1YLNA

The crystal structure of the protein of unknown function vca0042 from vibrio cholerae o1
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
226
structure length
225
Chain Sequence
b'TVSTINSTDALAMVEHSELTLSITTPVGTKFVCRTPFIGTHTDKFLLVEMPKISADDLQYFFQEGFWMNIRAISPRGEGALIHFRSQLMHILQEPVPMAFLSIPNTMQVSQLRKEPRFELNLAGKVLFDEHRGDCELRDLSRSGCRFITPPLGKTYQVGDLVALEIFSDLRGTKTFPPLTGKICNLQRSLHHARYGLEFNEEGRNNAKNLLAQLKFNGTKLTLNA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein vca0042
publication title The crystal structure of the hypothetical protein vca0042 from Vibrio cholerae O1
rcsb
source organism Vibrio cholerae o1
molecule tags Structural genomics, unknown function
total genus 39
structure length 225
sequence length 226
ec nomenclature
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07238 PilZ PilZ domain
A PF12945 YcgR_2 Flagellar protein YcgR
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.110.10 Mainly Beta Roll Pnp Oxidase; Chain A Electron Transport, Fmn-binding Protein; Chain A 1ylnA01
2.40.10.220 Mainly Beta Beta Barrel Thrombin, subunit H predicted glycosyltransferase like domains 1ylnA02
1EJEA 3DB0A 4HMSA 4N7RC 3A20A 2Q9KA 1T9MA 1FLMA 3B5MA 3H96A 4YWNA 3NFWA 1YLNA 1RZ1A 3FGEA 2HHZA 3PFTA 3ZODA 4F07A 5EJLA 1WLKA 4RT0A 1WGBA 3IN6A 3KYGA 5ESCA 3R5LA 2IG6A 4I86A 2IABA 2RE7A 3ZOFA 4XJ2A 3U35A 3E4VA 2HQ7A 3DSGA 3ZOHA 5CHEC 3EC6A 4F48B 1Y30A 3CNRA 5KECA 1XXOA 4RT1A 3RH7A 1W3OA 3FKHA 3F7EA 1VL7A 2HTIA 1WV4A 2X1JA 3A6RA 4R82A 1YOAA 4HMXA 3TGVA 2OU5A 4XHYA 2FHQA 4HG6A 2QCKA 5EIYA 4QVBA 1I0SA 1AXJA 2FG9A 2E83A 2ECRA 1RFEA 4IRAA 1DNLA 3K88A 2L74A 2OL5A 3ZOEA 1W9AA 4P02A 1I0RA 2FURA 4HMUA 2ED4A 5JABA 3U5WA 2ARZA 2X1KA 1W3RA 3ZOCA 2HTDA 2VPAA 4XRNA 4HX6A 1XHNA 3U0IA 2I51A 3DMBA 5BNCA 2IMLA 5KGOA 2D36A 4YBNA 2RDEA 1CI0A 1WLIA 2PTFA 1NRGA 3BPKA 4FOUC 2R6VA 2ASFA 4L82A 3SWJA 2D38A 3R5YA 2AQ6A 2D37A 4Z85A 3A6QA 3VYAA 4HMVA 3AMFA 1RZ0A 5EJ1A 3R5PA 3CB0A 1G79A 5EJZA 4HMTA 2I02A 3R5ZA 2A2JA 2D5MA 2R0XA 3U34A 3BA3A 1YWUA 4HMWA 3VY5A 2GJGA 3HY8A 4P00A 3CP3A 3HMZA 4Y9IA 3R5WA 1TY9A 3VY2A 3GASA 2HQ9A 3AWHA 3R5RA 3ZOGA 2NR4A 1W3QA 3K86A 3KYFA 5CHOA 1JNWA 1USCA 1USFA 4ZKYA 1G76A 3K87A 2ECUA 5KEDA 1G78A 1G77A 2QEAA 3DNHA 1W3PA 3BNKA
chains in the Genus database with same CATH superfamily
1C5XB 3O8DA 5ESTE 1LKBA 1O33A 3M5NA 1A7SA 4YOIA 5AFYH 1V2JT 2VWOA 3P70B 1EOLA 1F92A 1T31A 4IN1A 2Q6DA 1RGQA 1V2PT 5EQRA 1CSOE 3ZODA 4F07A 1SBWA 3TU7H 1GMHG 2BDAA 1NPMA 2ZU1A 3JZ2B 2C90B 3PWBA 4AGKA 2BQ6B 5FPTA 2R0LA 1Y8TA 2UUKB 3UNSA 2SGAA 1ELVA 2HQ7A 1UVOA 2W5EA 1BBRE 4WJG2 1KTSB 2HGTH 2GKVE 1AFQB 2FPZA 3PV4A 4FUHA 4TPIZ 1GDQA 1S85A 3E91A 6ESTA 1NN6A 4MQAA 1VCQA 2CXVA 1S0RA 2Y7ZA 1LHDH 8LPRA 3CP7A 5DJ7A 3UAIC 4HI3A 4JZDH 3A7TA 2ZGHA 1E37B 5F8XA 1AMHA 1CA0C 1QZ8A 4IBLH 5L30H 2LP6A 3BIUH 1GDUA 4MG3A 3M7QA 1HAOH 1FNIA 4HMUA 1WV7H 2R0KA 2W3IA 3ZYEA 3MO9A 1GJ6A 4A6LA 1OOKB 3UREA 2AYWA 3BEUA 5B6LA 3FAOA 4IS5A 2IMLA 2PHBA 1G3BA 1E0FD 1UJ1A 1SMFE 4YOGA 3SNEA 2J98A 8GCHF 1O30A 2VH0A 3A8DA 4WH8A 5JBTA 1WAYB 2CHAB 1GBTA 1P3EA 3MU5A 2WPMS 4TSFD 1BITA 1HAXB 1W10U 3F3BA 2VIQA 4ZKSU 3RMOH 4FUFA 2BVXH 1PQ8A 1GVZA 3TIUA 2JKHA 2FMJA 1C2HA 3R0FA 1HLTH 1D3PB 1QJ1B 1J16A 1LHCH 1UK2A 2ZCLP 2VIWA 3I78A 1MBMA 2RDLA 2VIDA 3A81A 2IPQX 3E6PH 1W3PA 3KQEA 1DWDH 5DGJA 1VITG 2KCPA 2GMTB 4MPXA 4X8VH 3RXJA 2TRMA 1C4U2 2THFB 3B5MA 1CT4E 1KXAA 1FY4A 2G8TA 1OWKA 2GT7A 5EQQA 4HKHA 1TNHA 3ZYDA 2FOBA 4YT7H 1QB6A 1P9SA 2FI5E 1C5ZB 4B71A 2ZWLH 1HAYB 1SGNE 1EJMA 3BSQA 1C5UA 3DD2H 1CGIE 5C2ZA 3UOUA 4E06H 1BQYA 1DPOA 1H8ED 1GJAB 3ZVCA 1T8LA 2F9VA 3MO6A 4GHQA 1RIWC 2VIPA 4AG2A 1ZZZA 1AZ8A 2PR3A 3KQDA 2C3SA 2G5VA 3LGIA 1L1JA 3RXFA 1NU9A 1SFIA 1BTYA 2BDCA 5EXLA 4H42U 2WV9A 1NFYA 4X8UH 3SW2B 3M37A 5FBIA 1UHBA 3QTOH 2HNTE 1UVPA 2FXRA 3F0PA 1YC0A 2BOKA 2FG9A 2CF8H 1SQTA 2PKAB 1IQEA 3FN8A 1A0HB 3I29A 1ARCA 3OAAD 2NU0E 3IG6B 1UTLM 3GCNA 4NA7A 3ZVAA 2PW8H 1KTTB 2Z6BD 1FJSA 4VGCC 1VGCC 2R2WU 1ELCA 1EZUC 2C8WB 2PUXB 3U1IB 1RS0A 1LQDB 2JETC 2QY0B 4FUBA 5A2MH 1HAHH 1JBUH 1SFQB 4I8KA 1G2MA 1NRNH 2OC1A 2J97A 4NSYA 3SNBA 3U28C 4UDWH 1AO5A 1JOUB 2VWNA 4ABIA 1CVWH 4D76A 1OWHA 1O5AB 4ACAA 1JWTA 3LU9B 2UWPA 5A8ZA 3E0PB 4XBBA 2XOKD 3RXBA 1QQ4A 4F4OC 2AIPA 1Q2WA 1TONA 2OLGA 2HQ9A 3MTYA 1O3GA 1ZMLA 3KCGH 3RU4T 2QF3A 1HAIH 2Y80A 3ZZ3A 4ZROA 8ESTE 2VGCB 4YZUA 1FIWA 2WPKS 3EGKH 1Y5UT 4OS4A 4TY7A 4E7RG 1BTPA 3BTFE 3JZ1B 1EOJA 2BYAX 3F1SB 4O3UA 4A1VA 1V2WT 1P06A 1HGTH 3RXEA 1QJ7B 1DITH 2HHZA 2K4QA 2JJ1D 1BTZA 1O2HA 2XWBI 2C8ZB 4JCNA 4BTUB 1N6YA 4ISHH 6CHAC 1NY22 3IN6A 5GJ4B 1SI5H 3A80A 1CE5A 1RFNA 4NZQA 2PGQB 2A2XH 2PWXA 4OS2A 3KL6A 4R8TB 3PLBA 5EGMA 1DVAH 4I31A 4DT4A 1MU8B 2ODQA 1FAXA 3KQBA 1L0ZA 1HIAB 1GHBG 3LKWA 1T8MA 4DG4A 1UK4A 2AEIH 1WCZA 1TMBH 2PTCE 3IWMA 4INHA 3PO1C 1SGFG 4Q7XA 3SU3A 1UTNA 1P04A 2BD8A 1O3DA 1YP9A 5E2PA 1C2EA 4FUEA 1CA0B 1V6DA 3ZZ9A 4HZHA 2P3TB 1G36A 3LC5A 2KCAA 2GZ7A 1OP8A 3GCHC 2WHXA 1FUJA 1GBFA 2BXTH 3SZNA 3EA9A 5A8YA 5C1UA 2PSXA 1DWCH 5FBEA 3NUMA 1GG6C 2D2DA 2ZIQH 3UWJH 2RDEA 2FP7B 4BANB 2A5IA 2PTFA 3BPKA 1O3LA 2J4IA 1L4ZA 3LONA 4Z85A 1AI8H 1O2NA 3A6QA 1KLIH 1VCWA 4MLFB 4UFDH 1MAYA 2A31A 3RP2A 4B2CA 6GCHF 1GI3A 2VJ1A 3UNRA 5E8EH 1O3IA 3SO3A 2KFWA 4BAMB 5TCAA 3KIDU 3UPEA 1GVKB 1SGRE 1XM1A 1XVOA 3GICB 4Y8ZA 3O8CA 1O37A 2WPHS 2VVCA 3A7WA 8KME2 2ZDNA 1THPB 1BT7A 3ZZ6A 1TNGA 3AAUA 4K60A 3ATKA 2EI6A 1WTGH 3K86A 1WXRA 3SNDA 1AE5A 4CRFA 2IJOB 3RM2H 3BIVH 3TJVA 1GHYH 2WSSD 1O5EH 2HVXA 1Y12A 1QBVH 2BY6X 3T62A 8GCHG 4HMSA 2V35A 3UOPA 2A1DB 1A0JA 1MUEB 1F0SA 4X2WA 2EC9H 5CE1A 1B0EA 4OS5A 2G00A 1M9UA 2H9EH 3SV9A 2A4QA 3TITA 3HE1A 5EJLA 1HDTH 1PPCE 3VB4A 4X0WU 4X6NA 1RTFB 1EAUA 3RXAA 2IG6A 3URDA 1O3NA 3ZOFA 2I6QA 1K21H 3KN2A 3RXUA 1GBAA 3ZOHA 4M7GA 2KCYA 4D7FA 4Q7ZA 1BBRH 1O2QA 1T4VH 5E2OA 2H9HA 3S7KB 2FOGA 3TGVA 1AWHB 2BLWA 2XBWA 1ZHMA 4D9RA 1JXPA 2GDDA 4D9QA 1JIRA 1U6QA 1PFXC 1WQSA 1GHZA 1O2OA 1A5IA 2C8XB 4CH8B 1YM0A 1YBWA 1PQ5A 1GGDC 2B7DH 3DA9B 3BEFB 1Y3XA 4LZ1H 3SI3H 1BMMH 5AHGH 1HXFH 2VWLA 3MU8A 3BG4C 1ESBA 1MTWA 5FPYA 3A85A 1ZMJA 1P01A 1W8BH 4F55A 4VGCB 1AKSA 1VGCB 3RXTA 3BN9A 5L2YH 3VB7A 3L6PA 3SGAE 3B9FH 4AFZA 1P3CA 2IJD1 1BRAA 1EFRD 1W0YH 2D37A 2OUAA 1O2PA 1OS8A 3O8RA 4K69A 1H1BA 1GPZA 3SZEA 3RLYH 1SL3A 4Z6AH 1DLKB 1WUNH 2Q6GA 2ZEBA 5JB8S 2DUCA 2OBQA 2OP9A 5DPAA 3QO6A 1IHSH 2BMGB 3SNAA 1FXYA 2GV6A 5DP6A 1Z7KA 1V2QT 