3KYFA

Crystal structure of p4397 complexed with c-di-gmp
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
231
structure length
231
Chain Sequence
PQPPKVLSTPLEIAANLRQLQESHDPLIITFHDRSHRFQSYVVHVDRESNTLALDEMIPRDGEKFIENGEHFRVEGFHDGVRIAWECDHALKISEVDGHRCYSGPLPQEVTYHQRRNAFRAALKLSQLVDIILDGAHLKGNGAMRGKLLDISATGCKLRFEGNVEDRLQLGQVYERFKAGNPLGLVDTMVELRHLHYEERINTTFAGVRFHNLSGQAQRKIESFVYQLQRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Putative uncharacterized protein
publication title Structure of PP4397 Reveals the Molecular Basis for Different c-di-GMP Binding Modes by Pilz Domain Proteins.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 50
structure length 231
sequence length 231
ec nomenclature
pdb deposition date 2009-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07238 PilZ PilZ domain
A PF07317 YcgR Flagellar regulator YcgR
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.110.10 Mainly Beta Roll Pnp Oxidase; Chain A Electron Transport, Fmn-binding Protein; Chain A 3kyfA01
2.40.10.220 Mainly Beta Beta Barrel Thrombin, subunit H predicted glycosyltransferase like domains 3kyfA02
4F48B 2HQ9A 2IMLA 3U35A 1G77A 3A6RA 5CHOA 4IRAA 4HMXA 1VL7A 3R5RA 2X1KA 1W3QA 3AMFA 5EJLA 3DSGA 3B5MA 3GASA 1W3PA 2I02A 1WLKA 4ZKYA 2D37A 2L74A 5BNCA 2Q9KA 2ECUA 2OU5A 2RE7A 1RZ0A 4F07A 3SWJA 4YWNA 4HMWA 4XJ2A 2AQ6A 3R5PA 4Y9IA 3U0IA 1T9MA 2HTIA 1FLMA 1DNLA 3VY2A 3F7EA 3RH7A 3BPKA 2VPAA 3NFWA 3VY5A 1WV4A 1YOAA 3R5YA 1I0SA 2GJGA 3FGEA 2RDEA 2HHZA 3BNKA 3HMZA 3R5WA 2HQ7A 2QCKA 3U5WA 2ARZA 3EC6A 1AXJA 3H96A 5JABA 2I51A 4QVBA 2FURA 3U34A 3ZOFA 2ED4A 1NRGA 1G76A 3PFTA 4FOUC 3KYGA 4HMTA 4P02A 2FHQA 1EJEA 4P00A 4YBNA 2ECRA 1JNWA 