1YLNA

The crystal structure of the protein of unknown function vca0042 from vibrio cholerae o1
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
226
structure length
225
Chain Sequence
TVSTINSTDALAMVEHSELTLSITTPVGTKFVCRTPFIGTHTDKFLLVEMPKISADDLQYFFQEGFWMNIRAISPRGEGALIHFRSQLMHILQEPVPMAFLSIPNTMQVSQLRKEPRFELNLAGKVLFDEHRGDCELRDLSRSGCRFITPPLGKTYQVGDLVALEIFSDLRGTKTFPPLTGKICNLQRSLHHARYGLEFNEEGRNNAKNLLAQLKFNGTKLTLNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein vca0042
publication title The crystal structure of the hypothetical protein vca0042 from Vibrio cholerae O1
rcsb
source organism Vibrio cholerae o1
molecule tags Structural genomics, unknown function
total genus 39
structure length 225
sequence length 226
ec nomenclature
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07238 PilZ PilZ domain
A PF12945 YcgR_2 Flagellar protein YcgR
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.110.10 Mainly Beta Roll Pnp Oxidase; Chain A Electron Transport, Fmn-binding Protein; Chain A 1ylnA01
2.40.10.220 Mainly Beta Beta Barrel Thrombin, subunit H predicted glycosyltransferase like domains 1ylnA02
1USCA 3R5LA 2OU5A 4RT1A 4XRNA 4YWNA 3CP3A 4RT0A 2RE7A 2VPAA 2FG9A 1NRGA 2X1JA 1WV4A 3VY5A 4HX6A 3FGEA 3RH7A 1G79A 3SWJA 1W3OA 3CB0A 3A20A 3KYFA 3U0IA 2ECUA 3HY8A 4XJ2A 1G78A 2D36A 3R5RA 2E83A 1W9AA 2HHZA 1WLIA 1FLMA 2D37A 4I86A 2PTFA 1JNWA 1W3PA 2Q9KA 5EJLA 2IMLA 1G76A 2QEAA 1XXOA 3GASA 3DSGA 4Z85A 2HQ7A 1I0RA 3B5MA 2X1KA 4HMWA 3ZOEA 2IG6A 2D5MA 4Y9IA 1XHNA 1YLNA 3K87A 3U5WA 3ZODA 2A2JA 1DNLA 1VL7A 3ZOHA 2I51A 3HMZA 4R82A 2ED4A 2D38A 2HQ9A 4P02A 3AWHA 1TY9A 4HMVA 4F07A 5EJZA 5ESCA 3PFTA 1W3QA 2QCKA 2ASFA 2FURA 3IN6A 2HTIA 5EJ1A 2R6VA 1Y30A 3DMBA 2L74A 3R5PA 4ZKYA 1I0SA 4P00A 3R5WA 1CI0A 3NFWA 5CHEC 1USFA 4HMTA 3K88A 2FHQA 2RDEA 4HG6A 5KGOA 3EC6A 2R0XA 3R5ZA 3A6QA 3ZOGA 1RZ1A 2ARZA 3AMFA 4HMXA 2GJGA 1WLKA 3E4VA 1WGBA 2IABA 3K86A 5BNCA 1G77A 4IRAA 3R5YA 2NR4A 3ZOFA 3ZOCA 3VY2A 4F48B 5EIYA 4L82A 5KEDA 3BA3A 3CNRA 3A6RA 3BNKA 4HMUA 2HTDA 3DB0A 1W3RA 1AXJA 3F7EA 4N7RC 5JABA 4FOUC 3H96A 1EJEA 3DNHA 4QVBA 3KYGA 4YBNA 3TGVA 3VYAA 2ECRA 1RFEA 2AQ6A 3U35A 1YOAA 1RZ0A 3BPKA 3FKHA 4XHYA 1T9MA 5CHOA 2I02A 3U34A 5KECA 1YWUA 2OL5A 4HMSA
chains in the Genus database with same CATH superfamily
1TONA 4MG3A 1YPJH 1O38A 1WTGH 4UD9H 2J95A 5T6GA 5K7RA 4YO9A 3EYDA 1NRGA 2A4OA 2OC1A 2ZECA 1ABIH 4MLFB 1G79A 1K0HA 3FVFB 4A1VA 3N7EA 5CDFE 1O2LA 2QYIA 1BTHH 1J14A 2XWAA 1QURH 1WAYB 1EB1H 1ZMJA 3QWCH 1C5NH 4JK6A 4CRAA 2D37A 3SOSA 1WQVH 5EQRA 5T1VA 1K1PA 1W3PA 2HLDD 3VB7A 2Q9KA 1PPCE 1PQ7A 2G8TA 2RDLA 1HFDA 2QEAA 1O2SA 2XRCA 4X1QU 4H42U 2QAAA 3LJOA 4YM9A 2TGDA 2C3SA 2PHBA 2IG6A 1GJAB 1C2MA 1XUGA 2BLOA 1GWAA 1Z8JB 2FI3E 3FZDA 2I6SA 5E2PA 3UOUA 2WPMS 1UCYH 1GBKA 1P2KA 4P02A 2BDYA 2QY0B 2QN5T 4UHVA 3RMOH 1O2VA 1ELEE 1BRBE 1XX9A 3SHCH 5A8ZA 2H1UA 2HTIA 2G52A 5EJ1A 5B6LA 1SHHB 2F83A 4IS5A 3GY5A 1I0SA 1K1JA 2EC9H 3MU0A 2PUXB 1K21H 2QXJA 1O3JA 1J15A 5DGJA 1DWBH 5ABWA 4NFEA 2PFEA 1GI4A 3RXAA 1WLKA 1RIWB 5J4SA 3K86A 4IGDA 3A81A 4GCHF 1DSUA 1F7ZA 4AFUA 1C1RA 5L2ZH 3Q3XA 4AGJA 3BNKA 1IAUA 4K8YA 3ESTA 3KQCA 1AXJA 3ELAH 2ZU5A 3PV5A 1A0HB 2J98B 4I8LA 4X0WU 1QR3E 6LPRA 1DM4B 3GY2A 1G36A 1ZZZA 3PO1B 4DT7B 4QVBA 1GJ7B 5LPRA 1P01A 1GL0E 4MPUA 3FKHA 2H9TH 5A09A 2CN0H 4I31A 2FI5E 2ZC9H 1O2TA 5FBEA 3SUEA 1ARBA 4CRFA 2QF4A 4OS5A 1P2NA 1CBWC 2FTLE 2G4UA 3FP7E 5FAHA 1WBGB 4ZKSU 2BDHA 1O32A 1UHBB 2PSYA 1PPBH 3A8DA 2VINA 1GCTC 2R2WU 2RE7A 1C9PA 1Y5UT 1GHYH 2Z9LA 2JJ2D 1GG6B 4F55A 3MYWA 1SFQB 3RH7A 2VIWA 1GI6A 1DWEH 2BM2A 2WV9A 3T5FH 3SJIA 4Q80A 5L2YH 3M37A 2THFB 1GJ9B 5EPYA 3KNXA 3DHKH 5IDKA 2WINI 1KXEA 1F0SA 2SGDE 1BCUH 1SKYE 4FU8A 5SGAE 3DFJA 2QGRA 1EPTC 1T31A 1UK3A 1FPCH 3F9HA 1QRWA 2OLGA 2WYJA 1N6YA 1SGQE 8LPRA 3PTBA 1AE8H 4MPVA 4K2YA 1KXCA 1EZUC 5IK2D 1TQ7B 4K8BA 2VGCC 1NPMA 1O3NA 2JH6D 3OAAD 3PM3A 4X8UH 3ZZ7A 2QCKA 3FO8D 1F92A 4AG2A 2R0KA 3SUGA 1KY9A 1WSSH 2BDIA 3A7YA 4JZFH 1GCDA 1DX5M 1VITG 2J9NA 3UNSA 4XE4A 4X2WA 1BJVA 3EC6A 1BBRK 2XC0A 2R0XA 1SLVB 3PROA 2ILNA 1C1MA 1V2KT 5TCCA 1SR5C 1G3BA 1SQAA 3ZOFA 2K4QA 3W94A 1ELFA 3A6RA 1BQYA 2FEQH 1GHVH 5JBTA 2UUFB 2A4QA 4X1PU 1FMGA 2BDCA 2BY9X 2BD8A 4X8VH 4DW2U 2QC2A 3TIUA 4ISLA 1P2QA 2HPQH 1UMAH 1NRPH 2ZCHP 3ZZ3A 3N7OA 2FYRA 2A7CA 2BB4A 3PLKA 2V35A 1F0RA 3DFLA 2A1DB 2F9OA 2TRMA 4ZHMU 1DITH 4A92A 5J4QA 5HM9A 1S84A 9LPRA 1NU7B 5EXLA 5EW1H 2D2DA 2KAIB 2G4TA 3A86A 1HJAB 5FPTA 2VJ1A 3LGWA 5DP3A 4MNWA 1EJAA 3U8TH 5A0AE 1LO6A 2ZCLP 4WH8A 1MTWA 1O2ZA 4W64A 1OYTH 2VH6A 1WOFA 3LPRA 3HK6B 2J34A 1JMOH 1GBCA 1P9SA 1LKBA 3UOPA 5C17A 2C8XB 4K5ZA 3RXSA 5C5OA 2SGAA 3TJVA 2PTFA 1HAZB 1IHTH 2AMQA 1HAGE 5EJLA 1DWDH 3SJKA 4ZROA 1EZSC 1LHEH 1G76A 1W3CA 3ZYEA 5A8XA 1FY5A 1L4DA 4ISHH 1SGIB 1SB1H 2F91A 3RUOA 5DP4A 1L0ZA 3Q3KA 3F2HA 4JYTA 3OFND 4CBNA 1HAVB 1TX7A 1ZR0A 1GBBA 1TBQH 3UFAA 3TGJE 1P3EA 2B8OH 4J2YB 1K1LA 3E0NB 2B5TB 1YY3A 3BTQE 4ZXXH 2ODYB 2R6VA 1GVKB 4CR9A 1W14U 3GCOA 5DP5A 3SV2H 4DVAU 2GV7A 1CBWB 1AQ7A 1C2FA 1YC0A 1GHWH 3SU5A 2FHQA 4HFPB 3RLWH 2RDEA 3RXEA 1S83A 4UFDH 1O2WA 1MBQA 2AEIH 1GCTB 2GTBA 5FX6A 1HIAA 5HXFA 3RDZA 2CMYA 1RXPA 3R5YA 1NRRH 4CHAB 3VB6A 1BTWA 1V2RT 1QB9A 1FIZA 3CNRA 4HMUA 3FFGA 1RTKA 4ESTE 1UCYK 3M5NA 4N7RC 1TE0A 1IQJA 1MMJN 3RU4D 1L2EA 1DS2E 3PMBB 4KTUA 5F8XA 4INHA 3VYAA 4NWKA 2V3HH 1ARCA 1PQAA 2RA0A 3N7DA 3SNDA 4XHYA 1E36B 1HUTH 5DP8A 1BMAA 5ESTE 3STJA 2BX3A 5C67A 1C5XB 1EPTB 2GCTC 4I8KA 4Y7AA 4CR5A 2WPHS 2AS9A 4ABGA 2FOFA 4UEHH 1Y3WA 3M36A 3SNCA 2L1TA 2ANKH 4ZKNU 4LZ1H 4DURA 3LH3A 1GBDA 1PJPA 4M7GA 1LCYA 2KCYA 1TQ0B 2IJD1 3PRDA 2J92A 3SQEE 3GICB 1WV4A 4KP0A 3FP8E 4HX6A 1EQ9A 1KMHB 4CH8B 2XTTB 1CE5A 3U9AH 3P8NA 4AFQA 1ELDE 1EAWA 1A0JA 2F3CE 3LJJA 3VG8A 2ALVA 4ZAEA 2ZPQA 1V2QT 2WPJS 4YOIA 2FXRA 3PB1E 4JZEH 3A8AA 4XDEA 2NU4E 1GHBF 2VH0A 4I7YH 1V2OT 5C20A 2ZHEH 3UWJH 1O5CB 1BMLA 2FOHA 1MTUA 2C8ZB 2SGPE 1YLNA 1P05A 3UR9A 1DNLA 1G2MA 4Y7BA 1MD7A 4R82A 1E38B 3CS0A 2AMDA 1TBRH 2P59A 1WXRA 5A8YA 3P6ZB 2BHGA 1GJBB 1SGCA 4TPIZ 3E3TA 4B2CA 2LELA 1E0FD 3T29A 2FYQA 1RTLA 4GVUA 1D9IA 3T28A 1CA0B 1HDTH 1OP0A 3P95A 4RSPA 2AFQB 2GMTC 4YTAA 1AVGH 1UTNA 4FUBA 1HBTH 1ANCA 1MCTA 4I8HA 3MH6A 1O5EH 3HKJB 5GIBA 2P16A 4HMTA 3GOVB 1O3CA 4X1RU 1IQEA 2AERH 1N8OC 1O2NA 3MU4A 1MQ6A 3S7HB 3A6QA 3MO3A 2OXSA 3M3SA 5L6NH 1Y5AT 1IHSH 1DDJA 1SL3A 3SNAA 3OEHD 1ANBA 3I78A 1UO6A 2J4IA 