPF E;  1BJV A;  5FHT A;  1AKS B;  1QRX A;  1CT0 E;  1BMF D;  2ZTY A;  3ITI A;  4K8Y A;  3RXP A;  2BQ6 B;  5FXL A;  2RE7 A;  4BTT B;  2EC9 H;  3F9E A;  1BB0 B;  1BML A;  4U01 A;  4A1X A;  1EXF A;  1G32 B;  1ZGV A;  4Y8Y A;  2RDL A;  3GY3 A;  3A87 A;  3JZ2 B;  3ZOF A;  2QIQ A;  2UWP A;  4E06 H;  1J14 A;  1YF4 A;  1S6F A;  1D9I A;  3A20 A;  3OFN D;  1OWJ A;  1O5A B;  4I8L A;  4FET A;  4GHT A;  3VPK A;  1LHE H;  3U34 A;  4CBO A;  3NK8 A;  1GMD F;  4X6P A;  4UHV A;  3SW2 B;  5KED A;  1UCY E;  5LPE A;  3U35 A;  3V0X A;  1Y5U T;  5C2Z A;  3BTG E;  1DT2 A;  3PV4 A;  1RTL A;  4TWW A;  3P8O A;  4YM9 A;  1ANE A;  1ACB E;  3BV9 B;  1O3L A;  3R5Y A;  3MQK C;  1MCT A;  1SGY E;  3FP6 E;  1TPA E;  1MAY A;  4Z0K A;  1S82 A;  1INC A;  2ZU3 A;  4FUI A;  4U30 A;  5FPT A;  1CA8 B;  1QCP A;  1TLD A;  2XND D;  2HGT H;  1HIA B;  1NN6 A;  5F53 A;  3GCH B;  6CHA B;  3LPR A;  3BG4 C;  3LIW A;  3W94 A;  1WGB A;  2ZDA H;  4Q7Z A;  4DW2 U;  1QBV H;  1CGI E;  2PR3 A;  1GJ4 H;  1SLV B;  2A4O A;  3FGE A;  2CGA A;  2CJI A;  3B5M A;  3SOR A;  1HAI H;  4H6S B;  2ECR A;  1WBG B;  2H5C A;  2ZG0 H;  3M5M A;  2PGB B;  1ETT H;  2FOB A;  2SGE E;  4XFQ A;  4F49 A;  1O32 A;  2Y7X A;  5EG4 A;  1LPZ B;  3MYW A;  4X1P U;  1SFQ B;  1MD7 A;  1MTU A;  1RJX B;  1EJN A;  3A6Q A;  3M36 A;  1O5E H;  1UHB A;  2J92 A;  1NRP H;  2HLD D;  1F5K U;  2OQ5 A;  1P11 E;  3DSG A;  1KY9 A;  4ZXX H;  5HXF A;  2UUJ B;  3O8B A;  2J34 A;  4A1T A;  4UE7 H;  5HMA A;  5DP8 A;  2QEA A;  3VGC B;  1QQU A;  1ZRK A;  1LDT T;  1K2I 1;  2O8M A;  4UFD H;  3DA9 B;  2I6Q A;  1TFX A;  3SUE A;  1NU7 B;  2ZDM A;  8GCH F;  1ELE E;  4OS5 A;  2UUY A;  2FI4 E;  1AIX H;  3R5Z A;  1VIT H;  2VID A;  2ZTX A;  1ZHM A;  2WV9 A;  3K88 A;  1A2C H;  1YPK H;  2VIO A;  3BIU H;  4GCH F;  1K28 D;  2ZQ2 A;  1O3N A;  3MO6 A;  4AFZ A;  1PPB H;  3AWH A;  3BTM E;  1DXP A;  4NCY A;  2A2Q H;  4FXG H;  1MTN B;  2W3K A;  1VZQ H;  2XRC A;  3A83 A;  1QA7 A;  4A6L A;  1SVP A;  1WLK A;  2OD3 B;  4JK6 A;  4AN7 A;  3MH6 A;  3GIS B;  1SLU B;  1C5O H;  2ZFQ H;  1ZPB A;  2SFA A;  3HE1 A;  3QLP H;  4HMX A;  1C5T A;  3SQE E;  1FON A;  1AQ7 A;  1C2H A;  1DWC H;  2P59 A;  1GDN A;  1HJ8 A;  1EPT A;  2P94 A;  2XC0 A;  3ZVG A;  2SNV A;  3P8F A;  5ABW A;  1J9C H;  2D36 A;  4JMY