4N7RC 3ZOEA 3R5ZA 4HX6A 1USFA 2D38A 3A6QA 3TGVA 3DMBA 1Y30A 4HMSA 4XHYA 2FG9A 2ASFA 2R6VA 5KEDA 3IN6A 2IABA 3E4VA 5EJZA 1G79A 2R0XA 3A20A 3FKHA 2HTDA 3ZOHA 3KYFA 5EJ1A 4R82A 2X1JA 1G78A 3AWHA 4RT1A 1I0RA 2OL5A 5KECA 1RFEA 2A2JA 1USCA 3K88A 1RZ1A 1WGBA 4Z85A 3CB0A 1YWUA 3ZOCA 1XXOA 3CP3A 4HMUA 1W9AA 5EIYA 2NR4A 3DB0A 3VYAA 4XRNA 3HY8A 1WLIA 3ZOGA 3CNRA 4HMVA 1XHNA 1W3OA 4L82A 1CI0A 3ZODA 2E83A 5CHEC 4I86A 1TY9A 4HG6A 3DNHA 2D5MA 1YLNA 3BA3A 2QEAA 2IG6A 5ESCA 4RT0A 3K86A 1W3RA 3K87A 3R5LA 2PTFA 5KGOA 2D36A
chains in the Genus database with same CATH superfamily
2GD4B 3BIUH 5I25A 1IQHA 3EAJA 2QF4A 3JZ2B 1G30B 2XWAA 5EW1H 4ZHMU 1W3PA 1Z71A 5FXLA 3ZZ7A 4LXBH 4SGBE 4E06H 3RXKA 4ZCNA 1V2KT 3KQBA 1ORFA 4UD9H 1QBOA 1V2RT 1T9MA 2ANWA 2XCFA 1DSUA 3LH3A 1FNIA 2ZQ1A 1AKSB 2O8WA 2W6JD 3L6PA 4ZKRU 3A80A 3RXPA 1QTFA 3LKWA 3UR9A 1I0SA 4K8BA 4E7RG 1RD3B 2A31A 3HMZA 4Y6DA 1G3BA 1PPFE 1ETTH 1VR1H 1TX8A 4B6FA 5LH8A 2XNIA 4MPUA 2FYQA 2TGPZ 1A0HB 3MWIU 1SGIB 5DKMA 3RXVA 1O5AB 1F7ZA 1P2NA 4B74A 2PUXB 4MTBA 4YOJA 1LKBA 1P12E 7GCHF 1TX6A 3SU2A 4HMTA 2GP9B 1C5PA 2HOBA 4K1SA 2FHQA 2RFKC 3JZ1B 1SLWB 1DWDH 1V2UT 2GDEH 4DURA 5JBBS 1KSNA 3TGVA 2G51A 4FVBA 1C5LH 1EFRD 1K1LA 1NRNH 2BLVA 2VJ1A 4D9QA 4Z6AH 4WWYA 1H9IE 5HM2A 3SNDA 5EPNA 2ASFA 3LC5A 1X7AC 2KAIA 2Z6BD 1UTKA 2CF9H 4X8VH 2FMJA 5LPFA 1KXAA 1RJXB 2OC0A 4O3TA 4ASHA 3ZOHA 1XMNB 1C2MA 3P6ZB 1WV7H 2OQ5A 1A46H 1P2JA 1W0KD 3UR6A 2UWLA 1DICA 2A5IA 1TGCA 4ISLA 4O3UA 3VXFH 1USCA 4DIHH 1RIWC 3M5MA 4NZLA 1LVYA 4CH2B 1C5MD 3NK8A 3BEFB 4HMUA 4NSYA 4XDEA 4ZHLU 1QR3E 3EDXB 1RIWB 1FDPA 4JK5A 3SGQE 5EW2H 1ARCA 5E0JA 2IOTA 3HY8A 5DP4A 4AYYB 1PPCE 1C1MA 3QWCH 1J8AA 3M37A 1W14U 3QTOH 1EAUA 4A92A 2XRCA 4HG6A 4KTSA 