2F9UA 5C5NA 1FV9A 1VJAU 2Y80A 2ZQ2A 1FY1A 3A88A 3SU0A 4A1XA 1TX8A 7LPRA 4WWYA 1GI0A 5GJ4B 3MU1A 4DCDA 1NRSH 3F9GA 1ETRH 3NRLA 1YM0A 1GJ4H 2Q6FA 3F1SB 2B7DH 4JYVH 4MPWA 1GI7B 4NA8A 3RXHA 1AZ8A 3EA8A 3PMJA 1C5SA 1LVMA 2P3UB 1O5FH 2FX6A 4IC5A 1J17T 1C1WH 1LPZB 4FVBA 4UDWH 2Y6TA 1GHAG 4U30A 3UNRA 3KQDA 2WUBA 1LHCH 1EFRD 4ABHA 1FY4A 5FHTA 2OCVB 1FONA 3SGBE 1MKXH 3ZV8A 4TWWA 2G55A 3LGUA 3SWJA 3A20A 4DJZB 3STIA 4ABDA 1G9IE 1P10A 4BAQB 1W9AA 3BIUH 1VGCC 3B8JA 1WLIA 2YMSB 4X2VA 1DWCH 4UONA 2ZU2A 2VNTA 3MOCA 1Z7KA 4E7RG 3M61U 2ZP0H 6GCHF 1AU8A 1BHXB 2PR3A 2IMLA 2XXLA 3A7ZA 1V2TT 1V2UT 3DSGA 1T7CA 2BD3A 2BMGB 5GCHF 2QF0A 3HATH 1VR1H 5E0GA 5FXLA 1V2LT 1QBNA 1INCA 3DSOA 2CJIA 1VL7A 1JXPA 1PQ5A 3Q3YA 1E79D 3FKSD 4WF8A 1GBMA 1GHXH 1BITA 3SGQE 1SGRE 5ESCA 2BLWA 1AIXH 2VIVA 2O9QA 3OE7D 2G51A 3AW0A 1NRNH 3IN6A 4TPYA 3KQ5A 3A87A 4AFZA 1WV7H 1Y30A 1T4VH 3ZYDA 1HB0B 1T4UH 4OS7A 3TH3H 1H4WA 1O35A 3V0XA 1X7AC 1AUTC 2EI8A 2Z3CA 2WPKS 2FOEA 2GCHF 2Q1JA 4ABFA 2GJGA 1HYLA 1TNHA 5A0CA 4BTTB 1H9IE 1TIOA 4YT6H 4TWYA 2NU3E 3PLPA 3L3TA 1GG6C 1YKTA 1AWFH 3GDSA 3BA3A 4YZUA 3UWIA 3W95A 2A4GA 4CRCA 5LGOA 1QJ1B 3A83A 2HVYB 2ZPRA 1P2JA 3F9FA 3DT0H 1FAXA 1QQUA 4Y8XA 2FOAA 4NSYA 5FL7D 1MU8B 1E34B 5CMXH 2ZDLA 2WZQA 2UUJB 1EJNA 2ZF0H 5IYTA 3U35A 1TRNA 5HIZA 4OS1A 2AYWA 1TFXA 4K60A 1JOUB 3KIDU 1HV7A 1UTLM 3RXBA 4SGAE 3RXMA 4CRDA 1E1QD 1W7XH 3BG4C 1USCA 2EY4C 4RT0A 1SPJA 1C5OH 3QTOH 1C1PA 1TMUH 3VPKA 3ZZBA 1O33A 3FGEA 2XWBI 5DPAA 3CB0A 2B0FA 2EA3A 1TGTA 3AAVA 3PV2A 1UTJA 3UAIC 4IMQA 2XW9A 1A5IA 3Q00A 4IN1A 1OSSA 1NZQH 3BEIB 3GCTF 1LHGH 2D36A 4AYYB 4TYDA 1C9TA 1ZSLA 2VBCA 3F9EA 3SI3H 1XXFA 1YBWA 4I86A 1GJ8B 1O2HA 3R3GB 4MQAA 2C8WB 2FI4E 1O5AB 1O3IA 4MTKA 1N8OB 1B0FA 2LNCA 1W11U 1XXOA 1KTTB 3RMNH 1GBFA 2ZTZA 4THNH 3EAAA 1SQOA 2GVFA 2FIRH 1NTPA 3BTKE 3K87A 5EGMA 4KGAA 2F9NA 1S0QA 1QJ7B 1KXDA 3F3BA 3MNXA 3M35A 5A2MH 2ANMH 3ZV9A 1GMCF 1F5RA 2W3IA 2QE7D 3T26A 1Y3XA 4IN2A 4P00A 5EXNA 1S0RA 2PWXA 1CGHA 3SNEA 2Z3EA 4X2XA 3IITA 1TAWA 5B6OA 1YYY1 4E7NA 1P2MA 3RM0H 2J38A 1KXFA 2FM2A 1WTHD 1S85A 4FUFA 2QCYA 1AMHA 1GDNA 1HJAC 3UIRA 1FZZA 2UUYA 2ZDNA 1A0LA 1L1JA 2LPRA 2ZGHA 3TNTA 3W1EA 2RCEA 1QL8A 1ZSKA 1TRYA 3SV8A 1YPMH 2D1JA 4ABAA 2IPQX 2R9PA 2C90B 1ELTA 1O34A 1KLTA 1PYTC 3F0PA 3BTFE 1YPGH 5EODA 1VGCB 4ZCNA 2GT7A 1W7GH 2AQ6A 3BPKA 1Y5BT 3GY7A 4D9RA 1QL9A 3VEQB 2ODPA 3ZZAA 2ESTE 4ACAA 3NZIA 1DUAA 1KIGH 2OL5A 4GUXA 3IWMA 1O2XA 4HMSA 1XKAC 1ZLRA 2F43B 2FOMB 4JZIA 2XOKD 1O37A 2J5UA 4NZLA 2KCAA 1HJ8A 2KCPA 2BYAX 1ZHRA 1HLTH 2Q6GA 3TJUA 1NC6A 1B5GH 2WHXA 1HXEH 3RXOA 5F6MA 2J97A 4FU9A 4HTCH 4MPXA 1XVOA 2FOBA 3MHWU 3PTNA 1C1TA 1VJ9U 3ATMA 1J8AA 4GHQA 3R5RA 2E83A 1M9UA 4A1TA 1CHOG 2BY7X 2PKAB 1SHYA 1ZGVA 1TGBA 2ZKSA 2BD4A 4MNYA 1BTZA 8ESTE 1SQTA 1GHBG 2BQ6B 3OSYA 1O2GH 3H5CB 2W7SA 2X1KA 5FCKA 5FPSA 1TOMH 2NWNA 4CHAC 2O8WA 1BRCE 1KDQA 2Z3DA 3RXGA 1DFPA 3VB5A 2ZO3H 1BB0B 4UFGH 1W0YH 4TY7A 4ZHLU 3E91A 1Q3XA 2D38A 1V2PT 2ZFRH 2ALPA 1HAPH 1MKXK 3TLOA 4WXIA 1TY9A 4F07A 1YPHC 2ZTXA 1NBME 1EAUA 3AASA 5F8TA 2O8MA 2A7JA 3O8DA 2W5EA 3LU9B 4X1SU 1S6HA 1SGDE 4NA7A 2XBWA 4TT3D 1E37B 4DIIH 4TSFD 4Q7XA 1HJ9A 2Z9IA 3MTYA 5CHEC 1B7XB 2XC5A 2BOKA 3BG4B 3JZ2B 2OD3B 2UWPA 4JK5A 2V3MA 1FX0B 3SI4H 3E4VA 1WGBA 3BTHE 4UFEH 2BDGA 3SU6A 2NU1E 1G77A 1AFEH 3ZOCA 4VGCB 1DT2A 1XXDA 1QFKH 3OTPA 2IPHA 3EDXB 1DSTA 1BDAA 1ZHMA 1O0DH 4O97A 1DXWA 3BEUA 1AKSA 1XKBC 3F2GA 5TJXA 3TGVA 1HAIH 2O8TA 7GCHF 2YOLA 1DY9A 1O3HA 2IJOB 1FQ3A 3ODDA 3IG6B 5EQSA 5HIYA 1FDPA 1O2KA 3ZZ8A 3EE7A 1HAYB 1YWUA 1GI2A 4ZH8A 3V12A 1C5MD 1RRKA 5GXPA 1XMNB 3HE1A 4LOYH 2JJ1D 1C4V2 1HAHH 4XRNA 1ID5H 1CT0E 2XBYA 1Y3VA 4WMFA 5DO4H 2AMPA 1MABB 4AG1A 4BTIB 4H6TA 2L6OA 1CO7E 2FLBH 1OOKB 1ZJDA 3FZZA 4WMEA 1ZRKA 2G00A 2VWMA 3H09A 1CA0C 1SGTA 3V4HA 2OQ5A 3PWCA 2FDAA 5K0HA 1BMMH 1RFNA 4NIWA 1QIXB 4U01A 2CHAC 4WJG2 3P17H 1C5RA 2A2QH 3E90B 2KCOA 6GCHG 1O2PA 4DG4A 1QBOA 2CXVA 1GBEA 4BAKB 1SSXA 3QDZB 3MWIU 1MH0A 4LXBH 4FVDA 5EW2H 5GCHG 1GHZA 1GI5A 1E1RD 1CGIE 1NROH 1D3PB 5EQQA 4OGXA 4Q63A 2CF8H 3EAJA 4B74A 4ZXYH 2QF5A 3C1KA 3UPEA 3ODFA 4BOHA 2KM0A 3I77A 1DY8A 1HPGA 1PFXC 1YP9A 1ZPZA 2HOBA 4LK4A 1C2EA 3ZIAD 4ASUD 2SNWA 1CU1A 1SOZA 2ZA5A 4KTSA 4X6MA 3O8BA 3MNBA 1TB6H 1TPAE 4I8GA 3LKWA 2WUCA 3RXTA 1EXFA 1K1MA 5A0BA 1WYKA 4Y0YE 4ASHA 1EASA 1SI5H 5AHGH 1V3XA 1FI8A 2ZPSA 3SU2A 1AI8H 4WH6A 1TLDA 1OWKA 2GCHG 3MI4A 1A46H 2BQWB 5EPNA 4DT4A 3LC3A 3RXFA 2EEKA 1NFYA 1FIWA 5C3NA 5DG6A 1YPLH 3RXDA 1EZXC 1LQEA 2AGGX 4D9QA 4KELA 3ZZ6A 1TGCA 2P95A 1SLUB 1NS3A 1Z8GA 4AFSA 2YMSC 1HAXB 2ECRA 1AD8H 1QZ8A 1YPKH 5BPEA 3RLYH 1RZ0A 1K9OE 2FLRH 4X8TH 5JPMH 3VB4A 4HGCA 3V7TA 1AN1E 3A8CA 5I25A 2H5CA 5JB8S 1KTSB 2V7QD 4FXGH 4JYUH 1OPHB 2BVSH 1H8ED 5HGGA 2FPZA 1TA2A 4CH2B 4X1NU 3T2NA 1SC8U 4YWNA 3GDUA 1K1NA 1GJ6A 1MZDA 2OC7A 4Y10E 1O3OA 4AOQA 3S9BA 1BUIA 4O9VA 1MAXA 5GNDA 1AGJA 1IQIA 1UVTH 3ITIA 1GI3A 3AK5A 1GI9B 4BAOB 3UQVA 3JZ1B 1A2CH 3VGCB 1A5HA 1L1NA 1IQNA 3S0NA 1F5KU 3U8RH 2HHZA 4GPGA 3LGVA 2BVRH 2PGBB 4ZUHA 1XUHA 3SO3A 3MQKC 1P12E 1JNWA 3PLBA 1VCWA 3N99A 2SGFE 4D7FA 1DOJA 1A7SA 3ZVBA 1N1LA 4UE7H 3VXFH 2W26A 2C4FH 3TU7H 1I0RA 2R3YA 3SORA 4HKHA 1D3DB 1LDTT 1T8OA 4FUEA 4FETA 3KL6A 1O30A 4M9FA 3WW7A 3P8OA 3GY8A 1NO9H 2J94A 1H8DH 5FCRA 1TMBH 1JWTA 3KF2A 2OK5A 1P2IA 2ZQ1A 1ZJKA 2HQ9A 1C2DA 1J16A 3RXCA 2D8WA 3SN8A 2FS9A 1MTVA 1W13U 5EJZA 1P11E 3MO9A 1EAXA 3EA9A 3D62A 4MDSA 1QRXA 1BMNH 1D4PB 2L74A 3V3MA 1DLKB 1HXFH 1PPEE 6CHAC 3VFEA 3K9XB 1O5DH 5EOKA 1RD3B 7ESTE 1O5BB 4OGYA 3SUDA 4YT7H 1PYTD 4MNVA 5KGOA 1D3QB 2XC4A 3R5ZA 2SGQE 5JBCS 2NU0E 2ARZA 1TGNA 1C2HA 1W10U 1P0SH 2A45B 1ZTLA 1Q31A 3GISB 4IRAA 1ZOMA 1H9HE 1O2RA 2ZHQH 3P92A 4IBLH 4B71A 3QK1A 3TJOA 4J1YA 5KEDA 2FODA 5DP9A 3B23B 4X2YA 2BY5X 3F7EA 5F03A 1MTSA 1F2SE 2ZG0H 1YPEH 2VU8E 1NU9A 1ZTKA 4QT8C 1V2JT 2ZEBA 3QO6A 1TPOA 2CHAB 2XBXA 1LHFH 3F68H 2XNDD 5CHOA 4CRGA 1QGFA 1WDIA 3O8CA 3C27B 5ESBA 1GI1A 1O2OA 4GCHG 3SJ8A 1OYQA 1DUEA 4RT1A 1WUNH 2V3OH 1KYNA 1C2KA 2R0LA 1KXAA 2EI6A 1C2IA 5CE1A 1QB6A 2GT8A 3RXKA 1IOEA 2GUJA 3KQEA 1ELBA 1Z6EA 2AGEX 3KYFA 3AVZA 5GDSH 2GKVE 1C5YB 5E2OA 2BTCE 1ESAA 2F4LA 4X6PA 3ZZ5A 1O2IA 5DP6A 2VIPA 4NGAH 2KZ4A 2OP9A 1L4ZA 2Y82A 2PKSC 1G37A 5GPIB 5HKKD 1UK4A 3SU4A 1YLCA 4Y11E 1QY6A 2I6QA 3TK5A 1G3DA 2PLXA 2HLCA 2BOHB 2CK3D 2BLQA 2GZ9A 3F6UH 1GBLA 2UWOA 5DN6D 2D5MA 1C4U2 3L33A 1P03A 3MO6A 3BG8A 2HNTC 1TABE 1AWHB 2OUAA 1D6WA 2I51A 2BD2A 3E0PB 2P8OB 