2P3UB 2FOFA 5E0JA 1QJ6B 5HGGA 3E16B 5C5OA 1FX0B 1BMFD 1J8AA 1W3QA 1DSTA 5CHOA 3KGPA 3ZVEA 4INLA 1RTLA 3K87A 2XNIA 5EPYA 4CRDA 3EYDA 4ZCNA 1YPHC 2J38A 1IHTH 1COWD 2QEAA 3DNHA 1ETRH 3SU5A 1C2KA 1EJEA 2ZA5A 2FODA 2WUBA 4INKA 1EAXA 3SOSA 3UTUH 1FY5A 1T8OA 1UW7A 1ZPCA 3BTQE 3RXKA 4A1XA 6CHAB 4Y71A 3EE0B 2D26C 2J98B 1J9CH 3NRLA 3PV5A 1YYY1 2JH6D 4ABJA 5AVDA 5F8TA 1SQOA 3FP7E 1O3BA 1WSSH 1EJNA 3F9HA 3OEED 1MKXH 2XRCA 1G3CA 2P59A 2ZHEH 3NCLA 2TGPZ 3NXPA 2V6NA 4ISNA 3E4VA 2QGRA 3SV6A 2GZ8A 1MKWH 1MCVA 3SV2H 2OD3B 1TPPA 1ZLRA 3L33A 3MWIU 1CO7E 1NROH 1DDJA 4RT1A 3RXVA 1X7AC 2G55A 4GPGA 1HRTH 4HGCA 3PO1B 2FZZA 1W7XH 3RU4D 4NA9H 5L2ZH 4X8TH 1O3JA 1K9OE 1LMWB 5EIYA 1QTFA 3SQEE 1GL0E 4QVBA 2GUJA 2SGDE 1AXJA 3S7HB 2E83A 2A45B 1JRSA 3GCHB 1C1UH 3DHKH 2L74A 1NRRH 3PYHA 3D49H 2J95A 1RD3B 1ETSH 1P2JA 2J34A 1TGBA 2QXHA 3EDXB 5BRRE 1F7ZA 1GG6B 1C2GA 2ZC9H 3GOVB 1TGTA 4LK4A 2WZQA 3BTTE 1ORFA 1B0FA 1K0HA 2BDBA 1IOEA 2BZAA 2GP9B 3OY5U 4SGAE 3WWFA 4AZ2B 3K6YA 1AWFH 1TGCA 1QL8A 2RA3A 1GI0A 3QUMP 2NU3E 1NC6A 4YO9A 1SHHB 4B6EA 3R5ZA 4AYVB 2R0XA 5T6GA 2PGBB 3V3MA 1NESE 3VGCC 1O31A 2VVVA 2XC0A 5T1VA 3WW7A 4TT3D 1THRH 2VU8E 2Z9GA 1O2WA 2HLCA 2J94A 3GCTF 3NK8A 1ZPBA 3P8OA 1BBRK 2A0QB 2J2UA 1ZGVA 3ESTA 3ATIA 1UHBB 3KF2A 1Z8RA 2WYJA 3SU6A 1TGSZ 1C1SA 2XWAA 2GD4B 1ZOMA 3DCLA 1AU8A 2ZCKP 3MNXA 5LPEA 5T6DA 2FESH 5DP7A 3TLOA 4CRAA 1EAWA 3ZVFA 6GCHG 3F9EA 4Y76A 3S69A 3SU2A 4KTUA 4X6MA 1SLVB 2NU2E 1WLKA 2OC8A 4GLYA 1JRTA 1QFKH 1FN8A 1P8VC 1W14U 2IABA 1GMDF 1PQAA 2OC0A 3VXFH 1VITH 3BTDE 2VIVA 5F8ZA 2Y81A 2EA3A 4ABHA 3M5OA 1QIXB 3PWCA 1UCYE 2Z9KA 1C5QA 5ESBA 1G2LA 1UTMA 3F7EA 5HKKD 1HAVA 1SPJA 3AW0A 4BOHA 5DP4A 3VB5A 3N7OA 2FWWA 3SUGA 2G4TA 2BLVA 1S81A 1GGDB 2BHGA 1O2GH 1TE0A 3UR6A 2FI3E 3QK1A 1GBJA 1E38B 3UIRA 1SGEE 1EZSC 2ANMH 3PV2A 1MTSA 5HMAA 2VWMA 1IQGA 2G4UA 4P02A 1E1RD 2FURA 1PPFE 1LPGB 1DANH 3MHWU 4RN6A 2HPQH 2O8LA 1E1QD 1MQ6A 2PLXA 1IQMA 4Q63A 2QIQA 2Y5HA 5IDKA 3TGKE 2D8WA 2EI7A 4D8NA 2ZDMA 3QDZB 2TGTA 4GCHF 1J14A 1QBOA 5GCHF 4FOUC 1D9IA 2BX3A 4L82A 3V4HA 1GHXH 1C2JA 1O5FH 2NU1E 2WPJS 2OC7A 1PPBH 5HM2A 4JYVH 2P95A 1RJXB 4U2WA 1HAGE 1LQEA 1AVWA 1ZGIA 4FVDA 1C2MA 3OX7U 1H9LB 3RXLA 1TQ7B 4ABEA 1N1LA 3QZQA 1MKXK 4HMWA 1HFDA 1HV7A 3A86A 3VY5A 1GWAA 2BQ7B 1V2TT 3RMMH 2B5TB 2Y5FA 3GDVA 4Y8YA 4RKJB 5HIZA 3BEIB 1MKWK 1UVSH 1EX3A 1NFWA 5C1XA 2NR4A 3ODDA 1TRNA 3M61U 4DVAU 5J4QA 1JNWA 1HXEH 1ESTA 2ZDAH 1SOZA 5GNDA 1S6LA 1ZTLA 1UVUH 2A4RA 5LH8A 1O3EA 4DT7B 5C3NA 5AF9H 4XBDA 1LO6A 4XFQA 2FX4A 4NWLA 5GWZA 3M5LA 4D7GA 4FUGA 3N99A 2ZQ2A 4A5TS 3ZZBA 3FGEA 2STBE 2F4LA 2AMQA 1V3XA 1IQJA 1VR1H 2BD7A 5HIYA 1V2UT 3O8BA 1GBKA 1YPLH 4NWKA 1DLEA 3PLKA 3K9XB 3RU4E 3SV8A 1MH0A 3BTWE 4FU7A 1KXCA 3LPRA 1AY6H 2F9BH 1YPEH 1SGDE 1BTHH 1ANBA 1XMNB 1P2MA 2RA0A 1KYNA 4FU8A 3PMJA 4CR5A 1G9IE 5JB9S 1VL7A 2HPPH 5F53A 3OE7D 1QR3E 3EAJA 4FUJA 1ZHRA 3M3TA 4I32A 1KLJH 1QB9A 1SG8B 1UTOA 1F5RA 2CN0H 5C0TA 1BHXB 3PROA 2HWLB 4HTCH 4UFGH 4Z0KA 5J4SA 3BTME 1O38A 2OK5A 3ZZ5A 1NRPH 1V2VT 1GHVH 4YTAA 3SUFA 3A84A 2H5DA 4B76A 2ZU3A 2JDID 4CRCA 2EQNA 1MZAA 2ZQ1A 2VPAA 4XRNA 4OS7A 4HX6A 3N7EA 1J17T 4DIIH 2QV1A 1Q31A 2ESTE 3A83A 4LOYH 2AQ6A 3F2GA 5FCRA 5PTPA 1ELDE 2XBYA 4ZKOU 1HJ8A 1FMGA 1O34A 4AX9H 4BTTB 5JBCS 4U30A 1H8HD 2TBSA 1DM4B 1EASA 3F9GA 1BIOA 4LZ4B 1G79A 1BJVA 2BDGA 3I77A 1LPZB 1ZSJA 3VGCB 3GY2A 3AAVA 1XUGA 1XUHA 1P02A 1YWUA 2EEKA 1C2DA 1FY8E 3ZVBA 3DFLA 2BVSH 3V0XA 1BB0B 1FLEE 2AMPA 1O3AA 1EB1H 3PTNA 1O3PB 3AASA 1GMCF 1ZRKA 1ZSLA 2DE9A 1MD7A 1EP6A 1O2RA 1W11U 1VKYA 3P6ZB 1O3KA 2QXGA 1MD8A 3HPTB 4GSOA 4ASUD 5LPFA 4ZKYA 3A7YA 1O0DH 2H2ZA 2VINA 1O2LA 1FONA 1ZJDA 1EAIA 3UQOA 3SJIA 5A0BA 3U1JB 1Z8GA 1DXWA 3UFAA 3MH6A 3IITA 4NIVA 4IC6A 1QRWA 2ZGCA 1AKSB 4A92A 4I33A 4BAQB 4K3JA 1O3FA 1WBGB 1CHOF 1ZR0A 5DG6A 4YWNA 1Y3UA 2C8YB 2D1JA 1O5CB 3QWCH 4Q80A 1K2I1 3Q3YA 4AB8A 1RZ1A 5DO4H 4MTBA 7LPRA 3SJOA 3KYGA 4W64A 1ZYOA 4UE7H 1GBCA 3GCTG 1C5TA 1NBMD 4ACBA 3P8FA 4Y0ZE 3U35A 4U32A 3QTVH 1TPSA 4JZIA 1OWEA 4K5ZA 4Y7AA 1HPGA 1UTQA 2R3YA 1XXOA 5E0GA 2Z9IA 3TGJE 2X1JA 3H7TA 1ABJH 1IQFA 3A8AA 4B2AA 4UFFH 4XSKU 4X2VA 1S0QA 4TV4A 1KMHB 4ZKRU 5EXMA 1Z6EA 1O2TA 7GCHF 4GVUA 5CHAC 3K2UA 1GVLA 2GCTC 1CHGA 3FZZA 3UQVA 1W0ZU 2BTCE 2O8WA 1W7GH 2R9PA 3GDSA 5F03A 1I0RA 2G51A 1P11E 3HK3B 3U5WA 2WYGA 1GMDG 1TA6A 1VJ9U 2YNBA 4IGDA 3GDUA 3TJNA 1ESAA 1SGPE 2A5KA 1T4UH 1W0JD 4YM9A 5BNCA 2BQWB 4AGJA 2BOHB 4ZH8A 1YY3A 1NRGA 2JH5D 1QRXA 4MNXA 3R5YA 2QE7D 5GPIB 3TNTA 2ZF0H 1SB1H 2ZECA 5EJ1A 1SGCA 5HM9A 1C1TA 3E3TA 2ZHFH 3P8NA 3QLPH 1HBTH 3PRDA 3DT0H 3V12A 4JYTA 2BDHA 2A32A 7ESTE 2QF4A 2XC4A 3ITIA 3T2NA 3K65B 1LVYA 3HMZA 1C1VH 1DXPA 1TY9A 4NFFA 3AWHA 1HYLA 4E7NA 1F5KU 1OPHB 1IQLA 2BVRH 2Z7FE 3A7XA 1ZTKA 3A7VA 1DWBH 1PJPA 1SQAA 4PROA 3RXOA 1RRKA 3FP8E 4GCHG 5AFZH 5GCHG 1P57B 2WPLS 1QQUA 1O3CA 1A5HA 1O2XA 3C27B 1FDPA 3OU0A 2CF9H 1PYTC 3F0OA 1C4V2 3AK5A 1CQQA 2W6JD 4MVNA 4A7IB 3W94A 1S82A 1SLUB 1OYQA 2V7QD 1DFPA 3H5CB 2XC5A 2C4FH 4WWYA 3UB0A 2BX4A 3STIA 5TCCA 4R0IA 2ZU5A 1BRBE 2B8OH 1SQRA 1FV9A 2IOTA 2TPIZ 2BD5A 1W13U 2AHME 2CV3A 2JH0D 1AFEH 1UCYH 2EY4C 1C5PA 4Y11E 1W3OA 1UTJA 1P09A 1WYKA 1YPHE 1P2IA 2QF0A 3AW1A 2LPRA 4YESB 2V0BA 2ZNKH 4NFEA 2A7CA 1BCUH 1Y3VA 1SGFA 2FHQA 3S9CA 3RM0H 3VEQB 2ANYA 1I0SA 1OSSA 1YLCA 1DY9A 1Z8IB 2BB4A 4AG1A 2Y82A 1D3TB 2B9LA 1FAKH 4I8HA 2FS8A 4E05H 4GAWA 1SHYA 1RIWB 3D23A 3RUOA 2Q1JA 1EXFA 5JABA 1O2IA 2ARZA 2BLQA 1C2IA 1TBRH 3ZZCA 1TMTH 4I8GA 2ZFPH 1HUTH 4MPVA 2BZ6H 1SSXA 1UTKA 3Q77A 1H9HE 1ZMNA 2NWNA 1DT2A 1O2YA 3BTHE 3HKJB 3T26A 4KP0A 1V2NT 3RC5A 7KMEH 1K1IA 1RZ0A 3KEEA 5DKMA 1C1MA 1NFXA 1NU7B 1O2VA 2I02A 1AQ7A 4WMDA 2A2JA 1ELTA 1S83A 2BY8X 3D65E 3QZRA 4CR9A 1P9UA 1C5NH 2P8OC 3ZZ4A 3ATWA 2DE8A 1HAVB 1WQVH 2FX6A 1TMUH 2IPHA 1V2KT 1YCPM 3UY9A 1L1NA 2NU4E 3CS0A 1MTUA 2JETB 4IW4E 4ZHLU 5I46H 3MYWA 1GBHA 1H8DH 3BV9B 2XTTB 1Q3XA 3LGTA 1DOJA 1USFA 1TRYA 4XBCA 3PTBA 4ZHAA 2GT8A 1BOQA 5A0CA 1CGJE 1S84A 3BTGE 4UD9H 1AFQC 4WVPE 1DUAA 3TGIE 3D62A 1QL9A 1BUIA 2F3CE 4RT0A 1GI2A 1K1NA 1LVBA 5HXFA 1GI6A 1GJBB 1UTPA 4I86A 1GMCG 1A5GH 2BLOA 2ILNA 2V3HH 4ABBA 2BY7X 2W3KA 3EAAA 4X8SH 1QY6A 1C5VA 3DSGA 3HK6B 1AE8H 1O36A 1T7CA 2K0QA 3EA8A 2BD2A 4X2XA 3U9AH 4AORA 4Y10E 3RH7A 1CGHA 2HTIA 3A6RA 2BM2A 2F9OA 4R82A 1YOAA 1P2OA 2ALVA 2GV7A 1PPHE 2ZFRH 4NIYA 2ZHWH 3ENSB 1F0TA 2HVYB 5CHAB 4Y79A 2FOCA 3RXSA 2GCTB 1EJAA 3MU1A 1DNLA 1HNEE 1BA8B 4CBOA 2A4GA 3LGYA 4YOJA 1Y59T 