2PKSC 4TWYA 4X1QU 3TNSA 2BDBA 3E1XB 1SG8B 2PKSB 1JIMA 6GCHG 1J14A 3M3SA 1V2WT 2BY7X 1H8ED 3B23B 4HMXA 1EASA 1YPJH 2ZDNA 1T7CA 1ELAA 2STAE 3FZDA 1FIZA 4YOGA 1BZXE 1O3EA 3SU5A 4H42U 1SGCA 4CHAB 5A09A 4HKHA 1PFXC 1AN1E 1MMJN 1KY9A 3CS0A 1E1RD 2F9BH 4D76A 1SVPA 2FLBH 4FUIA 2ZFFH 4I7YH 2ZWLH 2A2XH 1P03A 3SU1A 2FOEA 3RXCA 1H4WA 2FOGA 3BTEE 1A61H 4CRDA 3KIDU 1ZSKA 4B2AA 1CT2E 2V3OH 4QT8C 2XXLA 1P09A 1S6HA 1YPGH 2H9EH 1BITA 1NFWA 3ZOFA 1BBRH 2KX4A 5ABWA 2ED4A 2EI6A 1V2OT 1BTWA 2XC4A 1UK3A 5AVDA 1LVMA 2OQUA 1F5RA 3M7UA 1O5DH 1HJAB 1MTVA 1Y3UA 3V3MA 2W3IA 2BD2A 1OP2A 4X8TH 3A88A 3E91A 1NFYA 2H6MA 5DK1A 3FKSD 1NRQH 2FS8A 5SGAE 2WYGA 1ARBA 1TA2A 1Y30A 4ESTE 3SQHE 1GDNA 3MQKC 2ZDKA 1QIXB 1O3GA 4RSPA 1HCGA 5DJ7A 1V2ST 1WYKA 1FMGA 1ABJH 1GI9B 2H9TH 4ZAEA 1TNJA 2VWLA 1I0RA 1P3CA 2PP6A 5H4IB 1TX7A 2R2MB 1HXFH 3K88A 1QNJA 3GCHB 2IN2A 2PHBA 4BAQB 4X2YA 3A83A 3H09A 3D49H 4NIXA 3BTME 1GBBA 2RA3A 1W12U 5FX5A 3ZVFA 5E2PA 4BAMB 4YZUA 4NFFA 4Q4LA 1YLCA 3KEEA 3HE1A 5JDUB 1WAYB 4X8UH 4BXSA 2EI7A 4H4FA 3F6UH 1ZPZA 2XC0A 1PQAA 1P02A 1AY6H 1RXPA 2NU0E 2Y80A 3ITIA 2IPHA 1NBME 1P9SA 3SYJA 2L74A 1XVOA 3GDSA 4IBLH 1IQFA 3FFGA 2Q6FA 1DANH 3ATMA 5JYIA 5A0BA 1ELVA 1FN8A 2R0LA 4OS6A 3S9AA 1UTJA 1P10A 1JOUB 3F7EA 4TV4A 4NA9H 1NROH 4K5ZA 5B6LA 1W0YH 2R3UA 1O37A 3FGEA 2Y5GA 2ZDLA 3F9HA 6GCHF 1A5IA 1UTOA 4JYUH 2HQ7A 1WQSA 3ZYDA 1S85A 4NSVA 3OE7D 4DIIH 2I51A 1EB2A 2KCOA 2R0KA 1C1SA 1Q2WA 2CHAC 1K28D 1V2PT 1EB1H 3BG4C 5G4BA 3RXEA 3S7KB 1H9LB 3SJKA 1D3PB 2KM0A 3ZZ4A 2FI3E 1Y5BT 4K60A 4M9FA 4CRBA 2VH6A 3ZOEA 1MD8A 4FUGA 1AUJA 1KTSB 4Q2KA 1F2SE 2XWBI 1SQAA 1JRTA 5K0HA 4AORA 2OTVA 3RXAA 5K7RA 1YLDA 1IHSH 1GI8B 1OWIA 3E4VA 2A5KA 1Y5AT 1HRTH 1O5EH 1GBJA 1K1PA 2WPDD 