4CREA 2J98A 4AX9H 1MTNB 2ED4A 3KGPA 3RC5A 4NA9H 4ZKOU 1BTPA 1AZZA 1ELCA 1JIMA 1J9CH 4NIYA 3ATLA 2DE8A 1PPFE 1XM1A 1SFIA 4F49A 4AORA 1RS0A 3ENSB 2B9LA 5HYOA 3ZZDA 3GCHC 1ELAA 1TNKA 1GGDC 1NM6A 1WU1A 2WPDD 4FUHA 4I32A 1UHBA 1ABJH 1EJMA 2CF9H 1GBTA 1RTFB 4NZQA 5LPFA 1UVPA 3ATKA 2IABA 1LVBA 1O3BA 3ATIA 7KMEH 1O2UA 1FY3A 3EE0B 2FZZA 1YGCH 1GMDF 2CGAA 2H6MA 1O2YA 9ESTA 2GZ7A 3PYHA 5JABA 4FOUC 4RKJB 2ZDKA 3BTTE 5E8EH 2TGAA 2GDDA 3OX7U 1AUJA 3M7TA 3QUMP 1EB2A 3DNHA 4GHTA 4O3UA 4YBNA 2P94A 7GCHG 3VB3A 5C1UA 3UUZA 1CT2E 3M7UA 1EP5A 2ZIQH 4ABIA 2VWLA 3ZZ4A 2C8YB 1AFQB 2ZFTA 2ZHWH 1QA0A 1UVSH 2XYAA 4TV4A 3CP7A 1Y3YA 4B2BA 1Z71A 3TH4H 4CBOA 1EATA 1SQRA 5AFYH 1HIAB 3SZNA 1SBWA 1OKXA 5T3HA 3U98H 1O3DA 4Y8YA 2QXIA 3KHVA 1SGPE 1C2GA 4B6FA 2PGQB 2ZCKP 2P93A 3FAOA 4I33A 2AGIX 4MVNA 2STAE 2FWWA 3M5LA 3PMAB 3H7OA 1BTXA 5HM2A 1FLMA 3S9CA 1FAKH 6CHAB 4DIHH 3NK8A 1P9UA 3MMGA 2OBOA 3M3VA 4UFFH 3F2FA 3SNBA 1DICA 1MD8A 3M3TA 3ATWA 4X6NA 5C94A 2HQ7A 3RU4E 1GBAA 1QL7A 2ZU4A 3HKIB 5JBBS 4VGCC 4E06H 3ZODA 1OWEA 2OQUA 1TNGA 2SGEE 2W6ID 1OP2A 2ZDMA 4ABBA 4XOJA 2R2MB 1C5LH 2Y7ZA 1C1SA 3BV9B 1S82A 4IC6A 1COWD 2IOTA 1ZMNA 3R0FA 1N6XA 1ZSJA 1O3PB 2G5NA 3SV9A 1O3KA 2QA9E 4D7GA 1FLEE 1A3EH 1IQHA 1IQMA 1KSNA 1YF4A 2FESH 2XCFA 2W6JD 2A5AA 3NPSA 3EA7A 3VXEH 1BRAA 4YXWD 2OC8A 3CENA 1C1UH 1THSH 3R5WA 1BRUP 3MNSA 2GV6A 1CA8B 5AF9H 5BRRE 4Q7ZA 2Z9JA 2YMSD 1OP8A 2AIQA 1C2LA 1LPKB 2LP6A 1BIOA 1RZ1A 1Z8IB 2ZI2H 1TRMA 1DXPA 2M5TA 1MKWH 1TGSZ 1C5UA 2BXUH 3LDXH 4NSVA 1OWIA 3SV6A 5EIYA 1CQQA 5EXMA 3QLPH 4A6LA 1EOLA 2R3UA 2HTDA 8GCHF 2A2XH 1W3RA 5T6FA 4B73A 2FOGA 3HK3B 2VVVA 1C1NA 1ANDA 1O39A 5AFZH 3OU0A 3UR6A 1ANEA 2Z9KA 2PKSB 3GCNA 2YNBA 4E05H 5L30H 1NFWA 1V2NT 4U32A 4BXSA 2K0QA 5CHBA 2WYGA 3E16B 5GWZA 1AB9C 3RC6A 2BXTH 1RJXB 2BQ7B 4MNXA 3R5LA 4BTUB 3E1XB 3RXPA 2F9VA 2ZFSA 2HALA 4KTCA 1D3TB 2Y81A 3T25A 2ZFFH 5PTPA 1YLDA 1HAVA 1IQKA 3VY5A 3DCLA 5E0JA 1UJ1A 1W8BH 1JIRA 5FBIA 4YOJA 5EU8A 1GMHF 1O2QA 1TOCB 1THRH 1O3AA 3P8GA 3LH1A 1SGEE 2HRVA 1EUFA 4GLYA 1G78A 4Y0ZE 1AE5A 1V2VT 3D65E 3SV7A 2O8LA 1BJUA 3GCHB 3DUXH 3WY8A 1GGDB 1MZAA 2PP6A 2ZZUH 4O03A 4RKOB 2Z6BD 1O3FA 1PPHE 2QXGA 2V6NA 2AH4X 5LH8A 4DGJA 1P8VC 2GGVB 2F9BH 2ZWLH 3UY9A 3SU1A 2W7UA 1MCVA 2OBQA 3ZVGA 5DK1A 3NKKA 1HAOH 2ANWA 1KLIH 4AB9A 3DSPA 1FPHH 3HMZA 1GJCB 3BTDE 3A7TA 4Y8ZA 1GVZA 1K1OA 4DOQA 1DE7H 1THPB 1W0JD 1B0EA 1HRTH 2D26C 4HMVA 1TA6A 1EOJA 4OM9A 2VB0A 5CHAC 4AB8A 1GI8B 4NFFA 2PW8H 1YCPM 1UTMA 1YPHE 3FOAA 3U8OH 4A7IB 2FURA 3TK9A 4H6SB 4ABJA 4Y79A 2FP7B 3DMBA 2BDAA 1TALA 1C1QA 4ZKYA 3TJNA 5EG4A 1EPTA 3M5OA 2Y7XA 3SQHE 1XVMA 2EQNA 4HG6A 1FN6A 4ISNA 1NN6A 1GDQA 4HMXA 1TMTH 1DVAH 1SLXB 5BNCA 1EZQA 4F48B 1SGYE 2ZGJA 3UNQA 1CHGA 1BT7A 1GHAF 1H1BA 6ESTA 1CGJE 2CV3A 3NWUA 2EI7A 1EKBB 3HGPA 4XBBA 3VGCC 2ZU1A 3LT3A 2TGTA 4INKA 4RN6A 5F53A 3K2UA 1GBIA 1Z1JA 2ZGBH 2VVUA 1AO5A 3OY5U 1MQ5A 1GPZA 3A89A 4WMDA 1HCGA 4YESB 1C5WB 4Z0KA 2JETB 1VCPA 4H4FA 1A61H 2OU5A 3CP3A 5C0UA 2M2AA 2XNIA 3QTVH 1ORFA 1G3CA 3QZQA 2H9HA 3GS9A 1GJ5H 1C5ZB 2G5VA 3KCGH 3BEFB 3NCLA 5G4BA 4B75A 4NWLA 2KR7A 1UW7A 4ISIH 4XD7D 2ECUA 1LTOA 1GDUA 3D23A 3RXLA 2BY8X 1UTPA 4CRBA 4FUIA 4XJ2A 1O5GH 1S81A 2VWNA 1UK2A 4B2AA 2G81E 2Y5GA 3B9FH 2BDBA 3SGAE 4Z6AH 4R8TB 3RP2A 1C1VH 1VZQH 1P2OA 3GASA 4MTBA 1ZPBA 1W0KD 1O36A 2UUKB 3B5MA 1C1OA 4HMWA 1SMFE 4Q4LA 3QX5H 2H2ZA 1FJSA 1FXYA 5H4IB 1G3EA 1P04A 1ZPCA 4A5TS 5LPEA 4BAHB 1V2MT 4FUGA 2A7HA 3M5MA 3TK6A 4GAWA 1LHDH 3FN8A 3RXRA 2BD9A 1LVYA 4JCNA 2ASUB 1O3LA 1W3QA 1MAYA 1TNIA 1TPPA 3BTME 2FX4A 1P02A 1H8IH 2ZFQH 3I29A 4FUJA 2OTVA 1YCPH 5DJ7A 1D6RA 3V13A 1OWHA 4IW4E 3PV4A 1W2KH 1AB9B 5HMAA 1PQ8A 3PRBA 4YOGA 1O3GA 2K8IA 1LVOA 1XUJA 1F0UA 1H9LB 4FUDA 2KFWA 2A31A 1CSOE 1G2LA 2HGTH 3GY6A 2RA3A 3VY2A 1OWJA 1C5VA 1GMDG 3NUMA 3S9AA 1ELVA 2A32A 1DLEA 3BTGE 3K6ZA 1JRSA 3QZRA 5DSFA 2OC0A 3H96A 1LMWB 2A4RA 4OS2A 3RU4T 1QHRB 3BIVH 1EJEA 4X6OA 2PUQH 4BANB 1MUEB 4AN7A 4WXVA 3L6PA 3K6YA 2JH5D 3SZEA 2OINA 3RXQA 3U1IB 2ZDVH 1HNEE 2VIDA 4XSKU 3KQBA 3ZVFA 2ZTYA 3F0OA 1SLWB 1U6QA 2Y5HA 3LGIA 1ZYOA 3TITA 1GL1A 1O31A 3UREA 2FOCA 4ZKRU 3T62A 4D76A 1SOTA 2P8OC 1MKWK 1MTNC 2K1QA 2FG9A 3LOXA 1S6LA 3SU3A 2ANYA 2JDID 2QXHA 5CHAB 4D8NA 3EQ0H 1XUFA 1V6DA 3QN7A 1Q2WA 2GD4B 3DD2H 2XBVA 4OS4A 3WWBA 3FP6E 2BZAA 1O3EA 1BMFD 1RGQA 3SBKA 5T6DA 1A5GH 3AW1A 2GDEH 3LIWA 1O2MA 2ZDAH 2WPLS 3BN9A 2FTMA 4HI3A 2Z7FE 5I46H 1QNJA 4LZ4B 3TPIZ 1IQFA 3BTEE 2ZU3A 3U5WA 2Y5FA 1EX3A 1TYNA 3RC4A 1ELGA 4NIXA 3RXJA 1T8LA 3TGKE 3GCTG 2HVXA 1VKYA 3QGJA 1BHXF 1IQLA 2BVXH 2TPIZ 3KN2A 4Q7YA 1W12U 2QF3A 5DP7A 1BA8B 3A7VA 2BZ6H 3EGKH 3RMLH 1QRZA 2RG3A 3MH4A 2O8UA 4B6EA 1AFQC 4DY7B 1A1RA 3HGNA 1NFUA 3K88A 3NXPA 2Z94A 4NIVA 1OXGA 1TPSA 1A3BH 2ZGCA 4HZHA 2QV1A 5JDUB 1G32B 3URDA 1EP6A 1ZMLA 2V0BA 2NR4A 1TNJA 1KDQB 1GMCG 1FN8A 8GCHG 3DB0A 4ABEA 3RXVA 2PTNA 1SGFG 3BSQA 4YLUA 2VGCB 5F8ZA 4ISOA 2J2UA 2NU2E 1QJ6B 1NT1A 1AY6H 1YOAA 3PMHB 1AVWA 2BLVA 3BF6H 1ZTJA 3CS7A 3OTJE 1P09A 1K22H 4XBDA 2I02A 3U34A 1LQDB 1CHOF 3MNCA 3QGNB 1TWXB 1ZRBA 3RM2H 1JRTA 1Z8RA 1P3CA 3TH2H 4PROA 1DANH 3ZVAA 2AHME 2VPAA 1FUJA 2X1JA 1EAIA 1SG8B 1ETSH 3ZVCA 3ZZCA 1OX1A 2UWLA 3RMMH 1TBZH 1ESTA 2YNAA 1W3OA 3U0IA 1ZHPA 2PSXA 1GMHG 3DA9B 1K1IA 1IQGA 3MH7A 4WVPE 3U1JB 1Y8TA 3LGYA 3MH5A 3TNSA 1AKSB 2H9EH 4K69A 3T27A 4SGBE 3WWFA 2F9PA 1GBJA 3K65B 1V2WT 4FU7A 3A84A 3SYJA 1C5TA 2W3KA 2WV4A 4AGKA 2WPIS 3Q77A 3TGIE 1T32A 2ZNKH 4K1EA 3LONA 2XCNA 2P3FH 4YLQH 2BD5A 4AC9A 1CVWH 5FX5A 5JYIA 2HNTE 2BY6X 4U2WA 1QQ4A 3AWHA 2ZFPH 1SGNE 1W0ZU 1HGTH 3PFTA 1BBRE 2FS8A 3PWBA 4ZHAA 1GBHA 1MBMA 2HWLB 2TIOA 4NG9H 1TX6A 4AYVB 5DKMA 3R5PA 2SFAA 4INLA 5C1XA 1Z1IA 3P70B 1NFXA 1VITF 3D49H 3E6PH 3NFWA 4K1TA 2ULLA 3H7TA 3OEED 1OWDA 1SVPA 1AHTH 2TGPZ 5E0HA 3UB0A 8KME2 3O8RA 2DUCA 3MFJA 2A0QB 3GY4A 4L82A 3UTUH 1C4Y2 2A5IA 1K2I1 3LGTA 3AAUA 3GYLB 4NCYA 2WSSD 1TNLA 3A7WA 1AVXA 4AZ2B 3A85A 1CT4E 1QB1A 1VITH 4Z1MD 3KYGA 1G30B 1UVUH 2PKAA 3A7XA 3S7KB 4R0IA 4JZDH 1RFEA 3S69A 3FANA 3A8BA 1T9MA 1YCPK 3A82A 3U69H 1P57B 4ACBA 1NRQH 5KECA 1S5SA 5ETXA 5JB9S 4I8JA 5TCAA 4JZ1A 2RFKC 2HNTF 1WQSA 1VCQA 1NBMD 5JBAS 4F4OC 1C2JA 1C5QA 3SW2B 2BX4A 1RIWC 1QTFA 4Y6DA 4XBCA 2VWOA 3P8FA 3OY6U 3SJ9A 4Y71A 1BTUA 3SUFA 2Q6DA 1BOQA 1C5PA 2FO9A 3HY8A 4K3JA 3UQOA 3PO1C 1XUKA 2GP9B 1QA7A 1Y12A 1O2JA 2P3TB 4BAMB 1F0TA 3HPTB 4BNRA 2QIQA 1H8HD 3G01A 1F5LA 1QCPA 1S6FA 1UTQA 3MU5A 4GSOA 5C0TA 1GVLA 2PTCE 3GYMA 1BBRH 4BXWA 2HPPH 1T8NA 4Z85A 2TBSA 1NY22 2GCTB 2ZGXH 2JIZD 3ZZ9A 3ZOEA 1MU6B 4Y9IA 1XHNA 2KX4A 4IMZA 1XUIA 1ETTH 2A2JA 3GY3A 1LKAA 3ZOHA 2PV9B 3ZVDA 1T8MA 1JBUH 4B1TA 4X8SH 1WCZA 3Q76A 4Y76A 5C1YA 2JKHA 1SGFA 3M7QA 2VIOA 2ASFA 2P5ZX 1OS8A 2JH0D 3MU8A 1QBVH 3TVJB 2ZHFH 3LC5A 2IN2A 2WV5A 1UTOA 3SJOA 2ZHDA 4KKDA 2JETC 1Y59T 1FY8E 4K1SA 1CI0A 3GDVA 4JMYA 3SHAH 2A5KA 1DPOA 1E35B 1USFA 4FUCA 1KLJH 1PPZA 1UCYE 3A80A 1Y3UA 3ZOGA 1A4WH 3AMFA 1LPGB 2ODQA 1V2ST 1Z6JH 4OS6A 4Q2KA 3U28C 4ZMAH 4RI0A 3ZVEA 1OHHD 1PPGE 2BD7A 4O3TA 4XFQA 2FMJA 2SNVA 1ESBA 1NESE 2DE9A 1BTYA 2H5DA 2VIQA 1L1GA 1KXBA 2GZ8A 4WY3A 4TY6A 1GJDB 3RXUA 5C2ZA 2Z9GA 2AIPA 1FNIA 1ACBE 3E8LA 5FPYA 1UVOA 3RXIA 3KEEA 3URCA 1BZXE 1O3MA 1P06A 2GMTB 1UTKA 3BTWE 2VVCA 2C93B 2KAIA 4B76A 1ZGIA 5AVDA 2STBE 2GX4A 1K28D 3OYPA