4X6OA 4TWYA 3GY5A 3Q3XA 3SUEA 2YOLA 3MNSA 1HIAA 4OGXA 3KHVA 1V2LT 1TB6H 2GCHF 1BDAA 1TAWA 2RFKC 1GJ8B 2WUCA 2STAE 3K6ZA 1GL1A 3Q00A 4AYYB 3A7ZA 1P10A 2VB0A 3B8JA 3F9FA 2H5CA 1BTXA 1CA8B 3MU0A 5C1YA 4AFQA 1GBIA 4FXGH 1XX9A 3EE7A 1NS3A 3SU1A 1KDQA 2KM0A 2BD4A 2GZ9A 2KR7A 5EW1H 4MPWA 3U34A 1HCGA 7GCHG 1O2SA 2AIQA 1OWJA 5HYOA 3LJOA 1ID5H 4BXSA 3TJOA 4DW2U 1L4DA 4KELA 1CT0E 2ZDLA 4BAHB 4RSPA 3LH3A 2QCYA 1UCYK 3ELAH 1L1GA 1S6FA 4B75A 2KCOA 2ZFTA 2O8UA 3SV7A 2WPDD 4IC5A 5DSFA 3FZDA 3MFJA 1OP0A 1E36B 3P17H 1USCA 5JPMH 5CHBA 4X1QU 4DOQA 3GY6A 4MTKA 2FIRH 2PP6A 1W12U 1NRQH 2Z3EA 1GI4A 1GDNA 1ELFA 2ZGJA 4OS6A 3PB1E 3VB6A 2FYRA 3SJ9A 1O2UA 3F68H 4YT6H 4FETA 2ZI2H 4BNRA 3LIWA 2TGAA 1T9MA 2Z9JA 4NSVA 1AVXA 1WOFA 4OM9A 3NFWA 1BRUP 1AB9C 1JMOH 2J92A 1GBMA 3PFTA 4DY7B 2VH6A 4X6PA 4WXVA 3HGPA 1SGTA 4Q4LA 1KXFA 3Q76A 4J1YA 3VG8A 3GYMA 4AC9A 2K8IA 4XJ2A 2F91A 1HAZB 3MOCA 4ISIH 2ZHDA 3A8CA 1LHFH 5FXLA 1Y3WA 5LGOA 5JYIA 1OWIA 1QNJA 3HGNA 1K1MA 1TRMA 1D6RA 2FI4E 4B2BA 2ZHQH 3FO8D 1KSNA 5K0HA 3MQKC 1KXDA 3ZV9A 1H4WA 2ZFQH 3MH5A 3ZZDA 2W7SA 4K8BA 3K88A 2VBCA 4H6SB 3ZOEA 2QAAA 4GHTA 1OHHD 2P5ZX 4Y8XA 3BTEE 2HLDD 2ZGBH 1GBLA 2X1KA 1GBDA 1K1PA 1K28D 2J5UA 1GI7B 2HTDA 3KQ5A 5JDUB 3U0IA 1XHNA 1BHXF 1SLWB 3E8LA 5DP8A 5EODA 1W2KH 2QXJA 1TGNA 2XCFA 5F6MA 2D36A 1YGCH 5LPRA 2XBXA 1UMAH 2ZKSA 1XUFA 3MNBA 1PYTD 3LGVA 1V2RT 3AVZA 2WV5A 4ZXXH 2P16A 3A87A 4X2YA 5FCKA 1CU1A 2XW9A 1Y5AT 1WTHD 2PUQH 3CB0A 3FVFB 4AB9A 1O2KA 4HMTA 2OBOA 3OSYA 1MAXA 1XKBC 4ZHMU 1HAPH 5C5NA 2UWOA 1G37A 3BG4B 2P8OB 2H6MA 3BA3A 2BY9X 4ISOA 3SU0A 1NO9H 1C5SA 2ZFFH 4JZEH 3SYJA 4NIWA 3HY8A 1TOMH 3DFJA 1AIXH 2O8MA 5GXPA 3VY2A 1PPEE 3GCOA 3RMNH 1C9PA 1OX1A 5T6FA 1A0LA 3P8GA 3MH4A 2W26A 4NG9H 3UUZA 2SNVA 3TJUA 1FZZA 1FI8A 1G78A 3HATH 2WV4A 1RXPA 2BD9A 5ETXA 3RXHA 1VZQH 4K1SA 4X1PU 2W6ID 1O2JA 2BD3A 1W3CA 2FOAA 3SBKA 3U8TH 4YXWD 1YPKH 4MNVA 1LCYA 3A20A 1XUKA 1FLMA 2EI8A 4AFSA 5EOKA 1O5BB 1EQ9A 2R2MB 1LDTT 1TNJA 5EW2H 1DE7H 1WGBA 1A3BH 2HRVA 1C2FA 1N6XA 3VPKA 2UUJB 1PQ7A 2L1TA 4CHAC 1C5WB 2PKSC 4JK6A 1IQNA 2SFAA 2ZTYA 4AFUA 5JBBS 3ATLA 1HJ9A 4K8YA 2H9TH 1MU6B 2CMYA 3EC6A 4BAOB 1LKAA 2F43B 3DUXH 1G3DA 5JBAS 1GI5A 1TPOA 1V2ST 5EU8A 1LVMA 1D3DB 1JIMA 1F5LA 1XXFA 4O97A 1XVMA 1RTKA 2ZGXH 2FTMA 4ASHA 2ECRA 3S9AA 1DICA 2PV9B 3EQ0H 3LC3A 5FX5A 1EZXC 5L6NH 3ODFA 1AGJA 1SOTA 2RCEA 2PSYA 4X1NU 1T32A 5C20A 1BTUA 5KGOA 3LT3A 4YBNA 4O3TA 2ZU2A 3PMBB 2LELA 3TPIZ 5I25A 3A88A 3M7UA 2VNTA 4TWWA 1O2ZA 3R5PA 1F0RA 3M3SA 1O3MA 1C1PA 4WXIA 4K2YA 5A0AE 9LPRA 5C17A 1C1QA 1TALA 5CMXH 1LVOA 2OCVB 2F9PA 1ZTJA 1NZQH 3CP3A 2P3FH 1OKXA 4UONA 2V3MA 3OY6U 2TIOA 2XBVA 3R5RA 2G52A 1TNIA 1ZJKA 4JZFH 3ZOGA 5DP5A 5ABWA 5GDSH 3GY7A 2AGEX 2GCHG 1A2CH 1SKYE 1W0KD 1C1NA 5FX6A 5KEDA 3UNQA 4Y6DA 2O9QA 3VFEA 4HFPB 2BXUH 3M3VA 1QL7A 1DSUA 4LXBH 4B74A 2GTBA 4IMZA 1AB9B 2SGEE 1ZRBA 5DP9A 1C1OA 1C5OH 3DSOA 2OQUA 1TX6A 1LTOA 3STJA 2GGVB 3SNCA 3R5LA 2JIZD 3RXCA 1GJ9B 2ZDVH 5C67A 1P2NA 1ANCA 4I7YH 1GJ5H 3OTPA 4ISLA 1QA7A 3QN7A 1Z1IA 1ANDA 3T28A 4KTSA 3NKKA 3CNRA 3FKHA 1GJDB 2M2AA 1N8OC 2Q6FA 4YLQH 3U69H 1WV4A 1YPGH 4O03A 4IMQA 4Y7BA 1ELEE 2ZO3H 1SLXB 1P03A 1EZQA 4A1TA 1C5MD 4XHYA 2FS9A 5FL7D 1O35A 5EPNA 1HB0B 2P93A 1BMLA 2FTLE 2KAIA 4CH2B 1DS2E 1ZSKA 1UO6A 2LNCA 3TH4H 3FOAA 1TX8A 4XDEA 1DY8A 3E90B 2QC2A 3LDXH 1XUIA 1EPTA 4I8JA 1DX5M 1QB1A 4DCDA 3C1KA 1H8IH 2I51A 1MTVA 2XNDD 1B5GH 3ZZ7A 3LH1A 4WMEA 2Z94A 2K1QA 3E1XB 1GI9B 3RMLH 2ZTXA 4BXWA 2AMDA 3LGUA 1BMAA 3H7OA 4WY3A 4FUDA 2BDIA 3G01A 1AUJA 3BTKE 3OYPA 4QT8C 1TQ0B 1C5RA 3MMGA 2YNAA 1FY3A 1ELAA 2VIOA 3UR9A 3A89A 4DJZB 2UUFB 2GJGA 4OS1A 5IYTA 1KXBA 4DIHH 2A5AA 1C2LA 3MU4A 3GASA 1VJAU 1TNLA 1ZHPA 4TYDA 3KYFA 2CK3D 2Y7XA 1MTNC 5TJXA 4MDSA 2QXIA 2OTVA 4JK5A 2O8TA 3SN8A 5IK2D 1XKAC 1CBWC 1PPZA 3VXEH 3NZIA 2PTNA 1SR5C 1E35B 3CS7A 3P92A 3NWUA 3RXQA 1P2QA 2HNTC 1HJAC 1SGYE 3QGJA 1AN1E 3BF6H 4DURA 3W1EA 1ELBA 3H96A 1AHTH 2A4OA 1K1JA 2SGPE 1YLNA 2ODPA 4JMYA 1FIZA 1C1WH 2F9NA 1FN6A 1QRZA 1C5YB 2AGGX 3GY4A 3TK9A 4CHAB 3ZVDA 5C0UA 2PKSB 4FUIA 1GHAF 4NIXA 3MNCA 1GHWH 1KDQB 3PMAB 2R3UA 4CREA 2Z3DA 4UHVA 3CENA 1S6HA 5CHEC 1TFXA 1TYNA 2ZP0H 1A4WH 4ESTE 3SHAH 5SGAE 3F6UH 2ALPA 1QA0A 2YMSC 4RKOB 5A09A 1ARBA 3GS9A 2FEQH 2QCKA 4HG6A 3SJ8A 3TK6A 2QYIA 4BTIB 3W95A 3RXGA 3SI4H 4IRAA 4XD7D 1G32B 3VB3A 2FLBH 1D4PB 3GYLB 4H4FA 2AGIX 4ABFA 2ANKH 1O5DH 3MH7A 3ZIAD 1T8NA 1O2MA 4NA8A 1QHRB 1LHGH 4ZUHA 1EB2A 3FFGA 2ODYB 3TH2H 1H9IE 5GIBA 3RXRA 1C5LH 5FHTA 2FM2A 1INCA 2SNWA 1WLIA 1E34B 2UUYA 1YCPH 2ULLA 2R6VA 3L3TA 2ASFA 1KLTA 1IQIA 3VYAA 4HMVA 1LHEH 2FDAA 2WINI 1BZXE 3T25A 1TA2A 1OYTH 3URCA 1AUTC 1IQHA 3TNSA 5EJZA 1Z8JB 2AERH 1TBZH 1EATA 1P0SH 2QN5T 1TIOA 1YKTA 3GISB 1C4Y2 2FOEA 1F0UA 1GMHF 1ELGA 4NZLA 2F83A 4CRGA 4CBNA 4P00A 3RDZA 1GJ7B 2ZTZA 4WF8A 3R5WA 1B7XB 2WPIS 3M7TA 2G5NA 4FU9A 3HKIB 2J9NA 1XUJA 1VCPA 1AZZA 1O32A 3PLPA 2HNTF 1ACBE 1GCTC 4FVBA 4Y0YE 3A82A 2BY5X 2ZPQA 4WH6A 1A1RA 3RLWH 2PKAA 4CRBA 2ZDKA 2ZCHP 1IQKA 1EPTC 2OINA 3RC4A 3DB0A 2TGDA 4THNH 2H1UA 1DWEH 2Q9KA 1TOCB 3NPSA 1BJUA 1GBEA 1K22H 3T27A 1V2MT 3Q3KA 1NM6A 1BRCE 1CT2E 3H09A 2GVFA 4O9VA 4I8LA 3U8RH 4Q7YA 2FOMB 3UWIA 4FUCA 4DGJA 2B0FA 2HOBA 3PM3A 2RE7A 2AH4X 1GBBA 1Z6JH 3A8BA 4B6FA 3WWBA 2CGAA 2ASUB 1MMJN 4F48B 1N8OB 1NBME 1Y30A 4NGAH 5KECA 1QBNA 2C93B 1MCTA 1OWDA 1P2KA 1PPGE 3QGNB 5A8XA 1K1LA 2GX4A 4HMXA 3FP6E 3LJJA 4NCYA 1AD8H 4ABDA 2XYAA 3N7DA 1EUFA 4MPUA 1UVTH 1SGIB 5G4BA 3T29A 1FQ3A 1RFEA 4MNYA 2ANWA 1GCDA 1A46H 1SGQE 1NTPA 2HALA 4UFEH 4ZXYH 3V7TA 1W9AA 4ZMAH 1KY9A 1THSH 3LOXA 1DUEA 2ED4A 2Y5GA 3R3GB 4TY6A 4Z1MD 1SVPA 1W3RA 2RG3A 1D3QB 4UEHH 3S9BA 3OEHD 2OQ5A 3DMBA 1YF4A 1MBQA 3SGQE 1EKBB 4AN7A 2P94A 1TLDA 4AOQA 1CI0A 4GUXA 3GY8A 1J15A 2D38A 3EA7A 3SUDA 1D6WA 1VITF 1CHOG 4B73A 2XCNA 5K7RA 1G30B 1QGFA 2CHAC 3SU4A 2D5MA 1NRSH 2PFEA 4KGAA 2QF5A 4TPYA 3V13A 2AFQB 1KXEA 5T3HA 3PMHB 1KIGH 3FKSD 3T5FH 2ZPSA 3ZVGA 3F2FA 1F2SE 1WU1A 4MNWA 1XXDA 1Z1JA 4B1TA 3ZZAA 1A61H 5EXNA 1MTNB 1FY1A 3KNXA 5EQSA 6LPRA 1Y5BT 4X1SU 1GI8B 1IAUA 4KKDA 1GI1A 2ECUA 1ANEA 1CBWB 3SGBE 1QCPA 2G81E 1MQ5A 1G77A 2GDEH 5EG4A 9ESTA 1O39A 1TABE 1QURH 2SGQE 1HJAB 1TX7A 2FLRH 2ZFSA 4N7RC 5B6OA 3E0NB 1Z71A 1V2OT 2GMTC 2UWLA 2M5TA 2A7HA 1O3HA 2KZ4A 3WY8A 3SORA 3M36A 2BDYA 4J2YB 3RXMA 5ESCA 2CJIA 1O5GH 2I6SA 3GY3A 1AVGH 3ZV8A 3U8OH 1P12E 1YCPK 4XE4A 3ZZ8A 4IN2A 1MABB 3FANA 1O3OA 5C94A 1ZPZA 3DSPA 2IN2A 1UK3A 2AS9A 2QA9E 2Z9LA 1P05A 1NT1A 1OXGA 5BPEA 1TBQH 4ZAEA 3RC6A 4JYUH 2YMSB 2ZG0H 1BMNH 2Z3CA 4X1RU 4ABGA 2FOHA 2F9UA 1L2EA 2KX4A 2OU5A 3M5MA 2VVUA 1Y3YA 2ZZUH 1GJCB 4F49A 1LPKB 3PRBA 2JJ2D 4XOJA 4K1EA 4SGBE 5E0HA 4ABAA 1MZDA 2Y6TA 3P95A 3TK5A 1YPMH 1SC8U 3TH3H 3RXPA 2OL5A 3RXDA 1EP5A 1GJ4H 5DN6D 3MO3A 2SGFE 5DP3A 1GHAG 3F2HA 5DK1A 5H4IB 3ZOCA 3SQHE 3LGWA 4U01A 1FPHH 1WDIA 1ETTH 1G3EA 3M35A 4RI0A 4BAKB 1NFUA 4K1TA 2A7JA 3SWJA 3OTJE 4ZKNU 3B23B 2ZU4A 3AMFA 3QX5H 3RXIA 1K1OA 5CDFE 4Q2KA 2FYQA 2L6OA 3KQCA 4WMFA 1TNKA 4JZ1A 2A2QH 2FO9A 1ABIH 3ATMA 1TPAE 3SHCH 4KTCA 1A3EH 2OXSA 1YPJH 2ZPRA 3TVJB 1S5SA 2W7UA 4Y9IA 4YLUA 3MI4A 3BG8A 1FPCH 3SJKA 4H6TA 1BTWA 1GCTB 1OP2A 2KAIB 2YMSD 4M9FA 1YLDA 3OFND 1G76A 3U98H 1GHBF 1C1RA 1E79D 2XXLA 3S0NA 5FPSA 1TWXB 4OGYA 2V3OH 2VGCC 1EPTB 5FAHA 3BNKA 1C9TA