A;  3VB3 A;  5EU8 A;  4LK4 A;  3TPI Z;  3OTJ E;  1D4P B;  1GHZ A;  2OUA A;  1P01 A;  1SOT A;  2PFE A;  2SGD E;  1TMT H;  1AFQ C;  1W12 U;  3SZN A;  4E7R G;  3T62 A;  3VYA A;  4NIX A;  4BAN B;  3FAN A;  1UTK A;  3MU1 A;  1YPL H;  4YTA A;  1C5W B;  5DP5 A;  1QQ4 A;  3R5R A;  4X0W U;  1GBL A;  4A1V A;  3TH4 H;  1TBQ H;  4DGJ A;  4Q7Y A;  1DWE H;  1TBZ H;  1RZ0 A;  5EQR A;  1F92 A;  1VGC C;  3RH7 A;  1O5C B;  1ZMN A;  1G76 A;  4XE4 A;  4I31 A;  1W7X H;  1MTS A;  2G5N A;  1P0S H;  2Z9J A;  4HTC H;  4AFS A;  2AIP A;  5FBI A;  4O3U A;  2R6V A;  1GVK B;  2KFW A;  4FUF A;  4YXW D;  1ZJK A;  1D3Q B;  1S6H A;  1JMO H;  2FOG A;  3S9A A;  1GHB F;  1MZA A;  4ZHA A;  3P8G A;  1EP6 A;  1YPJ H;  3S0N A;  1TOC B;  3BTF E;  4CH8 B;  1BRB E;  1K1I A;  1RZ1 A;  3VXF H;  2BXT H;  2C3S A;  5I25 A;  3TJO A;  1WV7 H;  2TRM A;  1K0H A;  5EQQ A;  1GJ6 A;  5CE1 A;  2R0K A;  3UFA A;  4F55 A;  4TWY A;  3T5F H;  3TIT A;  3LC5 A;  2J95 A;  3B8J A;  4NA7 A;  3SUG A;  2FXR A;  2P95 A;  2IOT A;  1O33 A;  3PRD A;  2HRV A;  2IPQ X;  1NRR H;  5SGA E;  5G4B A;  3ZVF A;  4FUB A;  1AXJ A;  4X2V A;  2J2U A;  1NTP A;  1G3B A;  4HZH A;  4EST E;  3U0I A;  4CR5 A;  1TGB A;  1PQA A;  3E16 B;  2EI6 A;  1FUJ A;  2PW8 H;  2F9N A;  3RXR A;  1IAU A;  3BG4 B;  1LCY A;  2F43 B;  2BLO A;  1WDI A;  1BTH H;  2PKS B;  2HQ9 A;  2ECU A;  3AAV A;  1V2S T;  1W0Y H;  1BQY A;  5EW2 H;  1BBR E;  2YOL A;  1TNH A;  1USC A;  3OEH D;  2GCT B;  3PFT A;  3K65 B;  1PFX C;  1LHC H;  1T8M A;  1FY4 A;  1P2O A;  3MU5 A;  3MO9 A;  5EOK A;  4MDS A;  1SGF G;  1Z1I A;  2OC1 A;  1EAW A;  5C0T A;  1DNL A;  4B2A A;  1OYQ A;  1ZTL A;  4AG2 A;  3UNS A;  3P6Z B;  2W7U A;  3QK1 A;  1GI2 A;  2BHG A;  1O2W A;  3SYJ A;  3S7K B;  1FY3 A;  1TGT A;  3P8N A;  1ZHP A;  2FOE A;  2ZGJ A;  1KMH B;  1H8E D;  2R3U A;  3H5C B;  3TH2 H;  1TNL A;  3T28 A;  3RMO H;  4WXV A;  3A81 A;  1O5F H;  4HGC A;  4YES B;  4B6E A;  4YWN A;  2OC7 A;  1O39 A;  2GDD A;  3RXK A;  2A4Q A;  1O2V A;  1FJS A;  4Y6D A;  4UON A;  2WUC A;  1NY2 2;  3BTQ E;  1MTV A;  3E3T A;  4BTU B;  2WV5 A;  3RP2 A;  1NRS H;  2D5M A;  3FKS D;  2SGA A;  1RIW B;  2Y7Z A;  1ELA A;  1UTP A;  3SV2 H;  4IN2 A;  2FI5 E;  5A0A E;  4F48 B;  5C0U A;  2C8Y B;  2H2Z A;  3BPK A;  1RTF B;  2QYI A;  4ABI A;  