chains in the Genus database with same CATH topology
1USCA 3R5LA 2OU5A 4RT1A 4XRNA 4YWNA 3CP3A 4RT0A 2RE7A 2VPAA 2FG9A 1NRGA 2X1JA 1WV4A 3VY5A 4HX6A 3FGEA 3RH7A 1G79A 3SWJA 1W3OA 3CB0A 3A20A 3KYFA 3U0IA 2ECUA 3HY8A 4XJ2A 1G78A 2D36A 3R5RA 2E83A 1W9AA 2HHZA 1WLIA 1FLMA 2D37A 4I86A 2PTFA 1JNWA 1W3PA 2Q9KA 5EJLA 2IMLA 1G76A 2QEAA 1XXOA 3GASA 3DSGA 4Z85A 2HQ7A 1I0RA 3B5MA 2X1KA 4HMWA 3ZOEA 2IG6A 2D5MA 4Y9IA 1XHNA 1YLNA 3K87A 3U5WA 3ZODA 2A2JA 1DNLA 1VL7A 3ZOHA 2I51A 3HMZA 4R82A 2ED4A 2D38A 2HQ9A 4P02A 3AWHA 1TY9A 4HMVA 4F07A 5EJZA 5ESCA 3PFTA 1W3QA 2QCKA 2ASFA 2FURA 3IN6A 2HTIA 5EJ1A 2R6VA 1Y30A 3DMBA 2L74A 3R5PA 4ZKYA 1I0SA 4P00A 3R5WA 1CI0A 3NFWA 5CHEC 1USFA 4HMTA 3K88A 2FHQA 2RDEA 4HG6A 5KGOA 3EC6A 2R0XA 3R5ZA 3A6QA 3ZOGA 1RZ1A 2ARZA 3AMFA 4HMXA 2GJGA 1WLKA 3E4VA 1WGBA 2IABA 3K86A 5BNCA 1G77A 4IRAA 3R5YA 2NR4A 3ZOFA 3ZOCA 3VY2A 4F48B 5EIYA 4L82A 5KEDA 3BA3A 3CNRA 3A6RA 3BNKA 4HMUA 2HTDA 3DB0A 1W3RA 1AXJA 3F7EA 4N7RC 5JABA 4FOUC 3H96A 1EJEA 3DNHA 4QVBA 3KYGA 4YBNA 3TGVA 3VYAA 2ECRA 1RFEA 2AQ6A 3U35A 1YOAA 1RZ0A 3BPKA 3FKHA 4XHYA 1T9MA 5CHOA 2I02A 3U34A 5KECA 1YWUA 2OL5A 4HMSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1USC A;  3R5L A;  2OU5 A;  4RT1 A;  4XRN A;  4YWN A;  3CP3 A;  4RT0 A;  2RE7 A;  2VPA A;  2FG9 A;  1NRG A;  2X1J A;  1WV4 A;  3VY5 A;  4HX6 A;  3FGE A;  3RH7 A;  1G79 A;  3SWJ A;  1W3O A;  3CB0 A;  3A20 A;  3KYF A;  3U0I A;  2ECU A;  3HY8 A;  4XJ2 A;  1G78 A;  2D36 A;  3R5R A;  2E83 A;  1W9A A;  2HHZ A;  1WLI A;  1FLM A;  2D37 A;  4I86 A;  2PTF A;  1JNW A;  1W3P A;  2Q9K A;  5EJL A;  2IML A;  1G76 A;  2QEA A;  1XXO A;  3GAS A;  3DSG A;  4Z85 A;  2HQ7 A;  1I0R A;  3B5M A;  2X1K A;  4HMW A;  3ZOE A;  2IG6 A;  2D5M A;  4Y9I A;  1XHN A;  1YLN A;  3K87 A;  3U5W A;  3ZOD A;  2A2J A;  1DNL A;  1VL7 A;  3ZOH A;  2I51 A;  3HMZ A;  4R82 A;  2ED4 A;  2D38 A;  2HQ9 A;  4P02 A;  3AWH A;  1TY9 A;  4HMV A;  4F07 A;  5EJZ A;  5ESC A;  3PFT A;  1W3Q A;  2QCK A;  2ASF A;  2FUR A;  3IN6 A;  2HTI A;  5EJ1 A;  2R6V A;  1Y30 A;  3DMB A;  2L74 A;  3R5P A;  4ZKY A;  1I0S A;  4P00 A;  3R5W A;  1CI0 A;  3NFW A;  5CHE C;  1USF A;  4HMT A;  3K88 A;  2FHQ A;  2RDE A;  4HG6 A;  5KGO A;  3EC6 A;  2R0X A;  3R5Z A;  3A6Q A;  3ZOG A;  1RZ1 A;  2ARZ A;  3AMF A;  4HMX A;  2GJG A;  1WLK A;  3E4V A;  1WGB A;  2IAB A;  3K86 A;  5BNC A;  1G77 A;  4IRA A;  3R5Y A;  2NR4 A;  3ZOF A;  3ZOC A;  3VY2 A;  4F48 B;  5EIY A;  4L82 A;  5KED A;  3BA3 A;  3CNR A;  3A6R A;  3BNK A;  4HMU A;  2HTD A;  3DB0 A;  1W3R A;  1AXJ A;  3F7E A;  4N7R C;  5JAB A;  4FOU C;  3H96 A;  1EJE A;  3DNH A;  4QVB A;  3KYG A;  4YBN A;  3TGV A;  3VYA A;  2ECR A;  1RFE A;  2AQ6 A;  3U35 A;  1YOA A;  1RZ0 A;  3BPK A;  3FKH A;  4XHY A;  1T9M A;  5CHO A;  2I02 A;  3U34 A;  5KEC A;  1YWU A;  2OL5 A;  4HMS A; 
#chains in the Genus database with same CATH topology
 1TON A;  4MG3 A;  1YPJ H;  1O38 A;  1WTG H;  4UD9 H;  2J95 A;  5T6G A;  5K7R A;  4YO9 A;  3EYD A;  1NRG A;  2A4O A;  2OC1 A;  2ZEC A;  1ABI H;  4MLF B;  1G79 A;  1K0H A;  3FVF B;  4A1V A;  3N7E A;  5CDF E;  1O2L A;  2QYI A;  1BTH H;  1J14 A;  2XWA A;  1QUR H;  1WAY B;  1EB1 H;  1ZMJ A;  3QWC H;  1C5N H;  4JK6 A;  4CRA A;  2D37 A;  3SOS A;  1WQV H;  5EQR A;  5T1V A;  1K1P A;  1W3P A;  2HLD D;  3VB7 A;  2Q9K A;  1PPC E;  1PQ7 A;  2G8T A;  2RDL A;  1HFD A;  2QEA A;  1O2S A;  2XRC A;  4X1Q U;  4H42 U;  2QAA A;  3LJO A;  4YM9 A;  2TGD A;  2C3S A;  2PHB A;  2IG6 A;  1GJA B;  1C2M A;  1XUG A;  2BLO A;  1GWA A;  1Z8J B;  2FI3 E;  3FZD A;  2I6S A;  5E2P A;  3UOU A;  2WPM S;  1UCY H;  1GBK A;  1P2K A;  4P02 A;  2BDY A;  2QY0 B;  2QN5 T;  4UHV A;  3RMO H;  1O2V A;  1ELE E;  1BRB E;  1XX9 A;  3SHC H;  5A8Z A;  2H1U A;  2HTI A;  2G52 A;  5EJ1 A;  5B6L A;  1SHH B;  2F83 A;  4IS5 A;  3GY5 A;  1I0S A;  1K1J A;  2EC9 H;  3MU0 A;  2PUX B;  1K21 H;  2QXJ A;  1O3J A;  1J15 A;  5DGJ A;  1DWB H;  5ABW A;  4NFE A;  2PFE A;  1GI4 A;  3RXA A;  1WLK A;  1RIW B;  5J4S A;  3K86 A;  4IGD A;  3A81 A;  4GCH F;  1DSU A;  1F7Z A;  4AFU A;  1C1R A;  5L2Z H;  3Q3X A;  4AGJ A;  3BNK A;  1IAU A;  4K8Y A;  3EST A;  3KQC A;  1AXJ A;  3ELA H;  2ZU5 A;  3PV5 A;  1A0H B;  2J98 B;  4I8L A;  4X0W U;  1QR3 E;  6LPR A;  1DM4 B;  3GY2 A;  1G36 A;  1ZZZ A;  3PO1 B;  4DT7 B;  4QVB A;  1GJ7 B;  5LPR A;  1P01 A;  1GL0 E;  4MPU A;  3FKH A;  2H9T H;  5A09 A;  2CN0 H;  4I31 A;  2FI5 E;  2ZC9 H;  1O2T A;  5FBE A;  3SUE A;  1ARB A;  4CRF A;  2QF4 A;  4OS5 A;  1P2N A;  1CBW C;  2FTL E;  2G4U A;  3FP7 E;  5FAH A;  1WBG B;  4ZKS U;  2BDH A;  1O32 A;  1UHB B;  2PSY A;  1PPB H;  3A8D A;  2VIN A;  1GCT C;  2R2W U;  2RE7 A;  1C9P A;  1Y5U T;  1GHY H;  2Z9L A;  2JJ2 D;  1GG6 B;  4F55 A;  3MYW A;  1SFQ B;  3RH7 A;  2VIW A;  1GI6 A;  1DWE H;  2BM2 A;  2WV9 A;  3T5F H;  3SJI A;  4Q80 A;  5L2Y H;  3M37 A;  2THF B;  1GJ9 B;  5EPY A;  3KNX A;  3DHK H;  5IDK A;  2WIN I;  1KXE A;  1F0S A;  2SGD E;  1BCU H;  1SKY E;  4FU8 A;  5SGA E;  3DFJ A;  2QGR A;  1EPT C;  1T31 A;  1UK3 A;  1FPC H;  3F9H A;  1QRW A;  2OLG A;  2WYJ A;  1N6Y A;  1SGQ E;  8LPR A;  3PTB A;  1AE8 H;  4MPV A;  4K2Y A;  1KXC A;  1EZU C;  5IK2 D;  1TQ7 B;  4K8B A;  2VGC C;  1NPM A;  1O3N A;  2JH6 D;  3OAA D;  3PM3 A;  4X8U H;  3ZZ7 A;  2QCK A;  3FO8 D;  1F92 A;  4AG2 A;  2R0K A;  3SUG A;  1KY9 A;  1WSS H;  2BDI A;  3A7Y A;  4JZF H;  1GCD A;  1DX5 M;  1VIT G;  2J9N A;  3UNS A;  4XE4 A;  4X2W A;  1BJV A;  3EC6 A;  1BBR K;  2XC0 A;  2R0X A;  1SLV B;  3PRO A;  2ILN A;  1C1M A;  1V2K T;  5TCC A;  