chains in the Genus database with same CATH topology
1EJEA 3DB0A 4HMSA 4N7RC 3A20A 2Q9KA 1T9MA 1FLMA 3B5MA 3H96A 4YWNA 3NFWA 1YLNA 1RZ1A 3FGEA 2HHZA 3PFTA 3ZODA 4F07A 5EJLA 1WLKA 4RT0A 1WGBA 3IN6A 3KYGA 5ESCA 3R5LA 2IG6A 4I86A 2IABA 2RE7A 3ZOFA 4XJ2A 3U35A 3E4VA 2HQ7A 3DSGA 3ZOHA 5CHEC 3EC6A 4F48B 1Y30A 3CNRA 5KECA 1XXOA 4RT1A 3RH7A 1W3OA 3FKHA 3F7EA 1VL7A 2HTIA 1WV4A 2X1JA 3A6RA 4R82A 1YOAA 4HMXA 3TGVA 2OU5A 4XHYA 2FHQA 4HG6A 2QCKA 5EIYA 4QVBA 1I0SA 1AXJA 2FG9A 2E83A 2ECRA 1RFEA 4IRAA 1DNLA 3K88A 2L74A 2OL5A 3ZOEA 1W9AA 4P02A 1I0RA 2FURA 4HMUA 2ED4A 5JABA 3U5WA 2ARZA 2X1KA 1W3RA 3ZOCA 2HTDA 2VPAA 4XRNA 4HX6A 1XHNA 3U0IA 2I51A 3DMBA 5BNCA 2IMLA 5KGOA 2D36A 4YBNA 2RDEA 1CI0A 1WLIA 2PTFA 1NRGA 3BPKA 4FOUC 2R6VA 2ASFA 4L82A 3SWJA 2D38A 3R5YA 2AQ6A 2D37A 4Z85A 3A6QA 3VYAA 4HMVA 3AMFA 1RZ0A 5EJ1A 3R5PA 3CB0A 1G79A 5EJZA 4HMTA 2I02A 3R5ZA 2A2JA 2D5MA 2R0XA 3U34A 3BA3A 1YWUA 4HMWA 3VY5A 2GJGA 3HY8A 4P00A 3CP3A 3HMZA 4Y9IA 3R5WA 1TY9A 3VY2A 3GASA 2HQ9A 3AWHA 3R5RA 3ZOGA 2NR4A 1W3QA 3K86A 3KYFA 5CHOA 1JNWA 1USCA 1USFA 4ZKYA 1G76A 3K87A 2ECUA 5KEDA 1G78A 1G77A 2QEAA 3DNHA 1W3PA 3BNKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EJE A;  3DB0 A;  4HMS A;  4N7R C;  3A20 A;  2Q9K A;  1T9M A;  1FLM A;  3B5M A;  3H96 A;  4YWN A;  3NFW A;  1YLN A;  1RZ1 A;  3FGE A;  2HHZ A;  3PFT A;  3ZOD A;  4F07 A;  5EJL A;  1WLK A;  4RT0 A;  1WGB A;  3IN6 A;  3KYG A;  5ESC A;  3R5L A;  2IG6 A;  4I86 A;  2IAB A;  2RE7 A;  3ZOF A;  4XJ2 A;  3U35 A;  3E4V A;  2HQ7 A;  3DSG A;  3ZOH A;  5CHE C;  3EC6 A;  4F48 B;  1Y30 A;  3CNR A;  5KEC A;  1XXO A;  4RT1 A;  3RH7 A;  1W3O A;  3FKH A;  3F7E A;  1VL7 A;  2HTI A;  1WV4 A;  2X1J A;  3A6R A;  4R82 A;  1YOA A;  4HMX A;  3TGV A;  2OU5 A;  4XHY A;  2FHQ A;  4HG6 A;  2QCK A;  5EIY A;  4QVB A;  1I0S A;  1AXJ A;  2FG9 A;  2E83 A;  2ECR A;  1RFE A;  4IRA A;  1DNL A;  3K88 A;  2L74 A;  2OL5 A;  3ZOE A;  1W9A A;  4P02 A;  1I0R A;  2FUR A;  4HMU A;  2ED4 A;  5JAB A;  3U5W A;  2ARZ A;  2X1K A;  1W3R A;  3ZOC A;  2HTD A;  2VPA A;  4XRN A;  4HX6 A;  1XHN A;  3U0I A;  2I51 A;  3DMB A;  5BNC A;  2IML A;  5KGO A;  2D36 A;  4YBN A;  2RDE A;  1CI0 A;  1WLI A;  2PTF A;  1NRG A;  3BPK A;  4FOU C;  2R6V A;  2ASF A;  4L82 A;  3SWJ A;  2D38 A;  3R5Y A;  2AQ6 A;  2D37 A;  4Z85 A;  3A6Q A;  3VYA A;  4HMV A;  3AMF A;  1RZ0 A;  5EJ1 A;  3R5P A;  3CB0 A;  1G79 A;  5EJZ A;  4HMT A;  2I02 A;  3R5Z A;  2A2J A;  2D5M A;  2R0X A;  3U34 A;  3BA3 A;  1YWU A;  4HMW A;  3VY5 A;  2GJG A;  3HY8 A;  4P00 A;  3CP3 A;  3HMZ A;  4Y9I A;  3R5W A;  1TY9 A;  3VY2 A;  3GAS A;  2HQ9 A;  3AWH A;  3R5R A;  3ZOG A;  2NR4 A;  1W3Q A;  3K86 A;  3KYF A;  5CHO A;  1JNW A;  1USC A;  1USF A;  4ZKY A;  1G76 A;  3K87 A;  2ECU A;  5KED A;  1G78 A;  1G77 A;  2QEA A;  3DNH A;  1W3P A;  3BNK A; 
#chains in the Genus database with same CATH topology
 1C5X B;  3O8D A;  5EST E;  1LKB A;  1O33 A;  3M5N A;  1A7S A;  4YOI A;  5AFY H;  1V2J T;  2VWO A;  3P70 B;  1EOL A;  1F92 A;  1T31 A;  4IN1 A;  2Q6D A;  1RGQ A;  1V2P T;  5EQR A;  1CSO E;  3ZOD A;  4F07 A;  1SBW A;  3TU7 H;  1GMH G;  2BDA A;  1NPM A;  2ZU1 A;  3JZ2 B;  2C90 B;  3PWB A;  4AGK A;  2BQ6 B;  5FPT A;  2R0L A;  1Y8T A;  2UUK B;  3UNS A;  2SGA A;  1ELV A;  2HQ7 A;  1UVO A;  2W5E A;  1BBR E;  4WJG 2;  1KTS B;  2HGT H;  2GKV E;  1AFQ B;  2FPZ A;  3PV4 A;  4FUH A;  4TPI Z;  1GDQ A;  1S85 A;  3E91 A;  6EST A;  1NN6 A;  4MQA A;  1VCQ A;  2CXV A;  1S0R A;  2Y7Z A;  1LHD H;  8LPR A;  3CP7 A;  5DJ7 A;  3UAI C;  4HI3 A;  4JZD H;  3A7T A;  2ZGH A;  1E37 B;  5F8X A;  1AMH A;  1CA0 C;  1QZ8 A;  4IBL H;  5L30 H;  2LP6 A;  3BIU H;  1GDU A;  4MG3 A;  3M7Q A;  1HAO H;  1FNI A;  4HMU A;  1WV7 H;  2R0K A;  2W3I A;  3ZYE A;  3MO9 A;  1GJ6 A;  4A6L A;  1OOK B;  3URE A;  2AYW A;  3BEU A;  5B6L A;  3FAO A;  4IS5 A;  2IML A;  2PHB A;  1G3B A;  1E0F D;  1UJ1 A;  1SMF E;  4YOG A;  3SNE A;  2J98 A;  8GCH F;  1O30 A;  2VH0 A;  3A8D A;  4WH8 A;  5JBT A;  1WAY B;  2CHA B;  1GBT A;  1P3E A;  3MU5 A;  2WPM S;  4TSF D;  1BIT A;  1HAX B;  1W10 U;  3F3B A;  2VIQ A;  4ZKS U;  3RMO H;  4FUF A;  2BVX H;  1PQ8 A;  1GVZ A;  3TIU A;  2JKH A;  2FMJ A;  1C2H A;  3R0F A;  1HLT H;  1D3P B;  1QJ1 B;  1J16 A;  1LHC H;  1UK2 A;  2ZCL P;  2VIW A;  3I78 A;  1MBM A;  2RDL A;  2VID A;  3A81 A;  2IPQ X;  3E6P H;  1W3P A;  3KQE A;  1DWD H;  5DGJ A;  1VIT G;  2KCP A;  2GMT B;  4MPX A;  4X8V H;  3RXJ A;  2TRM A;  1C4U 2;  2THF B;  3B5M A;  1CT4 E;  1KXA A;  1FY4 A;  2G8T A;  1OWK A;  2GT7 A;  5EQQ A;  4HKH A;  1TNH A;  3ZYD A;  2FOB A;  4YT7 H;  1QB6 A;  1P9S A;  2FI5 E;  1C5Z B;  4B71 A;  2ZWL H;  1HAY B;  1SGN E;  1EJM A;  3BSQ A;  1C5U A;  3DD2 H;  1CGI E;  5C2Z A;  3UOU A;  4E06 H;  1BQY A;  1DPO A;  1H8E D;  1GJA B;  3ZVC A;  1T8L A;  2F9V A;  3MO6 A;  4GHQ A;  1RIW C;  2VIP A;  4AG2 A;  1ZZZ A;  1AZ8 A;  2PR3 A;  3KQD A;  2C3S A;  2G5V A;  3LGI A;  1L1J A;  3RXF A;  1NU9 A;  1SFI A;  1BTY A;  2BDC A;  5EXL A;  4H42 U;  2WV9 A;  1NFY A;  4X8U H;  3SW2 B;  3M37 A;  5FBI A;  1UHB A;  3QTO H;  2HNT E;  1UVP A;  2FXR A;  3F0P A;  1YC0 A;  2BOK A;  2FG9 A;  2CF8 H;  1SQT A;  2PKA B;  1IQE A;  3FN8 A;  1A0H B;  3I29 A;  1ARC A;  3OAA D;  2NU0 E;  3IG6 B;  1UTL M;  3GCN A;  4NA7 A;  3ZVA A;  2PW8 H;  1KTT B;  2Z6B D;  1FJS A;  4VGC C;  1VGC C;  2R2W U;  1ELC A;  1EZU C;  2C8W B;  2PUX B;  3U1I B;  1RS0 A;  1LQD B;  2JET C;  2QY0 B;  4FUB A;  5A2M H;  1HAH H;  1JBU H;  1SFQ B;  4I8K A;  1G2M A;  1NRN H;  2OC1 A;  2J97 A;  4NSY A;  