3N7EA 3ZZ3A 2HWLB 1HB0B 2VH0A 2P95A 1C2HA 2BVRH 1FY4A 3GY4A 4Y7AA 1ELEE 1CT0E 5ETXA 1NZQH 4ZXYH 2FOBA 2FO9A 2WYJA 1C4V2 3E3TA 2A7JA 3EE0B 2HVXA 1A5HA 1ACBE 1H9HE 1T4VH 1OX1A 1ZTKA 2J9NA 3AAVA 1GBEA 5EXNA 2RCEA 1EZUC 1SGTA 2BLQA 1IQIA 1G3DA 4YESB 4ZUHA 4CR5A 2ZGXH 2G81E 4XRNA 3RMLH 3V13A 4BAOB 1V2QT 2KCPA 1CO7E 2Y7ZA 1ELBA 1SPJA 5C2ZA 1FY1A 2LNCA 5L6NH 1Z8JB 2VIDA 1Z6JH 3RXJA 1O33A 4Y8XA 2IG6A 4NFEA 4RT0A 5FPTA 1HAPH 4GPGA 1SOTA 4DJZB 3CS7A 4DGJA 2Z9LA 4FUBA 1Y8TA 2GZ8A 1IQGA 1BMFD 4F48B 3U35A 2ZHEH 5FX6A 2Y6TA 1EATA 2ZC9H 3L33A 4HGCA 3TGIE 2VVVA 3NCLA 2FZZA 4ZKYA 3VPKA 3M5OA 3F0PA 3TITA 4F07A 2J94A 1WQVH 4YWNA 5JBAS 2BX4A 1C5QA 2BDIA 3ENSB 3HK6B 7KMEH 1MUEB 1UMAH 1NRSH 3IITA 4D8NA 1W2KH 1YCPM 1ANEA 2Q6GA 1HAHH 1KMHB 4CREA 3AW1A 1NN6A 2QE7D 2ZGJA 3OYPA 2AFQB 2QCKA 3OTJE 2HPPH 3TH2H 2O8UA 1TGBA 4QVBA 2Y82A 2OINA 2OXSA 1TGTA 2ZA5A 2G4TA 9LPRA 3PV4A 4NGAH 2PUQH 1UCYK 4ZXXH 1C1RA 3VB4A 1BIOA 1L4ZA 3RXFA 1G32B 1SBWA 1XXDA 3DSOA 3MTYA 2K0QA 5A8XA 2V7QD 4HX6A 1RGQA 2KR7A 2OCVB 1VJAU 2H1UA 5JBTA 2ODPA 3MNCA 1VCPA 1QCPA 1K22H 1TMTH 2C8YB 2HTDA 4AX9H 1O5GH 1PPGE 5F8TA 5EJ1A 2GMTB 1UO6A 5L2ZH 1UTPA 1GJAB 1SOZA 3A7YA 1QFKH 3EGKH 4BTUB 5JBCS 1W0ZU 2B8OH 2UWOA 1O2TA 2G55A 4X1PU 2OP9A 2A5AA 2SGDE 1E35B 2GTBA 3OY5U 1ZTJA 4CR9A 1HAVA 3LGYA 3PLBA 1O2HA 1HAYB 4UEHH 1FY8E 4F55A 4L82A 2V0BA 4ISIH 5GDSH 5A8ZA 7ESTE 3H7OA 1AZZA 2TGTA 2ZO3H 3WY8A 1MU6B 2NU4E 3A8CA 3BEIB 4KTCA 4O03A 3VB7A 1YLNA 5C94A 1DWEH 1AFEH 5T1VA 4TY6A 3P92A 1QRWA 2BMGB 4HI3A 3DD2H 1EUFA 2ODYB 1NS3A 5C5OA 4BANB 3LIWA 4IRAA 2VIQA 3SU0A 2JH0D 1O3CA 3R5RA 2WPJS 3GY5A 1W3QA 3AMFA 1O39A 1TNHA 3B5MA 1KLTA 2D37A 2YNBA 1IQEA 2ZQ2A 3MO3A 1C1UH 3BTWE 1JMOH 4KP0A 1D6RA 4XJ2A 3R5PA 