1SR5 C;  1G3B A;  1SQA A;  3ZOF A;  2K4Q A;  3W94 A;  1ELF A;  3A6R A;  1BQY A;  2FEQ H;  1GHV H;  5JBT A;  2UUF B;  2A4Q A;  4X1P U;  1FMG A;  2BDC A;  2BY9 X;  2BD8 A;  4X8V H;  4DW2 U;  2QC2 A;  3TIU A;  4ISL A;  1P2Q A;  2HPQ H;  1UMA H;  1NRP H;  2ZCH P;  3ZZ3 A;  3N7O A;  2FYR A;  2A7C A;  2BB4 A;  3PLK A;  2V35 A;  1F0R A;  3DFL A;  2A1D B;  2F9O A;  2TRM A;  4ZHM U;  1DIT H;  4A92 A;  5J4Q A;  5HM9 A;  1S84 A;  9LPR A;  1NU7 B;  5EXL A;  5EW1 H;  2D2D A;  2KAI B;  2G4T A;  3A86 A;  1HJA B;  5FPT A;  2VJ1 A;  3LGW A;  5DP3 A;  4MNW A;  1EJA A;  3U8T H;  5A0A E;  1LO6 A;  2ZCL P;  4WH8 A;  1MTW A;  1O2Z A;  4W64 A;  1OYT H;  2VH6 A;  1WOF A;  3LPR A;  3HK6 B;  2J34 A;  1JMO H;  1GBC A;  1P9S A;  1LKB A;  3UOP A;  5C17 A;  2C8X B;  4K5Z A;  3RXS A;  5C5O A;  2SGA A;  3TJV A;  2PTF A;  1HAZ B;  1IHT H;  2AMQ A;  1HAG E;  5EJL A;  1DWD H;  3SJK A;  4ZRO A;  1EZS C;  1LHE H;  1G76 A;  1W3C A;  3ZYE A;  5A8X A;  1FY5 A;  1L4D A;  4ISH H;  1SGI B;  1SB1 H;  2F91 A;  3RUO A;  5DP4 A;  1L0Z A;  3Q3K A;  3F2H A;  4JYT A;  3OFN D;  4CBN A;  1HAV B;  1TX7 A;  1ZR0 A;  1GBB A;  1TBQ H;  3UFA A;  3TGJ E;  1P3E A;  2B8O H;  4J2Y B;  1K1L A;  3E0N B;  2B5T B;  1YY3 A;  3BTQ E;  4ZXX H;  2ODY B;  2R6V A;  1GVK B;  4CR9 A;  1W14 U;  3GCO A;  5DP5 A;  3SV2 H;  4DVA U;  2GV7 A;  1CBW B;  1AQ7 A;  1C2F A;  1YC0 A;  1GHW H;  3SU5 A;  2FHQ A;  4HFP B;  3RLW H;  2RDE A;  3RXE A;  1S83 A;  4UFD H;  1O2W A;  1MBQ A;  2AEI H;  1GCT B;  2GTB A;  5FX6 A;  1HIA A;  5HXF A;  3RDZ A;  2CMY A;  1RXP A;  3R5Y A;  1NRR H;  4CHA B;  3VB6 A;  1BTW A;  1V2R T;  1QB9 A;  1FIZ A;  3CNR A;  4HMU A;  3FFG A;  1RTK A;  4EST E;  1UCY K;  3M5N A;  4N7R C;  1TE0 A;  1IQJ A;  1MMJ N;  3RU4 D;  1L2E A;  1DS2 E;  3PMB B;  4KTU A;  5F8X A;  4INH A;  3VYA A;  4NWK A;  2V3H H;  1ARC A;  1PQA A;  2RA0 A;  3N7D A;  3SND A;  4XHY A;  1E36 B;  1HUT H;  5DP8 A;  1BMA A;  5EST E;  3STJ A;  2BX3 A;  5C67 A;  1C5X B;  1EPT B;  2GCT C;  4I8K A;  4Y7A A;  4CR5 A;  2WPH S;  2AS9 A;  4ABG A;  2FOF A;  4UEH H;  1Y3W A;  3M36 A;  3SNC A;  2L1T A;  2ANK H;  4ZKN U;  4LZ1 H;  4DUR A;  3LH3 A;  1GBD A;  1PJP A;  4M7G A;  1LCY A;  2KCY A;  1TQ0 B;  2IJD 1;  3PRD A;  2J92 A;  3SQE E;  3GIC B;  1WV4 A;  4KP0 A;  3FP8 E;  4HX6 A;  1EQ9 A;  1KMH B;  4CH8 B;  2XTT B;  1CE5 A;  3U9A H;  3P8N A;  4AFQ A;  1ELD E;  1EAW A;  1A0J A;  2F3C E;  3LJJ A;  3VG8 A;  2ALV A;  4ZAE A;  2ZPQ A;  1V2Q T;  2WPJ S;  4YOI A;  2FXR A;  3PB1 E;  4JZE H;  3A8A A;  4XDE A;  2NU4 E;  1GHB F;  2VH0 A;  4I7Y H;  1V2O T;  5C20 A;  2ZHE H;  3UWJ H;  1O5C B;  1BML A;  2FOH A;  1MTU A;  2C8Z B;  2SGP E;  1YLN A;  1P05 A;  3UR9 A;  1DNL A;  1G2M A;  4Y7B A;  1MD7 A;  4R82 A;  1E38 B;  3CS0 A;  2AMD A;  1TBR H;  2P59 A;  1WXR A;  5A8Y A;  3P6Z B;  2BHG A;  1GJB B;  1SGC A;  4TPI Z;  3E3T A;  4B2C A;  2LEL A;  1E0F D;  3T29 A;  2FYQ A;  1RTL A;  4GVU A;  1D9I A;  3T28 A;  1CA0 B;  1HDT H;  1OP0 A;  3P95 A;  4RSP A;  2AFQ B;  2GMT C;  4YTA A;  1AVG H;  1UTN A;  4FUB A;  1HBT H;  1ANC A;  1MCT A;  4I8H A;  3MH6 A;  1O5E H;  3HKJ B;  5GIB A;  2P16 A;  4HMT A;  3GOV B;  1O3C A;  4X1R U;  1IQE A;  2AER H;  1N8O C;  1O2N A;  3MU4 A;  1MQ6 A;  3S7H B;  3A6Q A;  3MO3 A;  2OXS A;  3M3S A;  5L6N H;  1Y5A T;  1IHS H;  1DDJ A;  1SL3 A;  3SNA A;  3OEH D;  1ANB A;  3I78 A;  1UO6 A;  2J4I A;  2F9U A;  5C5N A;  1FV9 A;  1VJA U;  2Y80 A;  2ZQ2 A;  1FY1 A;  3A88 A;  3SU0 A;  4A1X A;  1TX8 A;  7LPR A;  4WWY A;  1GI0 A;  5GJ4 B;  3MU1 A;  4DCD A;  1NRS H;  3F9G A;  1ETR H;  3NRL A;  1YM0 A;  1GJ4 H;  2Q6F A;  3F1S B;  2B7D H;  4JYV H;  4MPW A;  1GI7 B;  4NA8 A;  3RXH A;  1AZ8 A;  3EA8 A;  3PMJ A;  1C5S A;  1LVM A;  2P3U B;  1O5F H;  2FX6 A;  4IC5 A;  1J17 T;  1C1W H;  1LPZ B;  4FVB A;  4UDW H;  2Y6T A;  1GHA G;  4U30 A;  3UNR A;  3KQD A;  2WUB A;  1LHC H;  1EFR D;  4ABH A;  1FY4 A;  5FHT A;  2OCV B;  1FON A;  3SGB E;  1MKX H;  3ZV8 A;  4TWW A;  2G55 A;  3LGU A;  3SWJ A;  3A20 A;  4DJZ B;  3STI A;  4ABD A;  1G9I E;  1P10 A;  4BAQ B;  1W9A A;  3BIU H;  1VGC C;  3B8J A;  1WLI A;  2YMS B;  4X2V A;  1DWC H;  4UON A;  2ZU2 A;  2VNT A;  3MOC A;  1Z7K A;  4E7R G;  3M61 U;  2ZP0 H;  6GCH F;  1AU8 A;  1BHX B;  2PR3 A;  2IML A;  2XXL A;  3A7Z A;  1V2T T;  1V2U T;  3DSG A;  1T7C A;  2BD3 A;  2BMG B;  5GCH F;  2QF0 A;  3HAT H;  1VR1 H;  5E0G A;  5FXL A;  1V2L T;  1QBN A;  1INC A;  3DSO A;  2CJI A;  1VL7 A;  1JXP A;  1PQ5 A;  3Q3Y A;  1E79 D;  3FKS D;  4WF8 A;  1GBM A;  1GHX H;  1BIT A;  3SGQ E;  1SGR E;  5ESC A;  2BLW A;  1AIX H;  2VIV A;  2O9Q A;  3OE7 D;  2G51 A;  3AW0 A;  1NRN H;  3IN6 A;  4TPY A;  3KQ5 A;  3A87 A;  4AFZ A;  1WV7 H;  1Y30 A;  1T4V H;  3ZYD A;  1HB0 B;  1T4U H;  4OS7 A;  3TH3 H;  1H4W A;  1O35 A;  3V0X A;  1X7A C;  1AUT C;  2EI8 A;  2Z3C A;  2WPK S;  2FOE A;  2GCH F;  2Q1J A;  4ABF A;  2GJG A;  1HYL A;  1TNH A;  5A0C A;  4BTT B;  1H9I E;  1TIO A;  4YT6 H;  4TWY A;  2NU3 E;  3PLP A;  3L3T A;  1GG6 C;  1YKT A;  1AWF H;  3GDS A;  3BA3 A;  4YZU A;  3UWI A;  3W95 A;  2A4G A;  4CRC A;  5LGO A;  1QJ1 B;  3A83 A;  2HVY B;  2ZPR A;  1P2J A;  3F9F A;  3DT0 H;  1FAX A;  1QQU A;  4Y8X A;  2FOA A;  4NSY A;  5FL7 D;  1MU8 B;  1E34 B;  5CMX H;  2ZDL A;  2WZQ A;  2UUJ B;  1EJN A;  2ZF0 H;  5IYT A;  3U35 A;  1TRN A;  5HIZ A;  4OS1 A;  2AYW A;  1TFX A;  4K60 A;  1JOU B;  3KID U;  1HV7 A;  1UTL M;  3RXB A;  4SGA E;  3RXM A;  4CRD A;  1E1Q D;  1W7X H;  3BG4 C;  1USC A;  2EY4 C;  4RT0 A;  1SPJ A;  1C5O H;  3QTO H;  1C1P A;  1TMU H;  3VPK A;  3ZZB A;  1O33 A;  3FGE A;  2XWB I;  5DPA A;  3CB0 A;  2B0F A;  2EA3 A;  1TGT A;  3AAV A;  3PV2 A;  1UTJ A;  3UAI C;  4IMQ A;  2XW9 A;  1A5I A;  3Q00 A;  4IN1 A;  1OSS A;  1NZQ H;  3BEI B;  3GCT F;  1LHG H;  2D36 A;  4AYY B;  4TYD A;  1C9T A;  1ZSL A;  2VBC A;  3F9E A;  3SI3 H;  1XXF A;  1YBW A;  4I86 A;  1GJ8 B;  1O2H A;  3R3G B;  4MQA A;  2C8W B;  2FI4 E;  1O5A B;  1O3I A;  4MTK A;  1N8O B;  1B0F A;  2LNC A;  1W11 U;  1XXO A;  1KTT B;  3RMN H;  1GBF A;  2ZTZ A;  4THN H;  3EAA A;  1SQO A;  2GVF A;  2FIR H;  1NTP A;  3BTK E;  3K87 A;  5EGM A;  4KGA A;  2F9N A;  1S0Q A;  1QJ7 B;  1KXD A;  3F3B A;  3MNX A;  3M35 A;  5A2M H;  2ANM H;  3ZV9 A;  1GMC F;  1F5R A;  2W3I A;  2QE7 D;  3T26 A;  1Y3X A;  4IN2 A;  4P00 A;  5EXN A;  1S0R A;  2PWX A;  1CGH