3SNB A;  3U28 C;  4UDW H;  1AO5 A;  1JOU B;  2VWN A;  4ABI A;  1CVW H;  4D76 A;  1OWH A;  1O5A B;  4ACA A;  1JWT A;  3LU9 B;  2UWP A;  5A8Z A;  3E0P B;  4XBB A;  2XOK D;  3RXB A;  1QQ4 A;  4F4O C;  2AIP A;  1Q2W A;  1TON A;  2OLG A;  2HQ9 A;  3MTY A;  1O3G A;  1ZML A;  3KCG H;  3RU4 T;  2QF3 A;  1HAI H;  2Y80 A;  3ZZ3 A;  4ZRO A;  8EST E;  2VGC B;  4YZU A;  1FIW A;  2WPK S;  3EGK H;  1Y5U T;  4OS4 A;  4TY7 A;  4E7R G;  1BTP A;  3BTF E;  3JZ1 B;  1EOJ A;  2BYA X;  3F1S B;  4O3U A;  4A1V A;  1V2W T;  1P06 A;  1HGT H;  3RXE A;  1QJ7 B;  1DIT H;  2HHZ A;  2K4Q A;  2JJ1 D;  1BTZ A;  1O2H A;  2XWB I;  2C8Z B;  4JCN A;  4BTU B;  1N6Y A;  4ISH H;  6CHA C;  1NY2 2;  3IN6 A;  5GJ4 B;  1SI5 H;  3A80 A;  1CE5 A;  1RFN A;  4NZQ A;  2PGQ B;  2A2X H;  2PWX A;  4OS2 A;  3KL6 A;  4R8T B;  3PLB A;  5EGM A;  1DVA H;  4I31 A;  4DT4 A;  1MU8 B;  2ODQ A;  1FAX A;  3KQB A;  1L0Z A;  1HIA B;  1GHB G;  3LKW A;  1T8M A;  4DG4 A;  1UK4 A;  2AEI H;  1WCZ A;  1TMB H;  2PTC E;  3IWM A;  4INH A;  3PO1 C;  1SGF G;  4Q7X A;  3SU3 A;  1UTN A;  1P04 A;  2BD8 A;  1O3D A;  1YP9 A;  5E2P A;  1C2E A;  4FUE A;  1CA0 B;  1V6D A;  3ZZ9 A;  4HZH A;  2P3T B;  1G36 A;  3LC5 A;  2KCA A;  2GZ7 A;  1OP8 A;  3GCH C;  2WHX A;  1FUJ A;  1GBF A;  2BXT H;  3SZN A;  3EA9 A;  5A8Y A;  5C1U A;  2PSX A;  1DWC H;  5FBE A;  3NUM A;  1GG6 C;  2D2D A;  2ZIQ H;  3UWJ H;  2RDE A;  2FP7 B;  4BAN B;  2A5I A;  2PTF A;  3BPK A;  1O3L A;  2J4I A;  1L4Z A;  3LON A;  4Z85 A;  1AI8 H;  1O2N A;  3A6Q A;  1KLI H;  1VCW A;  4MLF B;  4UFD H;  1MAY A;  2A31 A;  3RP2 A;  4B2C A;  6GCH F;  1GI3 A;  2VJ1 A;  3UNR A;  5E8E H;  1O3I A;  3SO3 A;  2KFW A;  4BAM B;  5TCA A;  3KID U;  3UPE A;  1GVK B;  1SGR E;  1XM1 A;  1XVO A;  3GIC B;  4Y8Z A;  3O8C A;  1O37 A;  2WPH S;  2VVC A;  3A7W A;  8KME 2;  2ZDN A;  1THP B;  1BT7 A;  3ZZ6 A;  1TNG A;  3AAU A;  4K60 A;  3ATK A;  2EI6 A;  1WTG H;  3K86 A;  1WXR A;  3SND A;  1AE5 A;  4CRF A;  2IJO B;  3RM2 H;  3BIV H;  3TJV A;  1GHY H;  2WSS D;  1O5E H;  2HVX A;  1Y12 A;  1QBV H;  2BY6 X;  3T62 A;  8GCH G;  4HMS A;  2V35 A;  3UOP A;  2A1D B;  1A0J A;  1MUE B;  1F0S A;  4X2W A;  2EC9 H;  5CE1 A;  1B0E A;  4OS5 A;  2G00 A;  1M9U A;  2H9E H;  3SV9 A;  2A4Q A;  3TIT A;  3HE1 A;  5EJL A;  1HDT H;  1PPC E;  3VB4 A;  4X0W U;  4X6N A;  1RTF B;  1EAU A;  3RXA A;  2IG6 A;  3URD A;  1O3N A;  3ZOF A;  2I6Q A;  1K21 H;  3KN2 A;  3RXU A;  1GBA A;  3ZOH A;  4M7G A;  2KCY A;  4D7F A;  4Q7Z A;  1BBR H;  1O2Q A;  1T4V H;  5E2O A;  2H9H A;  3S7K B;  2FOG A;  3TGV A;  1AWH B;  2BLW A;  2XBW A;  1ZHM A;  4D9R A;  1JXP A;  2GDD A;  4D9Q A;  1JIR A;  1U6Q A;  1PFX C;  1WQS A;  1GHZ A;  1O2O A;  1A5I A;  2C8X B;  4CH8 B;  1YM0 A;  1YBW A;  1PQ5 A;  1GGD C;  2B7D H;  3DA9 B;  3BEF B;  1Y3X A;  4LZ1 H;  3SI3 H;  1BMM H;  5AHG H;  1HXF H;  2VWL A;  3MU8 A;  3BG4 C;  1ESB A;  1MTW A;  5FPY A;  3A85 A;  1ZMJ A;  1P01 A;  1W8B H;  4F55 A;  4VGC B;  1AKS A;  1VGC B;  3RXT A;  3BN9 A;  5L2Y H;  3VB7 A;  3L6P A;  3SGA E;  3B9F H;  4AFZ A;  1P3C A;  2IJD 1;  1BRA A;  1EFR D;  1W0Y H;  2D37 A;  2OUA A;  1O2P A;  1OS8 A;  3O8R A;  4K69 A;  1H1B A;  1GPZ A;  3SZE A;  3RLY H;  1SL3 A;  4Z6A H;  1DLK B;  1WUN H;  2Q6G A;  2ZEB A;  5JB8 S;  2DUC A;  2OBQ A;  2OP9 A;  5DPA A;  3QO6 A;  1IHS H;  2BMG B;  3SNA A;  1FXY A;  2GV6 A;  5DP6 A;  1Z7K A;  1V2Q T;  2P3U B;  2FOF A;  5E0J A;  1QJ6 B;  5HGG A;  3E16 B;  5C5O A;  1FX0 B;  1BMF D;  1J8A A;  1W3Q A;  1DST A;  5CHO A;  3KGP A;  3ZVE A;  4INL A;  1RTL A;  3K87 A;  2XNI A;  5EPY A;  4CRD A;  3EYD A;  4ZCN A;  1YPH C;  2J38 A;  1IHT H;  1COW D;  2QEA A;  3DNH A;  1ETR H;  3SU5 A;  1C2K A;  1EJE A;  2ZA5 A;  2FOD A;  2WUB A;  4INK A;  1EAX A;  3SOS A;  3UTU H;  1FY5 A;  1T8O A;  1UW7 A;  1ZPC A;  3BTQ E;  3RXK A;  4A1X A;  6CHA B;  4Y71 A;  3EE0 B;  2D26 C;  2J98 B;  1J9C H;  3NRL A;  3PV5 A;  1YYY 1;  2JH6 D;  4ABJ A;  5AVD A;  5F8T A;  1SQO A;  3FP7 E;  1O3B A;  1WSS H;  1EJN A;  3F9H A;  3OEE D;  1MKX H;  2XRC A;  1G3C A;  2P59 A;  2ZHE H;  3NCL A;  2TGP Z;  3NXP A;  2V6N A;  4ISN A;  3E4V A;  2QGR A;  3SV6 A;  2GZ8 A;  1MKW H;  1MCV A;  3SV2 H;  2OD3 B;  1TPP A;  1ZLR A;  3L33 A;  3MWI U;  1CO7 E;  1NRO H;  1DDJ A;  4RT1 A;  3RXV A;  1X7A C;  2G55 A;  4GPG A;  1HRT H;  4HGC A;  3PO1 B;  2FZZ A;  1W7X H;  3RU4 D;  4NA9 H;  5L2Z H;  4X8T H;  1O3J A;  1K9O E;  1LMW B;  5EIY A;  1QTF A;  3SQE E;  1GL0 E;  4QVB A;  2GUJ A;  2SGD E;  1AXJ A;  3S7H B;  2E83 A;  2A45 B;  1JRS A;  3GCH B;  1C1U H;  3DHK H;  2L74 A;  1NRR H;  3PYH A;  3D49 H;  2J95 A;  1RD3 B;  1ETS H;  1P2J A;  2J34 A;  1TGB A;  2QXH A;  3EDX B;  5BRR E;  1F7Z A;  1GG6 B;  1C2G A;  2ZC9 H;  3GOV B;  1TGT A;  4LK4 A;  2WZQ A;  3BTT E;  1ORF A;  1B0F A;  1K0H A;  2BDB A;  1IOE A;  2BZA A;  2GP9 B;  3OY5 U;  4SGA E;  3WWF A;  4AZ2 B;  3K6Y A;  1AWF H;  1TGC A;  1QL8 A;  2RA3 A;  1GI0 A;  3QUM P;  2NU3 E;  1NC6 A;  4YO9 A;  1SHH B;  4B6E A;  3R5Z A;  4AYV B;  2R0X A;  5T6G A;  2PGB B;  3V3M A;  1NES E;  3VGC C;  1O31 A;  2VVV A;  2XC0 A;  5T1V A;  3WW7 A;  4TT3 D;  1THR H;  2VU8 E;  2Z9G A;  1O2W A;  2HLC A;  2J94 A;  3GCT F;  3NK8 A;  1ZPB A;  3P8O A;  1BBR K;  2A0Q B;  2J2U A;  1ZGV A;  3EST A;  3ATI A;  1UHB B;  3KF2 A;  1Z8R A;  2WYJ A;  3SU6 A;  1TGS Z;  1C1S A;  2XWA A;  2GD4 B;  1ZOM A;  3DCL A;  1AU8 A;  2ZCK P;  3MNX A;  5LPE A;  5T6D A;  2FES H;  5DP7 A;  3TLO A;  4CRA A;  1EAW A;  3ZVF A;  6GCH G;  3F9E A;  4Y76 A;  3S69 A;  3SU2 A;  4KTU A;  4X6M A;  1SLV B;  2NU2 E;  1WLK A;  2OC8 A;  4GLY A;  1JRT A;  1QFK H;  1FN8 A;  1P8V C;  1W14 U;  2IAB A;  1GMD F;  1PQA A;  2OC0 A;  3VXF H;  1VIT H;  3BTD E;  2VIV A;  5F8Z A;  2Y81 A;  2EA3 A;  4ABH A;  3M5O A;  1QIX B;  3PWC A;  1UCY E;  2Z9K A;  1C5Q A;  5ESB A;  1G2L A;  1UTM A;  3F7E A;  5HKK D;  1HAV A;  1SPJ A;  3AW0 A;  4BOH A;  5DP4 A;  3VB5 A;  3N7O A;  2FWW A;  3SUG A;  2G4T A;  2BLV A;  1S81 A;  1GGD B;  2BHG A;  1O2G H;  1TE0 A;  3UR6 A;  2FI3 E;  3QK1 A;  1GBJ A;  1E38 B;  3UIR A;  1SGE E;  1EZS C;  2ANM H;  3PV2 A;  1MTS A;  5HMA A;  2VWM A;  1IQG A;  2G4U A;  4P02 A;  1E1R D;  2FUR A;  1PPF E;  1LPG B;  1DAN H;  3MHW U;  4RN6 A;  2HPQ H;  2O8L A;  1E1Q D;  1MQ6 A;  2PLX A;  1IQM A;  4Q63 A;  2QIQ A;  2Y5H A;  5IDK A;  3TGK E;  2D8W A;  2EI7 A;  4D8N A;  2ZDM