1DX5M 5C20A 1SGYE 3RM2H 1THSH 1L0ZA 4Z1MD 1SLXB 3RH7A 3SOSA 1Y3WA 2G00A 4DVAU 2ASUB 2OBQA 2ZECA 2PSYA 4MQAA 1RFNA 1WCZA 1CT4E 4ZKNU 3DUXH 1HFDA 1MU8B 1MKWK 1ZSLA 1W13U 2K4QA 3SV7A 4CRFA 1FXYA 3U5WA 4X6NA 3EC6A 3ZYEA 1FONA 1AVWA 3G01A 3C27B 2BLWA 1SL3A 4A6LA 3HKJB 1QGFA 1RRKA 4NWKA 3KHVA 1Z1JA 1NRGA 1UK4A 3HATH 5DG6A 3UOPA 3E90B 1A0JA 1WTHD 1HBTH 1BA8B 3RMNH 1GMHF 5DP8A 2VINA 4P00A 3T26A 1MTWA 4YBNA 1JNWA 3A84A 1CSOE 4UFDH 1ELGA 3O8BA 2FP7B 1EZXC 3U98H 3VG8A 1DXPA 2Y5FA 3LDXH 4BNRA 1O36A 2FG9A 1C5YB 2R6VA 3HGNA 4JK6A 2XBXA 3LJOA 3UWIA 3AW0A 1EQ9A 1JIRA 1MCTA 2JDID 1IQKA 2DUCA 1ELFA 1O2WA 1NFUA 5C5NA 3RC6A 1H1BA 1LPKB 3O8CA 1IOEA 1WGBA 4OS7A 4PROA 4JZFH 5GPIB 4U01A 2A1DB 4HFPB 3LGWA 1AGJA 2BQWB 2IPQX 3M61U 3SV2H 5GIBA 2QA9E 2ZFSA 4GCHF 4ACBA 1CHGA 2V3HH 1GVKB 4XBDA 1CE5A 1CI0A 3LPRA 4AOQA 1YCPH 4M7GA 3GICB 1HXEH 4NCYA 1YPMH 5EQSA 1O2LA 2BD7A 2R9PA 4VGCB 2FTLE 2AGEX 4YTAA 1DUAA 1ZHPA 3QUMP 1B0EA 2ZU5A 2DE9A 3LGIA 1GL1A 3FP8E 4Q80A 1PYTC 3FAOA 4Y8YA 3F68H 3F9EA 1KXDA 2TPIZ 1S83A 2ZFRH 3RXRA 2W5EA 2ECUA 5C0TA 5J4QA 1EZQA 5E2OA 2AQ6A 1BRUP 4Y9IA 3Q00A 1CA0B 2Y5HA 5F6MA 1Y5UT 1S82A 4MNYA 3QLPH 1DLEA 3BTKE 3QX5H 1SGRE 1FN6A 3BPKA 2FOCA 2JETB 1BMMH 3DT0H 2VPAA 4UFFH 1SQTA 4NA7A 3MO6A 3PTNA 1ZPBA 2HHZA 2ZTZA 1TNKA 3GY6A 3RXDA 3R5WA 4Y0YE 4FVDA 1QURH 1GBHA 3PMBB 2J98B 3SQEE 1CBWB 2ZPQA 3U34A 2GDDA 2GUJA 3HKIB 3RU4T 3DSPA 1L1JA 3K6ZA 4AN7A 1UCYH 2ZGBH 2J38A 2BY9X 3A7VA 1FY5A 3A7ZA 2PSXA 5CHAB 5ESBA 2GGVB 1FV9A 4FUCA 3K9XB 1GHZA 2J97A 3BTHE 1LVBA 4B6EA 2ALVA 3PMJA 4B2CA 2PFEA 2VBCA 4UONA 1DPOA 2CJIA 2V6NA 1WTGH 4GLYA 1N1LA 1DT2A 3SGBE 4DCDA 1QBVH 1AFQC 3OAAD 1AMHA 2C3SA 3QO6A 1P9UA 3HPTB 1O2XA 1AFQB 1RFEA 1PYTD 2QY0B 1BRAA 