1GHB G;  1BBR K;  2V35 A;  1TRM A;  5ESB A;  2GCT C;  5FCR A;  1YCP M;  2BMG B;  2EQN A;  1OWD A;  4DII H;  1GI5 A;  1XVM A;  1GBI A;  1UMA H;  1HJ9 A;  3DT0 H;  1OWI A;  1AGJ A;  5GPI B;  2QY0 B;  2WPH S;  1ARB A;  3HPT B;  3UNR A;  1USF A;  2ILN A;  3ZZ4 A;  1V2K T;  2IG6 A;  4IN1 A;  1AVW A;  1TON A;  2FMJ A;  1SC8 U;  1TA6 A;  3OEE D;  5DP4 A;  2BQ7 B;  2AFQ B;  2ZPQ A;  1LVM A;  2W7S A;  2F9B H;  2KZ4 A;  1C1M A;  2BB4 A;  2J97 A;  3KQE A;  3K2U A;  3EYD A;  3ZVA A;  1C5Z B;  1HRT H;  4CH2 B;  3F9F A;  1KIG H;  1KLI H; 
#chains in the Genus database with same CATH homology
 1XHN A;  3VY5 A;  2D36 A;  3R5Y A;  2I51 A;  1TY9 A;  2ECU A;  2HQ9 A;  5JAB A;  2RDE A;  5BNC A;  3VY2 A;  2VPA A;  2FUR A;  3K87 A;  3BA3 A;  2X1J A;  3ZOE A;  5KGO A;  1USC A;  4N7R C;  1W3R A;  3PFT A;  4HMW A;  3DNH A;  4HMV A;  4XRN A;  2D38 A;  2HQ7 A;  1WGB A;  3GAS A;  5CHE C;  1NRG A;  5EJ1 A;  3R5P A;  1W3P A;  1DNL A;  3FGE A;  3SWJ A;  3TGV A;  3B5M A;  3VYA A;  1EJE A;  3EC6 A;  2HTI A;  2OL5 A;  2ECR A;  4HMS A;  2QCK A;  3HY8 A;  2FG9 A;  2PTF A;  1YOA A;  1W9A A;  3U5W A;  2X1K A;  1G78 A;  1G79 A;  3R5L A;  4FOU C;  5EIY A;  3R5R A;  2ED4 A;  2FHQ A;  5EJZ A;  1I0S A;  2E83 A;  3ZOH A;  1W3Q A;  3F7E A;  4YWN A;  3A6Q A;  1RFE A;  4P02 A;  1RZ0 A;  4HMU A;  3NFW A;  3KYF A;  4RT1 A;  3RH7 A;  3K86 A;  1G76 A;  3DSG A;  1Y30 A;  4L82 A;  3ZOC A;  4HG6 A;  4P00 A;  2D5M A;  1YLN A;  4I86 A;  2Q9K A;  2R6V A;  2QEA A;  3ZOD A;  5CHO A;  3FKH A;  4Z85 A;  4F48 B;  3CP3 A;  4XJ2 A;  3A6R A;  3IN6 A;  3E4V A;  3R5W A;  3BPK A;  3KYG A;  1WLI A;  1RZ1 A;  3AMF A;  3R5Z A;  1I0R A;  1G77 A;  3DB0 A;  3K88 A;  2AQ6 A;  2OU5 A;  3CNR A;  4HMT A;  4R82 A;  4ZKY A;  3AWH A;  2R0X A;  3DMB A;  2D37 A;  1VL7 A;  2L74 A;  4Y9I A;  4HX6 A;  1T9M A;  2IAB A;  1FLM A;  1JNW A;  2RE7 A;  5ESC A;  5KEC A;  1USF A;  2ARZ A;  1W3O A;  1WLK A;  2ASF A;  2HTD A;  1WV4 A;  4F07 A;  4XHY A;  2IG6 A;  2IML A;  2I02 A;  3ZOF A;  1XXO A;  1AXJ A;  2GJG A;  3A20 A;  4HMX A;  3CB0 A;  2NR4 A;  3H96 A;  4IRA A;  3ZOG A;  4RT0 A;  5EJL A;  3U34 A;  3BNK A;  5KED A;  2HHZ A;  4YBN A;  3U0I A;  3U35 A;  1CI0 A;  3HMZ A;  4QVB A;  2A2J A;  1YWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...