A;  3QDZ B;  2TGT A;  4GCH F;  1J14 A;  1QBO A;  5GCH F;  4FOU C;  1D9I A;  2BX3 A;  4L82 A;  3V4H A;  1GHX H;  1C2J A;  1O5F H;  2NU1 E;  2WPJ S;  2OC7 A;  1PPB H;  5HM2 A;  4JYV H;  2P95 A;  1RJX B;  4U2W A;  1HAG E;  1LQE A;  1AVW A;  1ZGI A;  4FVD A;  1C2M A;  3OX7 U;  1H9L B;  3RXL A;  1TQ7 B;  4ABE A;  1N1L A;  3QZQ A;  1MKX K;  4HMW A;  1HFD A;  1HV7 A;  3A86 A;  3VY5 A;  1GWA A;  2BQ7 B;  1V2T T;  3RMM H;  2B5T B;  2Y5F A;  3GDV A;  4Y8Y A;  4RKJ B;  5HIZ A;  3BEI B;  1MKW K;  1UVS H;  1EX3 A;  1NFW A;  5C1X A;  2NR4 A;  3ODD A;  1TRN A;  3M61 U;  4DVA U;  5J4Q A;  1JNW A;  1HXE H;  1EST A;  2ZDA H;  1SOZ A;  5GND A;  1S6L A;  1ZTL A;  1UVU H;  2A4R A;  5LH8 A;  1O3E A;  4DT7 B;  5C3N A;  5AF9 H;  4XBD A;  1LO6 A;  4XFQ A;  2FX4 A;  4NWL A;  5GWZ A;  3M5L A;  4D7G A;  4FUG A;  3N99 A;  2ZQ2 A;  4A5T S;  3ZZB A;  3FGE A;  2STB E;  2F4L A;  2AMQ A;  1V3X A;  1IQJ A;  1VR1 H;  2BD7 A;  5HIY A;  1V2U T;  3O8B A;  1GBK A;  1YPL H;  4NWK A;  1DLE A;  3PLK A;  3K9X B;  3RU4 E;  3SV8 A;  1MH0 A;  3BTW E;  4FU7 A;  1KXC A;  3LPR A;  1AY6 H;  2F9B H;  1YPE H;  1SGD E;  1BTH H;  1ANB A;  1XMN B;  1P2M A;  2RA0 A;  1KYN A;  4FU8 A;  3PMJ A;  4CR5 A;  1G9I E;  5JB9 S;  1VL7 A;  2HPP H;  5F53 A;  3OE7 D;  1QR3 E;  3EAJ A;  4FUJ A;  1ZHR A;  3M3T A;  4I32 A;  1KLJ H;  1QB9 A;  1SG8 B;  1UTO A;  1F5R A;  2CN0 H;  5C0T A;  1BHX B;  3PRO A;  2HWL B;  4HTC H;  4UFG H;  4Z0K A;  5J4S A;  3BTM E;  1O38 A;  2OK5 A;  3ZZ5 A;  1NRP H;  1V2V T;  1GHV H;  4YTA A;  3SUF A;  3A84 A;  2H5D A;  4B76 A;  2ZU3 A;  2JDI D;  4CRC A;  2EQN A;  1MZA A;  2ZQ1 A;  2VPA A;  4XRN A;  4OS7 A;  4HX6 A;  3N7E A;  1J17 T;  4DII H;  2QV1 A;  1Q31 A;  2EST E;  3A83 A;  4LOY H;  2AQ6 A;  3F2G A;  5FCR A;  5PTP A;  1ELD E;  2XBY A;  4ZKO U;  1HJ8 A;  1FMG A;  1O34 A;  4AX9 H;  4BTT B;  5JBC S;  4U30 A;  1H8H D;  2TBS A;  1DM4 B;  1EAS A;  3F9G A;  1BIO A;  4LZ4 B;  1G79 A;  1BJV A;  2BDG A;  3I77 A;  1LPZ B;  1ZSJ A;  3VGC B;  3GY2 A;  3AAV A;  1XUG A;  1XUH A;  1P02 A;  1YWU A;  2EEK A;  1C2D A;  1FY8 E;  3ZVB A;  3DFL A;  2BVS H;  3V0X A;  1BB0 B;  1FLE E;  2AMP A;  1O3A A;  1EB1 H;  3PTN A;  1O3P B;  3AAS A;  1GMC F;  1ZRK A;  1ZSL A;  2DE9 A;  1MD7 A;  1EP6 A;  1O2R A;  1W11 U;  1VKY A;  3P6Z B;  1O3K A;  2QXG A;  1MD8 A;  3HPT B;  4GSO A;  4ASU D;  5LPF A;  4ZKY A;  3A7Y A;  1O0D H;  2H2Z A;  2VIN A;  1O2L A;  1FON A;  1ZJD A;  1EAI A;  3UQO A;  3SJI A;  5A0B A;  3U1J B;  1Z8G A;  1DXW A;  3UFA A;  3MH6 A;  3IIT A;  4NIV A;  4IC6 A;  1QRW A;  2ZGC A;  1AKS B;  4A92 A;  4I33 A;  4BAQ B;  4K3J A;  1O3F A;  1WBG B;  1CHO F;  1ZR0 A;  5DG6 A;  4YWN A;  1Y3U A;  2C8Y B;  2D1J A;  1O5C B;  3QWC H;  4Q80 A;  1K2I 1;  3Q3Y A;  4AB8 A;  1RZ1 A;  5DO4 H;  4MTB A;  7LPR A;  3SJO A;  3KYG A;  4W64 A;  1ZYO A;  4UE7 H;  1GBC A;  3GCT G;  1C5T A;  1NBM D;  4ACB A;  3P8F A;  4Y0Z E;  3U35 A;  4U32 A;  3QTV H;  1TPS A;  4JZI A;  1OWE A;  4K5Z A;  4Y7A A;  1HPG A;  1UTQ A;  2R3Y A;  1XXO A;  5E0G A;  2Z9I A;  3TGJ E;  2X1J A;  3H7T A;  1ABJ H;  1IQF A;  3A8A A;  4B2A A;  4UFF H;  4XSK U;  4X2V A;  1S0Q A;  4TV4 A;  1KMH B;  4ZKR U;  5EXM A;  1Z6E A;  1O2T A;  7GCH F;  4GVU A;  5CHA C;  3K2U A;  1GVL A;  2GCT C;  1CHG A;  3FZZ A;  3UQV A;  1W0Z U;  2BTC E;  2O8W A;  1W7G H;  2R9P A;  3GDS A;  5F03 A;  1I0R A;  2G51 A;  1P11 E;  3HK3 B;  3U5W A;  2WYG A;  1GMD G;  1TA6 A;  1VJ9 U;  2YNB A;  4IGD A;  3GDU A;  3TJN A;  1ESA A;  1SGP E;  2A5K A;  1T4U H;  1W0J D;  4YM9 A;  5BNC A;  2BQW B;  4AGJ A;  2BOH B;  4ZH8 A;  1YY3 A;  1NRG A;  2JH5 D;  1QRX A;  4MNX A;  3R5Y A;  2QE7 D;  5GPI B;  3TNT A;  2ZF0 H;  1SB1 H;  2ZEC A;  5EJ1 A;  1SGC A;  5HM9 A;  1C1T A;  3E3T A;  2ZHF H;  3P8N A;  3QLP H;  1HBT H;  3PRD A;  3DT0 H;  3V12 A;  4JYT A;  2BDH A;  2A32 A;  7EST E;  2QF4 A;  2XC4 A;  3ITI A;  3T2N A;  3K65 B;  1LVY A;  3HMZ A;  1C1V H;  1DXP A;  1TY9 A;  4NFF A;  3AWH A;  1HYL A;  4E7N A;  1F5K U;  1OPH B;  1IQL A;  2BVR H;  2Z7F E;  3A7X A;  1ZTK A;  3A7V A;  1DWB H;  1PJP A;  1SQA A;  4PRO A;  3RXO A;  1RRK A;  3FP8 E;  4GCH G;  5AFZ H;  5GCH G;  1P57 B;  2WPL S;  1QQU A;  1O3C A;  1A5H A;  1O2X A;  3C27 B;  1FDP A;  3OU0 A;  2CF9 H;  1PYT C;  3F0O A;  1C4V 2;  3AK5 A;  1CQQ A;  2W6J D;  4MVN A;  4A7I B;  3W94 A;  1S82 A;  1SLU B;  1OYQ A;  2V7Q D;  1DFP A;  3H5C B;  2XC5 A;  2C4F H;  4WWY A;  3UB0 A;  2BX4 A;  3STI A;  5TCC A;  4R0I A;  2ZU5 A;  1BRB E;  2B8O H;  1SQR A;  1FV9 A;  2IOT A;  2TPI Z;  2BD5 A;  1W13 U;  2AHM E;  2CV3 A;  2JH0 D;  1AFE H;  1UCY H;  2EY4 C;  1C5P A;  4Y11 E;  1W3O A;  1UTJ A;  1P09 A;  1WYK A;  1YPH E;  1P2I A;  2QF0 A;  3AW1 A;  2LPR A;  4YES B;  2V0B A;  2ZNK H;  4NFE A;  2A7C A;  1BCU H;  1Y3V A;  1SGF A;  2FHQ A;  3S9C A;  3RM0 H;  3VEQ B;  2ANY A;  1I0S A;  1OSS A;  1YLC A;  1DY9 A;  1Z8I B;  2BB4 A;  4AG1 A;  2Y82 A;  1D3T B;  2B9L A;  1FAK H;  4I8H A;  2FS8 A;  4E05 H;  4GAW A;  1SHY A;  1RIW B;  3D23 A;  3RUO A;  2Q1J A;  1EXF A;  5JAB A;  1O2I A;  2ARZ A;  2BLQ A;  1C2I A;  1TBR H;  3ZZC A;  1TMT H;  4I8G A;  2ZFP H;  1HUT H;  4MPV A;  2BZ6 H;  1SSX A;  1UTK A;  3Q77 A;  1H9H E;  1ZMN A;  2NWN A;  1DT2 A;  1O2Y A;  3BTH E;  3HKJ B;  3T26 A;  4KP0 A;  1V2N T;  3RC5 A;  7KME H;  1K1I A;  1RZ0 A;  3KEE A;  5DKM A;  1C1M A;  1NFX A;  1NU7 B;  1O2V A;  2I02 A;  1AQ7 A;  4WMD A;  2A2J A;  1ELT A;  1S83 A;  2BY8 X;  3D65 E;  3QZR A;  4CR9 A;  1P9U A;  1C5N H;  2P8O C;  3ZZ4 A;  3ATW A;  2DE8 A;  1HAV B;  1WQV H;  2FX6 A;  1TMU H;  2IPH A;  1V2K T;  1YCP M;  3UY9 A;  1L1N A;  2NU4 E;  3CS0 A;  1MTU A;  2JET B;  4IW4 E;  4ZHL U;  5I46 H;  3MYW A;  1GBH A;  1H8D H;  3BV9 B;  2XTT B;  1Q3X A;  3LGT A;  1DOJ A;  1USF A;  1TRY A;  4XBC A;  3PTB A;  4ZHA A;  2GT8 A;  1BOQ A;  5A0C A;  1CGJ E;  1S84 A;  3BTG E;  4UD9 H;  1AFQ C;  4WVP E;  1DUA A;  3TGI E;  3D62 A;  1QL9 A;  1BUI A;  2F3C E;  4RT0 A;  1GI2 A;  1K1N A;  1LVB A;  5HXF A;  1GI6 A;  1GJB B;  1UTP A;  4I86 A;  1GMC G;  1A5G H;  2BLO A;  2ILN A;  2V3H H;  4ABB A;  2BY7 X;  2W3K A;  3EAA A;  4X8S H;  1QY6 A;  1C5V A;  3DSG A;  3HK6 B;  1AE8 H;  1O36 A;  1T7C A;  2K0Q A;  3EA8 A;  2BD2 A;  4X2X A;  3U9A H;  4AOR A;  4Y10 E;  3RH7 A;  1CGH A;  2HTI A;  3A6R A;  2BM2 A;  2F9O A;  4R82 A;  1YOA A;  1P2O A;  2ALV A;  2GV7 A;  