A;  3SNE A;  2Z3E A;  4X2X A;  3IIT A;  1TAW A;  5B6O A;  1YYY 1;  4E7N A;  1P2M A;  3RM0 H;  2J38 A;  1KXF A;  2FM2 A;  1WTH D;  1S85 A;  4FUF A;  2QCY A;  1AMH A;  1GDN A;  1HJA C;  3UIR A;  1FZZ A;  2UUY A;  2ZDN A;  1A0L A;  1L1J A;  2LPR A;  2ZGH A;  3TNT A;  3W1E A;  2RCE A;  1QL8 A;  1ZSK A;  1TRY A;  3SV8 A;  1YPM H;  2D1J A;  4ABA A;  2IPQ X;  2R9P A;  2C90 B;  1ELT A;  1O34 A;  1KLT A;  1PYT C;  3F0P A;  3BTF E;  1YPG H;  5EOD A;  1VGC B;  4ZCN A;  2GT7 A;  1W7G H;  2AQ6 A;  3BPK A;  1Y5B T;  3GY7 A;  4D9R A;  1QL9 A;  3VEQ B;  2ODP A;  3ZZA A;  2EST E;  4ACA A;  3NZI A;  1DUA A;  1KIG H;  2OL5 A;  4GUX A;  3IWM A;  1O2X A;  4HMS A;  1XKA C;  1ZLR A;  2F43 B;  2FOM B;  4JZI A;  2XOK D;  1O37 A;  2J5U A;  4NZL A;  2KCA A;  1HJ8 A;  2KCP A;  2BYA X;  1ZHR A;  1HLT H;  2Q6G A;  3TJU A;  1NC6 A;  1B5G H;  2WHX A;  1HXE H;  3RXO A;  5F6M A;  2J97 A;  4FU9 A;  4HTC H;  4MPX A;  1XVO A;  2FOB A;  3MHW U;  3PTN A;  1C1T A;  1VJ9 U;  3ATM A;  1J8A A;  4GHQ A;  3R5R A;  2E83 A;  1M9U A;  4A1T A;  1CHO G;  2BY7 X;  2PKA B;  1SHY A;  1ZGV A;  1TGB A;  2ZKS A;  2BD4 A;  4MNY A;  1BTZ A;  8EST E;  1SQT A;  1GHB G;  2BQ6 B;  3OSY A;  1O2G H;  3H5C B;  2W7S A;  2X1K A;  5FCK A;  5FPS A;  1TOM H;  2NWN A;  4CHA C;  2O8W A;  1BRC E;  1KDQ A;  2Z3D A;  3RXG A;  1DFP A;  3VB5 A;  2ZO3 H;  1BB0 B;  4UFG H;  1W0Y H;  4TY7 A;  4ZHL U;  3E91 A;  1Q3X A;  2D38 A;  1V2P T;  2ZFR H;  2ALP A;  1HAP H;  1MKX K;  3TLO A;  4WXI A;  1TY9 A;  4F07 A;  1YPH C;  2ZTX A;  1NBM E;  1EAU A;  3AAS A;  5F8T A;  2O8M A;  2A7J A;  3O8D A;  2W5E A;  3LU9 B;  4X1S U;  1S6H A;  1SGD E;  4NA7 A;  2XBW A;  4TT3 D;  1E37 B;  4DII H;  4TSF D;  4Q7X A;  1HJ9 A;  2Z9I A;  3MTY A;  5CHE C;  1B7X B;  2XC5 A;  2BOK A;  3BG4 B;  3JZ2 B;  2OD3 B;  2UWP A;  4JK5 A;  2V3M A;  1FX0 B;  3SI4 H;  3E4V A;  1WGB A;  3BTH E;  4UFE H;  2BDG A;  3SU6 A;  2NU1 E;  1G77 A;  1AFE H;  3ZOC A;  4VGC B;  1DT2 A;  1XXD A;  1QFK H;  3OTP A;  2IPH A;  3EDX B;  1DST A;  1BDA A;  1ZHM A;  1O0D H;  4O97 A;  1DXW A;  3BEU A;  1AKS A;  1XKB C;  3F2G A;  5TJX A;  3TGV A;  1HAI H;  2O8T A;  7GCH F;  2YOL A;  1DY9 A;  1O3H A;  2IJO B;  1FQ3 A;  3ODD A;  3IG6 B;  5EQS A;  5HIY A;  1FDP A;  1O2K A;  3ZZ8 A;  3EE7 A;  1HAY B;  1YWU A;  1GI2 A;  4ZH8 A;  3V12 A;  1C5M D;  1RRK A;  5GXP A;  1XMN B;  3HE1 A;  4LOY H;  2JJ1 D;  1C4V 2;  1HAH H;  4XRN A;  1ID5 H;  1CT0 E;  2XBY A;  1Y3V A;  4WMF A;  5DO4 H;  2AMP A;  1MAB B;  4AG1 A;  4BTI B;  4H6T A;  2L6O A;  1CO7 E;  2FLB H;  1OOK B;  1ZJD A;  3FZZ A;  4WME A;  1ZRK A;  2G00 A;  2VWM A;  3H09 A;  1CA0 C;  1SGT A;  3V4H A;  2OQ5 A;  3PWC A;  2FDA A;  5K0H A;  1BMM H;  1RFN A;  4NIW A;  1QIX B;  4U01 A;  2CHA C;  4WJG 2;  3P17 H;  1C5R A;  2A2Q H;  3E90 B;  2KCO A;  6GCH G;  1O2P A;  4DG4 A;  1QBO A;  2CXV A;  1GBE A;  4BAK B;  1SSX A;  3QDZ B;  3MWI U;  1MH0 A;  4LXB H;  4FVD A;  5EW2 H;  5GCH G;  1GHZ A;  1GI5 A;  1E1R D;  1CGI E;  1NRO H;  1D3P B;  5EQQ A;  4OGX A;  4Q63 A;  2CF8 H;  3EAJ A;  4B74 A;  4ZXY H;  2QF5 A;  3C1K A;  3UPE A;  3ODF A;  4BOH A;  2KM0 A;  3I77 A;  1DY8 A;  1HPG A;  1PFX C;  1YP9 A;  1ZPZ A;  2HOB A;  4LK4 A;  1C2E A;  3ZIA D;  4ASU D;  2SNW A;  1CU1 A;  1SOZ A;  2ZA5 A;  4KTS A;  4X6M A;  3O8B A;  3MNB A;  1TB6 H;  1TPA E;  4I8G A;  3LKW A;  2WUC A;  3RXT A;  1EXF A;  1K1M A;  5A0B A;  1WYK A;  4Y0Y E;  4ASH A;  1EAS A;  1SI5 H;  5AHG H;  1V3X A;  1FI8 A;  2ZPS A;  3SU2 A;  1AI8 H;  4WH6 A;  1TLD A;  1OWK A;  2GCH G;  3MI4 A;  1A46 H;  2BQW B;  5EPN A;  4DT4 A;  3LC3 A;  3RXF A;  2EEK A;  1NFY A;  1FIW A;  5C3N A;  5DG6 A;  1YPL H;  3RXD A;  1EZX C;  1LQE A;  2AGG X;  4D9Q A;  4KEL A;  3ZZ6 A;  1TGC A;  2P95 A;  1SLU B;  1NS3 A;  1Z8G A;  4AFS A;  2YMS C;  1HAX B;  2ECR A;  1AD8 H;  1QZ8 A;  1YPK H;  5BPE A;  3RLY H;  1RZ0 A;  1K9O E;  2FLR H;  4X8T H;  5JPM H;  3VB4 A;  4HGC A;  3V7T A;  1AN1 E;  3A8C A;  5I25 A;  2H5C A;  5JB8 S;  1KTS B;  2V7Q D;  4FXG H;  4JYU H;  1OPH B;  2BVS H;  1H8E D;  5HGG A;  2FPZ A;  1TA2 A;  4CH2 B;  4X1N U;  3T2N A;  1SC8 U;  4YWN A;  3GDU A;  1K1N A;  1GJ6 A;  1MZD A;  2OC7 A;  4Y10 E;  1O3O A;  4AOQ A;  3S9B A;  1BUI A;  4O9V A;  1MAX A;  5GND A;  1AGJ A;  1IQI A;  1UVT H;  3ITI A;  1GI3 A;  3AK5 A;  1GI9 B;  4BAO B;  3UQV A;  3JZ1 B;  1A2C H;  3VGC B;  1A5H A;  1L1N A;  1IQN A;  3S0N A;  1F5K U;  3U8R H;  2HHZ A;  4GPG A;  3LGV A;  2BVR H;  2PGB B;  4ZUH A;  1XUH A;  3SO3 A;  3MQK C;  1P12 E;  1JNW A;  3PLB A;  1VCW A;  3N99 A;  2SGF E;  4D7F A;  1DOJ A;  1A7S A;  3ZVB A;  1N1L A;  4UE7 H;  3VXF H;  2W26 A;  2C4F H;  3TU7 H;  1I0R A;  2R3Y A;  3SOR A;  4HKH A;  1D3D B;  1LDT T;  1T8O A;  4FUE A;  4FET A;  3KL6 A;  1O30 A;  4M9F A;  3WW7 A;  3P8O A;  3GY8 A;  1NO9 H;  2J94 A;  1H8D H;  5FCR A;  1TMB H;  1JWT A;  3KF2 A;  2OK5 A;  1P2I A;  2ZQ1 A;  1ZJK A;  2HQ9 A;  1C2D A;  1J16 A;  3RXC A;  2D8W A;  3SN8 A;  2FS9 A;  1MTV A;  1W13 U;  5EJZ A;  1P11 E;  3MO9 A;  1EAX A;  3EA9 A;  3D62 A;  4MDS A;  1QRX A;  1BMN H;  1D4P B;  2L74 A;  3V3M A;  1DLK B;  1HXF H;  1PPE E;  6CHA C;  3VFE A;  3K9X B;  1O5D H;  5EOK A;  1RD3 B;  7EST E;  1O5B B;  4OGY A;  3SUD A;  4YT7 H;  1PYT D;  4MNV A;  5KGO A;  1D3Q B;  2XC4 A;  3R5Z A;  2SGQ E;  5JBC S;  2NU0 E;  2ARZ A;  1TGN A;  1C2H A;  1W10 U;  1P0S H;  2A45 B;  1ZTL A;  1Q31 A;  3GIS B;  4IRA A;  1ZOM A;  1H9H E;  1O2R A;  2ZHQ H;  3P92 A;  4IBL H;  4B71 A;  3QK1 A;  3TJO A;  4J1Y A;  5KED A;  2FOD A;  5DP9 A;  3B23 B;  4X2Y A;  2BY5 X;  3F7E A;  5F03 A;  1MTS A;  1F2S E;  2ZG0 H;  1YPE H;  2VU8 E;  1NU9 A;  1ZTK A;  4QT8 C;  1V2J T;  2ZEB A;  3QO6 A;  1TPO A;  2CHA B;  2XBX A;  1LHF H;  3F68 H;  2XND D;  5CHO A;  4CRG A;  1QGF A;  1WDI A;  3O8C A;  3C27 B;  5ESB A;  1GI1 A;  1O2O A;  4GCH G;  3SJ8 A;  1OYQ A;  1DUE A;  4RT1 A;  1WUN H;  2V3O H;  1KYN A;  1C2K A;  2R0L A;  1KXA A;  2EI6 A;  1C2I A;  5CE1 A;  1QB6 A;  2GT8 A;  3RXK A;  1IOE A;  2GUJ A;  3KQE A;  1ELB A;  1Z6E A;  2AGE X;  3KYF A;  3AVZ A;  5GDS H;  2GKV E;  1C5Y B;  5E2O A;  2BTC E;  1ESA A;  2F4L A;  4X6P A;  3ZZ5 A;  1O2I A;  5DP6 A;  2VIP A;  4NGA H;  2KZ4 A;  2OP9 A;  1L4Z A;  2Y82 A;  2PKS C;  1G37 A;  5GPI B;  5HKK D;  1UK4 A;  3SU4 A;  1YLC A;  4Y11 E;  1QY6 A;  2I6Q A;  3TK5 A;  1G3D A;  2PLX A;  2HLC A;  