1GCDA 4YLQH 2BOHB 1BMAA 5HYOA 3MU4A 2WV4A 1TNIA 1BUIA 2CGAA 2VIWA 3TJNA 1CA8B 1OWHA 1UTQA 1W0JD 3DB0A 4WY3A 3VYAA 5FBIA 8GCHG 3A8DA 4HMVA 1K2I1 4BTIB 3RLYH 5LPRA 1C1VH 2JJ1D 1O38A 9ESTA 1D9IA 4AGKA 1TY9A 1O3MA 4X6PA 1ZMNA 2FOFA 4E7NA 3T62A 2O8LA 5EXMA 1LDTT 2P5ZX 4R0IA 3R5LA 3LU9B 1MABB 5BNCA 1QB1A 3S7HB 1O3JA 1O5BB 3MH4A 1WOFA 3MU5A 3MMGA 4FUJA 2VWOA 4WMDA 1ZGIA 3BSQA 1O2IA 2BDHA 2R2WU 1QRXA 3EA8A 1EP6A 1LQDB 1C2DA 2XNDD 3NUMA 4OGXA 4ABBA 2RE7A 1RZ0A 1Z6EA 1V2LT 3OSYA 2THFB 4MNWA 1HJ8A 2HTIA 4B2BA 2UUFB 3SI3H 4XOJA 3PO1B 4YOIA 8LPRA 1KLIH 1ZR0A 3UNQA 2FXRA 4R8TB 3NFWA 2J98A 3TGKE 1TONA 4MPVA 1P2IA 1MKWH 1KDQB 1FX0B 4AYVB 1EXFA 1MTUA 3E6PH 3LC3A 2A2QH 2YOLA 2ZGCA 2BHGA 1HAZB 1D6WA 1CGHA 1EOLA 3QZRA 4E05H 3T5FH 4CHAC 4AFQA 1OYTH 1AKSA 2A4OA 2ZU1A 2KCAA 4AG1A 3EA9A 4DT7B 1UVPA 2GKVE 1SLVB 1EAXA 3EE7A 3RXBA 5DSFA 5CMXH 1XKBC 2P3FH 2WUCA 1EJEA 2D1JA 3UB0A 2HLDD 4ZKOU 1PQ8A 1P01A 2QXGA 3ATWA 1P11E 1BTXA 1DLKB 1V2JT 5KEDA 3RMMH 3TH4H 3NPSA 4X6OA 2FDAA 4I33A 4B71A 1ABIH 2J95A 1BHXB 2Z3DA 3M3VA 1HJAC 1BB0B 1QJ1B 5FL7D 3A7XA 1L1NA 1FY3A 1VKYA 4NIVA 1BTHH 3TH3H 1GI2A 1QBNA 2CN0H 1XKAC 1H8DH 3UTUH 1O2VA 2J34A 2UUKB 1QL7A 5JPMH 2HNTC 1W3CA 3F2HA 2ZEBA 5E0HA 3FP7E 1ZRKA 2NR4A 2HPQH 3EA7A 2GCHG 1O5FH 1ZYOA 3ZOGA 2BX3A 5DP6A 1C9TA 1QQUA 2EY4C 1DY9A 2BYAX 1G3CA 4X2VA 3NXPA 3URCA 4I86A 1SB1H 3GCHC 4I31A 4BAHB 1A0LA 3VB6A 3DHKH 5GJ4B 3SUGA 1AWFH 3RXUA 1UTLM 1T8OA 1UCYE 2QAAA 1XXFA 2IMLA 1G77A 1T8NA 5JB9S 1K1IA 3A89A 4NIYA 1KXEA 3U28C 2QXIA 4ZH8A 1T8LA 2QC2A 5T6FA 2UUJB 2JIZD 4ACAA 1GCTC 5TCCA 8GCHF 5HKKD 1GI5A 2AEIH 1GCTB 4FU8A 1RTFB 2JJ2D 5C17A 2Y81A 3ODFA 4GSOA 1O3OA 1FAKH 2ZFTA 1NU9A 2CMYA 1E36B 4OS1A 1WV4A 1GJ5H 4ISOA 4JMYA 4JZEH 