1PPH E;  2ZFR H;  4NIY A;  2ZHW H;  3ENS B;  1F0T A;  2HVY B;  5CHA B;  4Y79 A;  2FOC A;  3RXS A;  2GCT B;  1EJA A;  3MU1 A;  1DNL A;  1HNE E;  1BA8 B;  4CBO A;  2A4G A;  3LGY A;  4YOJ A;  1Y59 T;  4X6O A;  4TWY A;  3GY5 A;  3Q3X A;  3SUE A;  2YOL A;  3MNS A;  1HIA A;  4OGX A;  3KHV A;  1V2L T;  1TB6 H;  2GCH F;  1BDA A;  1TAW A;  2RFK C;  1GJ8 B;  2WUC A;  2STA E;  3K6Z A;  1GL1 A;  3Q00 A;  4AYY B;  3A7Z A;  1P10 A;  2VB0 A;  3B8J A;  3F9F A;  2H5C A;  1BTX A;  1CA8 B;  3MU0 A;  5C1Y A;  4AFQ A;  1GBI A;  4FXG H;  1XX9 A;  3EE7 A;  1NS3 A;  3SU1 A;  1KDQ A;  2KM0 A;  2BD4 A;  2GZ9 A;  2KR7 A;  5EW1 H;  4MPW A;  3U34 A;  1HCG A;  7GCH G;  1O2S A;  2AIQ A;  1OWJ A;  5HYO A;  3LJO A;  1ID5 H;  4BXS A;  3TJO A;  4DW2 U;  1L4D A;  4KEL A;  1CT0 E;  2ZDL A;  4BAH B;  4RSP A;  3LH3 A;  2QCY A;  1UCY K;  3ELA H;  1L1G A;  1S6F A;  4B75 A;  2KCO A;  2ZFT A;  2O8U A;  3SV7 A;  2WPD D;  4IC5 A;  5DSF A;  3FZD A;  3MFJ A;  1OP0 A;  1E36 B;  3P17 H;  1USC A;  5JPM H;  5CHB A;  4X1Q U;  4DOQ A;  3GY6 A;  4MTK A;  2FIR H;  2PP6 A;  1W12 U;  1NRQ H;  2Z3E A;  1GI4 A;  1GDN A;  1ELF A;  2ZGJ A;  4OS6 A;  3PB1 E;  3VB6 A;  2FYR A;  3SJ9 A;  1O2U A;  3F68 H;  4YT6 H;  4FET A;  2ZI2 H;  4BNR A;  3LIW A;  2TGA A;  1T9M A;  2Z9J A;  4NSV A;  1AVX A;  1WOF A;  4OM9 A;  3NFW A;  1BRU P;  1AB9 C;  1JMO H;  2J92 A;  1GBM A;  3PFT A;  4DY7 B;  2VH6 A;  4X6P A;  4WXV A;  3HGP A;  1SGT A;  4Q4L A;  1KXF A;  3Q76 A;  4J1Y A;  3VG8 A;  3GYM A;  4AC9 A;  2K8I A;  4XJ2 A;  2F91 A;  1HAZ B;  3MOC A;  4ISI H;  2ZHD A;  3A8C A;  1LHF H;  5FXL A;  1Y3W A;  5LGO A;  5JYI A;  1OWI A;  1QNJ A;  3HGN A;  1K1M A;  1TRM A;  1D6R A;  2FI4 E;  4B2B A;  2ZHQ H;  3FO8 D;  1KSN A;  5K0H A;  3MQK C;  1KXD A;  3ZV9 A;  1H4W A;  2ZFQ H;  3MH5 A;  3ZZD A;  2W7S A;  4K8B A;  3K88 A;  2VBC A;  4H6S B;  3ZOE A;  2QAA A;  4GHT A;  1OHH D;  2P5Z X;  4Y8X A;  3BTE E;  2HLD D;  2ZGB H;  1GBL A;  2X1K A;  1GBD A;  1K1P A;  1K28 D;  2J5U A;  1GI7 B;  2HTD A;  3KQ5 A;  5JDU B;  3U0I A;  1XHN A;  1BHX F;  1SLW B;  3E8L A;  5DP8 A;  5EOD A;  1W2K H;  2QXJ A;  1TGN A;  2XCF A;  5F6M A;  2D36 A;  1YGC H;  5LPR A;  2XBX A;  1UMA H;  2ZKS A;  1XUF A;  3MNB A;  1PYT D;  3LGV A;  1V2R T;  3AVZ A;  2WV5 A;  4ZXX H;  2P16 A;  3A87 A;  4X2Y A;  5FCK A;  1CU1 A;  2XW9 A;  1Y5A T;  1WTH D;  2PUQ H;  3CB0 A;  3FVF B;  4AB9 A;  1O2K A;  4HMT A;  2OBO A;  3OSY A;  1MAX A;  1XKB C;  4ZHM U;  1HAP H;  5C5N A;  2UWO A;  1G37 A;  3BG4 B;  2P8O B;  2H6M A;  3BA3 A;  2BY9 X;  4ISO A;  3SU0 A;  1NO9 H;  1C5S A;  2ZFF H;  4JZE H;  3SYJ A;  4NIW A;  3HY8 A;  1TOM H;  3DFJ A;  1AIX H;  2O8M A;  5GXP A;  3VY2 A;  1PPE E;  3GCO A;  3RMN H;  1C9P A;  1OX1 A;  5T6F A;  1A0L A;  3P8G A;  3MH4 A;  2W26 A;  4NG9 H;  3UUZ A;  2SNV A;  3TJU A;  1FZZ A;  1FI8 A;  1G78 A;  3HAT H;  2WV4 A;  1RXP A;  2BD9 A;  5ETX A;  3RXH A;  1VZQ H;  4K1S A;  4X1P U;  2W6I D;  1O2J A;  2BD3 A;  1W3C A;  2FOA A;  3SBK A;  3U8T H;  4YXW D;  1YPK H;  4MNV A;  1LCY A;  3A20 A;  1XUK A;  1FLM A;  2EI8 A;  4AFS A;  5EOK A;  1O5B B;  1EQ9 A;  2R2M B;  1LDT T;  1TNJ A;  5EW2 H;  1DE7 H;  1WGB A;  1A3B H;  2HRV A;  1C2F A;  1N6X A;  3VPK A;  2UUJ B;  1PQ7 A;  2L1T A;  4CHA C;  1C5W B;  2PKS C;  4JK6 A;  1IQN A;  2SFA A;  2ZTY A;  4AFU A;  5JBB S;  3ATL A;  1HJ9 A;  4K8Y A;  2H9T H;  1MU6 B;  2CMY A;  3EC6 A;  4BAO B;  1LKA A;  2F43 B;  3DUX H;  1G3D A;  5JBA S;  1GI5 A;  1TPO A;  1V2S T;  5EU8 A;  1LVM A;  1D3D B;  1JIM A;  1F5L A;  1XXF A;  4O97 A;  1XVM A;  1RTK A;  2ZGX H;  2FTM A;  4ASH A;  2ECR A;  3S9A A;  1DIC A;  2PV9 B;  3EQ0 H;  3LC3 A;  5FX5 A;  1EZX C;  5L6N H;  3ODF A;  1AGJ A;  1SOT A;  2RCE A;  2PSY A;  4X1N U;  1T32 A;  5C20 A;  1BTU A;  5KGO A;  3LT3 A;  4YBN A;  4O3T A;  2ZU2 A;  3PMB B;  2LEL A;  3TPI Z;  5I25 A;  3A88 A;  3M7U A;  2VNT A;  4TWW A;  1O2Z A;  3R5P A;  1F0R A;  3M3S A;  1O3M A;  1C1P A;  4WXI A;  4K2Y A;  5A0A E;  9LPR A;  5C17 A;  1C1Q A;  1TAL A;  5CMX H;  1LVO A;  2OCV B;  2F9P A;  1ZTJ A;  1NZQ H;  3CP3 A;  2P3F H;  1OKX A;  4UON A;  2V3M A;  3OY6 U;  2TIO A;  2XBV A;  3R5R A;  2G52 A;  1TNI A;  1ZJK A;  4JZF H;  3ZOG A;  5DP5 A;  5ABW A;  5GDS H;  3GY7 A;  2AGE X;  2GCH G;  1A2C H;  1SKY E;  1W0K D;  1C1N A;  5FX6 A;  5KED A;  3UNQ A;  4Y6D A;  2O9Q A;  3VFE A;  4HFP B;  2BXU H;  3M3V A;  1QL7 A;  1DSU A;  4LXB H;  4B74 A;  2GTB A;  4IMZ A;  1AB9 B;  2SGE E;  1ZRB A;  5DP9 A;  1C1O A;  1C5O H;  3DSO A;  2OQU A;  1TX6 A;  1LTO A;  3STJ A;  2GGV B;  3SNC A;  3R5L A;  2JIZ D;  3RXC A;  1GJ9 B;  2ZDV H;  5C67 A;  1P2N A;  1ANC A;  4I7Y H;  1GJ5 H;  3OTP A;  4ISL A;  1QA7 A;  3QN7 A;  1Z1I A;  1AND A;  3T28 A;  4KTS A;  3NKK A;  3CNR A;  3FKH A;  1GJD B;  2M2A A;  1N8O C;  2Q6F A;  4YLQ H;  3U69 H;  1WV4 A;  1YPG H;  4O03 A;  4IMQ A;  4Y7B A;  1ELE E;  2ZO3 H;  1SLX B;  1P03 A;  1EZQ A;  4A1T A;  1C5M D;  4XHY A;  2FS9 A;  5FL7 D;  1O35 A;  5EPN A;  1HB0 B;  2P93 A;  1BML A;  2FTL E;  2KAI A;  4CH2 B;  1DS2 E;  1ZSK A;  1UO6 A;  2LNC A;  3TH4 H;  3FOA A;  1TX8 A;  4XDE A;  1DY8 A;  3E90 B;  2QC2 A;  3LDX H;  1XUI A;  1EPT A;  4I8J A;  1DX5 M;  1QB1 A;  4DCD A;  3C1K A;  1H8I H;  2I51 A;  1MTV A;  2XND D;  1B5G H;  3ZZ7 A;  3LH1 A;  4WME A;  2Z94 A;  2K1Q A;  3E1X B;  1GI9 B;  3RML H;  2ZTX A;  4BXW A;  2AMD A;  3LGU A;  1BMA A;  3H7O A;  4WY3 A;  4FUD A;  2BDI A;  3G01 A;  1AUJ A;  3BTK E;  3OYP A;  4QT8 C;  1TQ0 B;  1C5R A;  3MMG A;  2YNA A;  1FY3 A;  1ELA A;  2VIO A;  3UR9 A;  3A89 A;  4DJZ B;  2UUF B;  2GJG A;  4OS1 A;  5IYT A;  1KXB A;  4DIH H;  2A5A A;  1C2L A;  3MU4 A;  3GAS A;  1VJA U;  1TNL A;  1ZHP A;  4TYD A;  3KYF A;  2CK3 D;  2Y7X A;  1MTN C;  5TJX A;  4MDS A;  2QXI A;  2OTV A;  4JK5 A;  2O8T A;  3SN8 A;  5IK2 D;  1XKA C;  1CBW C;  1PPZ A;  3VXE H;  3NZI A;  2PTN A;  1SR5 C;  1E35 B;  3CS7 A;  3P92 A;  3NWU A;  3RXQ A;  1P2Q A;  2HNT C;  1HJA C;  1SGY E;  3QGJ A;  1AN1 E;  3BF6 H;  4DUR A;  3W1E A;  1ELB A;  3H96 A;  1AHT H;  2A4O A;  1K1J A;  2SGP E;  1YLN A;  2ODP A;  4JMY A;  1FIZ A;  1C1W H;  2F9N A;  1FN6 A;  1QRZ A;  1C5Y B;  2AGG X;  3GY4 A;  3TK9 A;  4CHA B;  3ZVD A;  5C0U A;  2PKS B;  4FUI A;  1GHA F;  4NIX A;  3MNC A;  1GHW H;  1KDQ B;  3PMA B;  2R3U A;  4CRE A;  2Z3D A;  4UHV A;  3CEN A;  1S6H A;  5CHE C;  1TFX