2BOH B;  2CK3 D;  2BLQ A;  2GZ9 A;  3F6U H;  1GBL A;  2UWO A;  5DN6 D;  2D5M A;  1C4U 2;  3L33 A;  1P03 A;  3MO6 A;  3BG8 A;  2HNT C;  1TAB E;  1AWH B;  2OUA A;  1D6W A;  2I51 A;  2BD2 A;  3E0P B;  2P8O B;  4CRE A;  2J98 A;  4AX9 H;  1MTN B;  2ED4 A;  3KGP A;  3RC5 A;  4NA9 H;  4ZKO U;  1BTP A;  1AZZ A;  1ELC A;  1JIM A;  1J9C H;  4NIY A;  3ATL A;  2DE8 A;  1PPF E;  1XM1 A;  1SFI A;  4F49 A;  4AOR A;  1RS0 A;  3ENS B;  2B9L A;  5HYO A;  3ZZD A;  3GCH C;  1ELA A;  1TNK A;  1GGD C;  1NM6 A;  1WU1 A;  2WPD D;  4FUH A;  4I32 A;  1UHB A;  1ABJ H;  1EJM A;  2CF9 H;  1GBT A;  1RTF B;  4NZQ A;  5LPF A;  1UVP A;  3ATK A;  2IAB A;  1LVB A;  1O3B A;  3ATI A;  7KME H;  1O2U A;  1FY3 A;  3EE0 B;  2FZZ A;  1YGC H;  1GMD F;  2CGA A;  2H6M A;  1O2Y A;  9EST A;  2GZ7 A;  3PYH A;  5JAB A;  4FOU C;  4RKJ B;  2ZDK A;  3BTT E;  5E8E H;  2TGA A;  2GDD A;  3OX7 U;  1AUJ A;  3M7T A;  3QUM P;  1EB2 A;  3DNH A;  4GHT A;  4O3U A;  4YBN A;  2P94 A;  7GCH G;  3VB3 A;  5C1U A;  3UUZ A;  1CT2 E;  3M7U A;  1EP5 A;  2ZIQ H;  4ABI A;  2VWL A;  3ZZ4 A;  2C8Y B;  1AFQ B;  2ZFT A;  2ZHW H;  1QA0 A;  1UVS H;  2XYA A;  4TV4 A;  3CP7 A;  1Y3Y A;  4B2B A;  1Z71 A;  3TH4 H;  4CBO A;  1EAT A;  1SQR A;  5AFY H;  1HIA B;  3SZN A;  1SBW A;  1OKX A;  5T3H A;  3U98 H;  1O3D A;  4Y8Y A;  2QXI A;  3KHV A;  1SGP E;  1C2G A;  4B6F A;  2PGQ B;  2ZCK P;  2P93 A;  3FAO A;  4I33 A;  2AGI X;  4MVN A;  2STA E;  2FWW A;  3M5L A;  3PMA B;  3H7O A;  1BTX A;  5HM2 A;  1FLM A;  3S9C A;  1FAK H;  6CHA B;  4DIH H;  3NK8 A;  1P9U A;  3MMG A;  2OBO A;  3M3V A;  4UFF H;  3F2F A;  3SNB A;  1DIC A;  1MD8 A;  3M3T A;  3ATW A;  4X6N A;  5C94 A;  2HQ7 A;  3RU4 E;  1GBA A;  1QL7 A;  2ZU4 A;  3HKI B;  5JBB S;  4VGC C;  4E06 H;  3ZOD A;  1OWE A;  2OQU A;  1TNG A;  2SGE E;  2W6I D;  1OP2 A;  2ZDM A;  4ABB A;  4XOJ A;  2R2M B;  1C5L H;  2Y7Z A;  1C1S A;  3BV9 B;  1S82 A;  4IC6 A;  1COW D;  2IOT A;  1ZMN A;  3R0F A;  1N6X A;  1ZSJ A;  1O3P B;  2G5N A;  3SV9 A;  1O3K A;  2QA9 E;  4D7G A;  1FLE E;  1A3E H;  1IQH A;  1IQM A;  1KSN A;  1YF4 A;  2FES H;  2XCF A;  2W6J D;  2A5A A;  3NPS A;  3EA7 A;  3VXE H;  1BRA A;  4YXW D;  2OC8 A;  3CEN A;  1C1U H;  1THS H;  3R5W A;  1BRU P;  3MNS A;  2GV6 A;  1CA8 B;  5AF9 H;  5BRR E;  4Q7Z A;  2Z9J A;  2YMS D;  1OP8 A;  2AIQ A;  1C2L A;  1LPK B;  2LP6 A;  1BIO A;  1RZ1 A;  1Z8I B;  2ZI2 H;  1TRM A;  1DXP A;  2M5T A;  1MKW H;  1TGS Z;  1C5U A;  2BXU H;  3LDX H;  4NSV A;  1OWI A;  3SV6 A;  5EIY A;  1CQQ A;  5EXM A;  3QLP H;  4A6L A;  1EOL A;  2R3U A;  2HTD A;  8GCH F;  2A2X H;  1W3R A;  5T6F A;  4B73 A;  2FOG A;  3HK3 B;  2VVV A;  1C1N A;  1AND A;  1O39 A;  5AFZ H;  3OU0 A;  3UR6 A;  1ANE A;  2Z9K A;  2PKS B;  3GCN A;  2YNB A;  4E05 H;  5L30 H;  1NFW A;  1V2N T;  4U32 A;  4BXS A;  2K0Q A;  5CHB A;  2WYG A;  3E16 B;  5GWZ A;  1AB9 C;  3RC6 A;  2BXT H;  1RJX B;  2BQ7 B;  4MNX A;  3R5L A;  4BTU B;  3E1X B;  3RXP A;  2F9V A;  2ZFS A;  2HAL A;  4KTC A;  1D3T B;  2Y81 A;  3T25 A;  2ZFF H;  5PTP A;  1YLD A;  1HAV A;  1IQK A;  3VY5 A;  3DCL A;  5E0J A;  1UJ1 A;  1W8B H;  1JIR A;  5FBI A;  4YOJ A;  5EU8 A;  1GMH F;  1O2Q A;  1TOC B;  1THR H;  1O3A A;  3P8G A;  3LH1 A;  1SGE E;  2HRV A;  1EUF A;  4GLY A;  1G78 A;  4Y0Z E;  1AE5 A;  1V2V T;  3D65 E;  3SV7 A;  2O8L A;  1BJU A;  3GCH B;  3DUX H;  3WY8 A;  1GGD B;  1MZA A;  2PP6 A;  2ZZU H;  4O03 A;  4RKO B;  2Z6B D;  1O3F A;  1PPH E;  2QXG A;  2V6N A;  2AH4 X;  5LH8 A;  4DGJ A;  1P8V C;  2GGV B;  2F9B H;  2ZWL H;  3UY9 A;  3SU1 A;  2W7U A;  1MCV A;  2OBQ A;  3ZVG A;  5DK1 A;  3NKK A;  1HAO H;  2ANW A;  1KLI H;  4AB9 A;  3DSP A;  1FPH H;  3HMZ A;  1GJC B;  3BTD E;  3A7T A;  4Y8Z A;  1GVZ A;  1K1O A;  4DOQ A;  1DE7 H;  1THP B;  1W0J D;  1B0E A;  1HRT H;  2D26 C;  4HMV A;  1TA6 A;  1EOJ A;  4OM9 A;  2VB0 A;  5CHA C;  4AB8 A;  1GI8 B;  4NFF A;  2PW8 H;  1YCP M;  1UTM A;  1YPH E;  3FOA A;  3U8O H;  4A7I B;  2FUR A;  3TK9 A;  4H6S B;  4ABJ A;  4Y79 A;  2FP7 B;  3DMB A;  2BDA A;  1TAL A;  1C1Q A;  4ZKY A;  3TJN A;  5EG4 A;  1EPT A;  3M5O A;  2Y7X A;  3SQH E;  1XVM A;  2EQN A;  4HG6 A;  1FN6 A;  4ISN A;  1NN6 A;  1GDQ A;  4HMX A;  1TMT H;  1DVA H;  1SLX B;  5BNC A;  1EZQ A;  4F48 B;  1SGY E;  2ZGJ A;  3UNQ A;  1CHG A;  1BT7 A;  1GHA F;  1H1B A;  6EST A;  1CGJ E;  2CV3 A;  3NWU A;  2EI7 A;  1EKB B;  3HGP A;  4XBB A;  3VGC C;  2ZU1 A;  3LT3 A;  2TGT A;  4INK A;  4RN6 A;  5F53 A;  3K2U A;  1GBI A;  1Z1J A;  2ZGB H;  2VVU A;  1AO5 A;  3OY5 U;  1MQ5 A;  1GPZ A;  3A89 A;  4WMD A;  1HCG A;  4YES B;  1C5W B;  4Z0K A;  2JET B;  1VCP A;  4H4F A;  1A61 H;  2OU5 A;  3CP3 A;  5C0U A;  2M2A A;  2XNI A;  3QTV H;  1ORF A;  1G3C A;  3QZQ A;  2H9H A;  3GS9 A;  1GJ5 H;  1C5Z B;  2G5V A;  3KCG H;  3BEF B;  3NCL A;  5G4B A;  4B75 A;  4NWL A;  2KR7 A;  1UW7 A;  4ISI H;  4XD7 D;  2ECU A;  1LTO A;  1GDU A;  3D23 A;  3RXL A;  2BY8 X;  1UTP A;  4CRB A;  4FUI A;  4XJ2 A;  1O5G H;  1S81 A;  2VWN A;  1UK2 A;  4B2A A;  2G81 E;  2Y5G A;  3B9F H;  2BDB A;  3SGA E;  4Z6A H;  4R8T B;  3RP2 A;  1C1V H;  1VZQ H;  1P2O A;  3GAS A;  4MTB A;  1ZPB A;  1W0K D;  1O36 A;  2UUK B;  3B5M A;  1C1O A;  4HMW A;  1SMF E;  4Q4L A;  3QX5 H;  2H2Z A;  1FJS A;  1FXY A;  5H4I B;  1G3E A;  1P04 A;  1ZPC A;  4A5T S;  5LPE A;  4BAH B;  1V2M T;  4FUG A;  2A7H A;  3M5M A;  3TK6 A;  4GAW A;  1LHD H;  3FN8 A;  3RXR A;  2BD9 A;  1LVY A;  4JCN A;  2ASU B;  1O3L A;  1W3Q A;  1MAY A;  1TNI A;  1TPP A;  3BTM E;  2FX4 A;  1P02 A;  1H8I H;  2ZFQ H;  3I29 A;  4FUJ A;  2OTV A;  1YCP H;  5DJ7 A;  1D6R A;  3V13 A;  1OWH A;  4IW4 E;  3PV4 A;  1W2K H;  1AB9 B;  5HMA A;  1PQ8 A;  3PRB A;  4YOG A;  1O3G A;  2K8I A;  1LVO A;  1XUJ A;  1F0U A;  1H9L B;  4FUD A;  2KFW A;  2A31 A;  1CSO E;  1G2L A;  2HGT H;  3GY6 A;  2RA3 A;  3VY2 A;  1OWJ A;  1C5V A;  1GMD G;  3NUM A;  3S9A A;  1ELV A;  2A32 A;  1DLE A;  3BTG E;  3K6Z A;  1JRS A;  3QZR A;  5DSF A;  2OC0 A;  3H96 A;  1LMW B;  2A4R A;  4OS2 A;  3RU4 T;  1QHR B;  3BIV H;  1EJE A;  4X6O A;  2PUQ H;  4BAN B;  1MUE B;  4AN7 A;  4WXV A;  3L6P A;  3K6Y A;  2JH5 D;  3SZE A;  2OIN A;  3RXQ A;  3U1I B;  2ZDV H;  1HNE E;  2VID A;  4XSK U;  3KQB A;  3ZVF A;  2ZTY A;  3F0O A;  1SLW B;  1U6Q A;  2Y5H A;  3LGI A;  1ZYO A;  3TIT A;  1GL1 A;  1O31 A;  3URE A;  2FOC A;  4ZKR U;  3T62 A;  4D76 A;  1SOT A;  2P8O C;  1MKW K;  1MTN C;  2K1Q A;  2FG9 A;  3LOX A;  1S6L A;  3SU3 A;  2ANY A;  2JDI D;  2QXH A;  5CHA B;  4D8N A;  3EQ0 H;  1XUF A;  1V6D A;  3QN7 A;  1Q2W A;  2GD4 B;  3DD2 H;  2XBV A;  4OS4 A;  3WWB A;  3FP6 E;  2BZA A;  1O3E A;  1BMF D;  1RGQ A;  3SBK A;  5T6D A;  1A5G H;  3AW1 A;  2GDE H;  3LIW A;  1O2M A;  2ZDA H;  2WPL S;  3BN9 A;  2FTM A;  4HI3 A;  2Z7F E;  5I46 H;  1QNJ A;  4LZ4 B;  3TPI Z;  1IQF A;  3BTE E;  2ZU3 A;  3U5W A;  2Y5F A;  1EX3 A;  1TYN A;  3RC4 A;  1ELG A;  4NIX A;  3RXJ A;  1T8L A;  3TGK E;  3GCT G;  2HVX A;  1VKY A;  3QGJ A;  1BHX F;  1IQL A;  2BVX H;  2TPI Z;  3KN2 A;  4Q7Y A;  1W12 U;  2QF3 A;  5DP7 A;  1BA8 B;  3A7V A;  2BZ6 H;  3EGK H;  3RML H;  1QRZ A;  2RG3 A;  3MH4 A;  2O8U A;  4B6E A;  1AFQ C;  4DY7 B;  1A1R A;  3HGN A;  1NFU A;  3K88 A;  3NXP A;  2Z94 A;  4NIV A;  1OXG A;  1TPS A;  1A3B H;  2ZGC A;  4HZH A;  2QV1 A;  5JDU B;  1G32 B;  3URD A;  1EP6 A;  1ZML A;  2V0B A;  2NR4 A;  1TNJ A;  1KDQ B;  1GMC G;  1FN8 A;  8GCH G;  3DB0 A;  4ABE A;  3RXV A;  2PTN A;  1SGF G;  3BSQ A;  4YLU A;  2VGC B;  5F8Z A;  4ISO A;  2J2U A;  2NU2 E;  1QJ6 B;  1NT1 A;  1AY6 H;  1YOA A;  3PMH B;  1AVW A;  2BLV A;  3BF6 H;  1ZTJ A;  3CS7 A;  3OTJ E;  1P09 A;  1K22 H;  4XBD A;  2I02 A;  3U34 A;  1LQD B;  1CHO F;  3MNC A;  3QGN B;  1TWX B;  1ZRB A;  3RM2 H;  1JRT A;  1Z8R A;  1P3C A;  3TH2 H;  4PRO A;  1DAN H;  3ZVA A;  2AHM E;  2VPA A;  1FUJ A;  2X1J A;  1EAI A;  1SG8 B;  1ETS H;  3ZVC A;  3ZZC A;  1OX1 A;  2UWL A;  3RMM H;  1TBZ H;  1EST A;  2YNA A;  1W3O A;  3U0I A;  1ZHP A;  2PSX A;  1GMH G;  3DA9 B;  1K1I A;  1IQG A;  3MH7 A;  4WVP E;  3U1J B;  1Y8T A;  3LGY A;  3MH5 A;  3TNS A;  1AKS B;  2H9E H;  4K69 A;  3T27 A;  4SGB E;  3WWF A;  2F9P A;  1GBJ A;  3K65 B;  1V2W T;  4FU7 A;  3A84 A;  3SYJ A;  1C5T A;  2W3K A;  2WV4 A;  4AGK A;  2WPI S;  3Q77 A;  3TGI E;  1T32 A;  2ZNK H;  4K1E A;  3LON A;  2XCN A;  2P3F H;  4YLQ H;  2BD5 A;  4AC9 A;  1CVW H;  5FX5 A;  5JYI A;  2HNT E;  2BY6 X;  4U2W A;  1QQ4 A;  3AWH A;  2ZFP H;  1SGN E;  1W0Z U;  1HGT H;  3PFT A;  1BBR E;  2FS8 A;  3PWB A;  4ZHA A;  1GBH A;  1MBM A;  2HWL B;  2TIO A;  4NG9 H;  1TX6 A;  4AYV B;  5DKM A;  3R5P A;  2SFA A;  4INL A;  5C1X A;  1Z1I A;  3P70 B;  1NFX A;  1VIT F;  3D49 H;  3E6P H;  3NFW A;  4K1T A;  2ULL A;  3H7T A;  3OEE D;  1OWD A;  1SVP A;  1AHT H;  2TGP Z;  5E0H A;  3UB0 A;  8KME 2;  3O8R A;  2DUC A;  3MFJ A;  2A0Q B;  3GY4 A;  4L82 A;  3UTU H;  1C4Y 2;  2A5I A;  1K2I 1;  3LGT A;  3AAU A;  3GYL B;  4NCY A;  2WSS D;  1TNL A;  3A7W A;  1AVX A;  4AZ2 B;  3A85 A;  1CT4 E;  1QB1 A;  1VIT H;  4Z1M D;  3KYG A;  1G30 B;  1UVU H;  2PKA A;  3A7X A;  3S7K B;  4R0I A;  4JZD H;  1RFE A;  3S69 A;  3FAN A;  3A8B A;  1T9M A;  1YCP K;  3A82 A;  3U69 H;  1P57 B;  4ACB A;  1NRQ H;  5KEC A;  1S5S A;  5ETX A;  5JB9 S;  4I8J A;  5TCA A;  4JZ1 A;  2RFK C;  2HNT F;  1WQS A;  1VCQ A;  1NBM D;  5JBA S;  4F4O C;  1C2J A;  1C5Q A;  3SW2 B;  2BX4 A;  1RIW C;  1QTF A;  4Y6D A;  4XBC A;  2VWO A;  3P8F A;  3OY6 U;  3SJ9 A;  4Y71 A;  1BTU A;  3SUF A;  2Q6D A;  1BOQ A;  1C5P A;  2FO9 A;  3HY8 A;  4K3J A;  3UQO A;  3PO1 C;  1XUK A;  2GP9 B;  1QA7 A;  1Y12 A;  1O2J A;  2P3T B;  4BAM B;  1F0T A;  3HPT B;  4BNR A;  2QIQ A;  1H8H D;  3G01 A;  1F5L A;  1QCP A;  1S6F A;  1UTQ A;  3MU5 A;  4GSO A;  5C0T A;  1GVL A;  2PTC E;  3GYM A;  1BBR H;  4BXW A;  2HPP H;  1T8N A;  4Z85 A;  2TBS A;  1NY2 2;  2GCT B;  2ZGX H;  2JIZ D;  3ZZ9 A;  3ZOE A;  1MU6 B;  4Y9I A;  1XHN A;  2KX4 A;  4IMZ A;  1XUI A;  1ETT H;  2A2J A;  3GY3 A;  1LKA A;  3ZOH A;  2PV9 B;  3ZVD A;  1T8M A;  1JBU H;  4B1T A;  4X8S H;  1WCZ A;  3Q76 A;  4Y76 A;  5C1Y A;  2JKH A;  1SGF A;  3M7Q A;  2VIO A;  2ASF A;  2P5Z X;  1OS8 A;  2JH0 D;  3MU8 A;  1QBV H;  3TVJ B;  2ZHF H;  3LC5 A;  2IN2 A;  2WV5 A;  1UTO A;  3SJO A;  2ZHD A;  4KKD A;  2JET C;  1Y59 T;  1FY8 E;  4K1S A;  1CI0 A;  3GDV A;  4JMY A;  3SHA H;  2A5K A;  1DPO A;  1E35 B;  1USF A;  4FUC A;  1KLJ H;  1PPZ A;  1UCY E;  3A80 A;  1Y3U A;  3ZOG A;  1A4W H;  3AMF A;  1LPG B;  2ODQ A;  1V2S T;  1Z6J H;  4OS6 A;  4Q2K A;  3U28 C;  4ZMA H;  4RI0 A;  3ZVE A;  1OHH D;  1PPG E;  2BD7 A;  4O3T A;  4XFQ A;  2FMJ A;  2SNV A;  1ESB A;  1NES E;  2DE9 A;  1BTY A;  2H5D A;  2VIQ A;  1L1G A;  1KXB A;  2GZ8 A;  4WY3 A;  4TY6 A;  1GJD B;  3RXU A;  5C2Z A;  2Z9G A;  2AIP A;  1FNI A;  1ACB E;  3E8L A;  5FPY A;  1UVO A;  3RXI A;  3KEE A;  3URC A;  1BZX E;  1O3M A;  1P06 A;  2GMT B;  1UTK A;  3BTW E;  2VVC A;  2C93 B;  2KAI A;  4B76 A;  1ZGI A;  5AVD A;  2STB E;  2GX4 A;  1K28 D;  3OYP A; 
#chains in the Genus database with same CATH homology
 1USC A;  3R5L A;  2OU5 A;  4RT1 A;  4XRN A;  4YWN A;  3CP3 A;  4RT0 A;  2RE7 A;  2VPA A;  2FG9 A;  1NRG A;  2X1J A;  1WV4 A;  3VY5 A;  4HX6 A;  3FGE A;  3RH7 A;  1G79 A;  3SWJ A;  1W3O A;  3CB0 A;  3A20 A;  3KYF A;  3U0I A;  2ECU A;  3HY8 A;  4XJ2 A;  1G78 A;  2D36 A;  3R5R A;  2E83 A;  1W9A A;  2HHZ A;  1WLI A;  1FLM A;  2D37 A;  4I86 A;  2PTF A;  1JNW A;  1W3P A;  2Q9K A;  5EJL A;  2IML A;  1G76 A;  2QEA A;  1XXO A;  3GAS A;  3DSG A;  4Z85 A;  2HQ7 A;  1I0R A;  3B5M A;  2X1K A;  4HMW A;  3ZOE A;  2IG6 A;  2D5M A;  4Y9I A;  1XHN A;  1YLN A;  3K87 A;  3U5W A;  3ZOD A;  2A2J A;  1DNL A;  1VL7 A;  3ZOH A;  2I51 A;  3HMZ A;  4R82 A;  2ED4 A;  2D38 A;  2HQ9 A;  4P02 A;  3AWH A;  1TY9 A;  4HMV A;  4F07 A;  5EJZ A;  5ESC A;  3PFT A;  1W3Q A;  2QCK A;  2ASF A;  2FUR A;  3IN6 A;  2HTI A;  5EJ1 A;  2R6V A;  1Y30 A;  3DMB A;  2L74 A;  3R5P A;  4ZKY A;  1I0S A;  4P00 A;  3R5W A;  1CI0 A;  3NFW A;  5CHE C;  1USF A;  4HMT A;  3K88 A;  2FHQ A;  2RDE A;  4HG6 A;  5KGO A;  3EC6 A;  2R0X A;  3R5Z A;  3A6Q A;  3ZOG A;  1RZ1 A;  2ARZ A;  3AMF A;  4HMX A;  2GJG A;  1WLK A;  3E4V A;  1WGB A;  2IAB A;  3K86 A;  5BNC A;  1G77 A;  4IRA A;  3R5Y A;  2NR4 A;  3ZOF A;  3ZOC A;  3VY2 A;  4F48 B;  5EIY A;  4L82 A;  5KED A;  3BA3 A;  3CNR A;  3A6R A;  3BNK A;  4HMU A;  2HTD A;  3DB0 A;  1W3R A;  1AXJ A;  3F7E A;  4N7R C;  5JAB A;  4FOU C;  3H96 A;  1EJE A;  3DNH A;  4QVB A;  3KYG A;  4YBN A;  3TGV A;  3VYA A;  2ECR A;  1RFE A;  2AQ6 A;  3U35 A;  1YOA A;  1RZ0 A;  3BPK A;  3FKH A;  4XHY A;  1T9M A;  5CHO A;  2I02 A;  3U34 A;  5KEC A;  1YWU A;  2OL5 A;  4HMS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...