A;  1TYN A;  2ZP0 H;  1A4W H;  4EST E;  3SHA H;  5SGA E;  3F6U H;  2ALP A;  1QA0 A;  2YMS C;  4RKO B;  5A09 A;  1ARB A;  3GS9 A;  2FEQ H;  2QCK A;  4HG6 A;  3SJ8 A;  3TK6 A;  2QYI A;  4BTI B;  3W95 A;  3RXG A;  3SI4 H;  4IRA A;  4XD7 D;  1G32 B;  3VB3 A;  2FLB H;  1D4P B;  3GYL B;  4H4F A;  2AGI X;  4ABF A;  2ANK H;  1O5D H;  3MH7 A;  3ZIA D;  1T8N A;  1O2M A;  4NA8 A;  1QHR B;  1LHG H;  4ZUH A;  1EB2 A;  3FFG A;  2ODY B;  3TH2 H;  1H9I E;  5GIB A;  3RXR A;  1C5L H;  5FHT A;  2FM2 A;  1INC A;  2SNW A;  1WLI A;  1E34 B;  2UUY A;  1YCP H;  2ULL A;  2R6V A;  3L3T A;  2ASF A;  1KLT A;  1IQI A;  3VYA A;  4HMV A;  1LHE H;  2FDA A;  2WIN I;  1BZX E;  3T25 A;  1TA2 A;  1OYT H;  3URC A;  1AUT C;  1IQH A;  3TNS A;  5EJZ A;  1Z8J B;  2AER H;  1TBZ H;  1EAT A;  1P0S H;  2QN5 T;  1TIO A;  1YKT A;  3GIS B;  1C4Y 2;  2FOE A;  1F0U A;  1GMH F;  1ELG A;  4NZL A;  2F83 A;  4CRG A;  4CBN A;  4P00 A;  3RDZ A;  1GJ7 B;  2ZTZ A;  4WF8 A;  3R5W A;  1B7X B;  2WPI S;  3M7T A;  2G5N A;  4FU9 A;  3HKI B;  2J9N A;  1XUJ A;  1VCP A;  1AZZ A;  1O32 A;  3PLP A;  2HNT F;  1ACB E;  1GCT C;  4FVB A;  4Y0Y E;  3A82 A;  2BY5 X;  2ZPQ A;  4WH6 A;  1A1R A;  3RLW H;  2PKA A;  4CRB A;  2ZDK A;  2ZCH P;  1IQK A;  1EPT C;  2OIN A;  3RC4 A;  3DB0 A;  2TGD A;  4THN H;  2H1U A;  1DWE H;  2Q9K A;  1TOC B;  3NPS A;  1BJU A;  1GBE A;  1K22 H;  3T27 A;  1V2M T;  3Q3K A;  1NM6 A;  1BRC E;  1CT2 E;  3H09 A;  2GVF A;  4O9V A;  4I8L A;  3U8R H;  4Q7Y A;  2FOM B;  3UWI A;  4FUC A;  4DGJ A;  2B0F A;  2HOB A;  3PM3 A;  2RE7 A;  2AH4 X;  1GBB A;  1Z6J H;  3A8B A;  4B6F A;  3WWB A;  2CGA A;  2ASU B;  1MMJ N;  4F48 B;  1N8O B;  1NBM E;  1Y30 A;  4NGA H;  5KEC A;  1QBN A;  2C93 B;  1MCT A;  1OWD A;  1P2K A;  1PPG E;  3QGN B;  5A8X A;  1K1L A;  2GX4 A;  4HMX A;  3FP6 E;  3LJJ A;  4NCY A;  1AD8 H;  4ABD A;  2XYA A;  3N7D A;  1EUF A;  4MPU A;  1UVT H;  1SGI B;  5G4B A;  3T29 A;  1FQ3 A;  1RFE A;  4MNY A;  2ANW A;  1GCD A;  1A46 H;  1SGQ E;  1NTP A;  2HAL A;  4UFE H;  4ZXY H;  3V7T A;  1W9A A;  4ZMA H;  1KY9 A;  1THS H;  3LOX A;  1DUE A;  2ED4 A;  2Y5G A;  3R3G B;  4TY6 A;  4Z1M D;  1SVP A;  1W3R A;  2RG3 A;  1D3Q B;  4UEH H;  3S9B A;  3OEH D;  2OQ5 A;  3DMB A;  1YF4 A;  1MBQ A;  3SGQ E;  1EKB B;  4AN7 A;  2P94 A;  1TLD A;  4AOQ A;  1CI0 A;  4GUX A;  3GY8 A;  1J15 A;  2D38 A;  3EA7 A;  3SUD A;  1D6W A;  1VIT F;  1CHO G;  4B73 A;  2XCN A;  5K7R A;  1G30 B;  1QGF A;  2CHA C;  3SU4 A;  2D5M A;  1NRS H;  2PFE A;  4KGA A;  2QF5 A;  4TPY A;  3V13 A;  2AFQ B;  1KXE A;  5T3H A;  3PMH B;  1KIG H;  3FKS D;  3T5F H;  2ZPS A;  3ZVG A;  3F2F A;  1F2S E;  1WU1 A;  4MNW A;  1XXD A;  1Z1J A;  4B1T A;  3ZZA A;  1A61 H;  5EXN A;  1MTN B;  1FY1 A;  3KNX A;  5EQS A;  6LPR A;  1Y5B T;  4X1S U;  1GI8 B;  1IAU A;  4KKD A;  1GI1 A;  2ECU A;  1ANE A;  1CBW B;  3SGB E;  1QCP A;  2G81 E;  1MQ5 A;  1G77 A;  2GDE H;  5EG4 A;  9EST A;  1O39 A;  1TAB E;  1QUR H;  2SGQ E;  1HJA B;  1TX7 A;  2FLR H;  2ZFS A;  4N7R C;  5B6O A;  3E0N B;  1Z71 A;  1V2O T;  2GMT C;  2UWL A;  2M5T A;  2A7H A;  1O3H A;  2KZ4 A;  3WY8 A;  3SOR A;  3M36 A;  2BDY A;  4J2Y B;  3RXM A;  5ESC A;  2CJI A;  1O5G H;  2I6S A;  3GY3 A;  1AVG H;  3ZV8 A;  3U8O H;  1P12 E;  1YCP K;  4XE4 A;  3ZZ8 A;  4IN2 A;  1MAB B;  3FAN A;  1O3O A;  5C94 A;  1ZPZ A;  3DSP A;  2IN2 A;  1UK3 A;  2AS9 A;  2QA9 E;  2Z9L A;  1P05 A;  1NT1 A;  1OXG A;  5BPE A;  1TBQ H;  4ZAE A;  3RC6 A;  4JYU H;  2YMS B;  2ZG0 H;  1BMN H;  2Z3C A;  4X1R U;  4ABG A;  2FOH A;  2F9U A;  1L2E A;  2KX4 A;  2OU5 A;  3M5M A;  2VVU A;  1Y3Y A;  2ZZU H;  1GJC B;  4F49 A;  1LPK B;  3PRB A;  2JJ2 D;  4XOJ A;  4K1E A;  4SGB E;  5E0H A;  4ABA A;  1MZD A;  2Y6T A;  3P95 A;  3TK5 A;  1YPM H;  1SC8 U;  3TH3 H;  3RXP A;  2OL5 A;  3RXD A;  1EP5 A;  1GJ4 H;  5DN6 D;  3MO3 A;  2SGF E;  5DP3 A;  1GHA G;  3F2H A;  5DK1 A;  5H4I B;  3ZOC A;  3SQH E;  3LGW A;  4U01 A;  1FPH H;  1WDI A;  1ETT H;  1G3E A;  3M35 A;  4RI0 A;  4BAK B;  1NFU A;  4K1T A;  2A7J A;  3SWJ A;  3OTJ E;  4ZKN U;  3B23 B;  2ZU4 A;  3AMF A;  3QX5 H;  3RXI A;  1K1O A;  5CDF E;  4Q2K A;  2FYQ A;  2L6O A;  3KQC A;  4WMF A;  1TNK A;  4JZ1 A;  2A2Q H;  2FO9 A;  1ABI H;  3ATM A;  1TPA E;  3SHC H;  4KTC A;  1A3E H;  2OXS A;  1YPJ H;  2ZPR A;  3TVJ B;  1S5S A;  2W7U A;  4Y9I A;  4YLU A;  3MI4 A;  3BG8 A;  1FPC H;  3SJK A;  4H6T A;  1BTW A;  1GCT B;  1OP2 A;  2KAI B;  2YMS D;  4M9F A;  1YLD A;  3OFN D;  1G76 A;  3U98 H;  1GHB F;  1C1R A;  1E79 D;  2XXL A;  3S0N A;  5FPS A;  1TWX B;  4OGY A;  2V3O H;  2VGC C;  1EPT B;  5FAH A;  3BNK A;  1C9T A; 
#chains in the Genus database with same CATH homology
 1EJE A;  3DB0 A;  4HMS A;  4N7R C;  3A20 A;  2Q9K A;  1T9M A;  1FLM A;  3B5M A;  3H96 A;  4YWN A;  3NFW A;  1YLN A;  1RZ1 A;  3FGE A;  2HHZ A;  3PFT A;  3ZOD A;  4F07 A;  5EJL A;  1WLK A;  4RT0 A;  1WGB A;  3IN6 A;  3KYG A;  5ESC A;  3R5L A;  2IG6 A;  4I86 A;  2IAB A;  2RE7 A;  3ZOF A;  4XJ2 A;  3U35 A;  3E4V A;  2HQ7 A;  3DSG A;  3ZOH A;  5CHE C;  3EC6 A;  4F48 B;  1Y30 A;  3CNR A;  5KEC A;  1XXO A;  4RT1 A;  3RH7 A;  1W3O A;  3FKH A;  3F7E A;  1VL7 A;  2HTI A;  1WV4 A;  2X1J A;  3A6R A;  4R82 A;  1YOA A;  4HMX A;  3TGV A;  2OU5 A;  4XHY A;  2FHQ A;  4HG6 A;  2QCK A;  5EIY A;  4QVB A;  1I0S A;  1AXJ A;  2FG9 A;  2E83 A;  2ECR A;  1RFE A;  4IRA A;  1DNL A;  3K88 A;  2L74 A;  2OL5 A;  3ZOE A;  1W9A A;  4P02 A;  1I0R A;  2FUR A;  4HMU A;  2ED4 A;  5JAB A;  3U5W A;  2ARZ A;  2X1K A;  1W3R A;  3ZOC A;  2HTD A;  2VPA A;  4XRN A;  4HX6 A;  1XHN A;  3U0I A;  2I51 A;  3DMB A;  5BNC A;  2IML A;  5KGO A;  2D36 A;  4YBN A;  2RDE A;  1CI0 A;  1WLI A;  2PTF A;  1NRG A;  3BPK A;  4FOU C;  2R6V A;  2ASF A;  4L82 A;  3SWJ A;  2D38 A;  3R5Y A;  2AQ6 A;  2D37 A;  4Z85 A;  3A6Q A;  3VYA A;  4HMV A;  3AMF A;  1RZ0 A;  5EJ1 A;  3R5P A;  3CB0 A;  1G79 A;  5EJZ A;  4HMT A;  2I02 A;  3R5Z A;  2A2J A;  2D5M A;  2R0X A;  3U34 A;  3BA3 A;  1YWU A;  4HMW A;  3VY5 A;  2GJG A;  3HY8 A;  4P00 A;  3CP3 A;  3HMZ A;  4Y9I A;  3R5W A;  1TY9 A;  3VY2 A;  3GAS A;  2HQ9 A;  3AWH A;  3R5R A;  3ZOG A;  2NR4 A;  1W3Q A;  3K86 A;  3KYF A;  5CHO A;  1JNW A;  1USC A;  1USF A;  4ZKY A;  1G76 A;  3K87 A;  2ECU A;  5KED A;  1G78 A;  1G77 A;  2QEA A;  3DNH A;  1W3P A;  3BNK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...