1XUFA 1VZQH 4YT7H 2UWPA 2WSSD 4TYDA 2QN5T 3MNBA 2FURA 1LTOA 4KKDA 3D65E 1OXGA 1U6QA 2K8IA 1NM6A 1G76A 3PFTA 2VB0A 1P57B 3MNSA 1F92A 4WH6A 2VIPA 5BPEA 1OPHB 1HPGA 5PTPA 1OS8A 4P02A 1V3XA 3ZVDA 2ZDAH 1K0HA 3OFND 1JWTA 5EXLA 1K1MA 1Q3XA 2B9LA 3ZZCA 4O9VA 1AB9B 2A4GA 1AVXA 1DE7H 1BCUH 4HMSA 1C9PA 1C5XB 2Z3CA 1NTPA 5F8XA 1LHCH 3GDUA 3S69A 1AE8H 5HGGA 3RXQA 3WWBA 5C0UA 3H7TA 1GJ6A 1O2QA 1OWKA 1A2CH 4GUXA 2OL5A 1GJ7B 1BQYA 3UWJH 5FPSA 1GMDG 1O32A 3GYLB 1BDAA 4B75A 3RC4A 1CU1A 3SZNA 2WZQA 3GY8A 1CGIE 4A5TS 4D7FA 1TRNA 3RC5A 1BOQA 2QIQA 1OP8A 1SGPE 3UAIC 1IQLA 2EI8A 1O2PA 4RKOB 3ZODA 4ABHA 3PROA 2F91A 3B8JA 4UDWH 1LPGB 5IYTA 3MHWU 2D5MA 1DXWA 3SU4A 2FESH 3NZIA 1EJMA 5KGOA 1GWAA 5DP3A 3F3BA 1EJNA 2XBYA 2VWNA 1ZZZA 2BDCA 3DCLA 3P17H 5EJLA 2LELA 4TPIZ 2ZCHP 1AZ8A 1J9CH 1MAYA 1G37A 2VVUA 1ETSH 1ID5H 2SFAA 1O2KA 2ZDVH 5DP5A 4XBCA 1XVMA 2GCHF 4ZHAA 2AGIX 2ZHDA 4IN2A 4AFZA 1TIOA 2BOKA 3A81A 2P3UB 8ESTE 1GG6C 2V35A 3QTVH 4MNXA 3TPIZ 3UQOA 4BAKB 2G8TA 3PM3A 1K21H 2AGGX 4GHQA 2AYWA 4AG2A 4TY7A 1GG6B 1FAXA 3FVFB 4XSKU 1P2MA 3A87A 4FXGH 4CRCA 2QF5A 1C5VA 2BTCE 5DPAA 1ESTA 1UVSH 3LGUA 2BVXH 1DWBH 2VGCC 4NG9H 2XYAA 1UVUH 1AI8H 1O3HA 3O8DA 3U8RH 1CVWH 1GMHG 3VXEH 1TABE 2VGCB 2Z3EA 1ZJKA 3TJOA 1C1WH 3ZIAD 1O2NA 5A8YA 2ECRA 1DUEA 2PKAB 2P3TB 1F0UA 1PPBH 1ZGVA 1BRBE 2SNVA 4YXWD 1EP5A 1D3QB 3QK1A 1SFIA 4XHYA 1HIAB 1T31A 3U8OH 1SFQB 1ANDA 4I32A 1ANBA 4NA8A 1XUIA 1YBWA 1YPLH 3RXOA 1DSTA 1YKTA 3KYFA 1MQ6A 2B0FA 1D3DB 5IK2D 1E34B 1J15A 2WHXA 3ZVEA 1E0FD 3ZV8A 2FTMA 5KECA 4MDSA 3ZZ9A 2AH4X 2A2JA 1F0TA 1GL0E 2ZFPH 1W10U 1QQ4A 1ZMJA 4INKA 2C90B 1XXOA 1THPB 3ZZ5A 1C1OA 2ANMH 3RU4D 1O35A 1UVOA 3LJJA 4GCHG 2BDAA 5HIYA 3M3TA 4CBOA 2ANYA 1D3TB 3P8FA 2GMTC 4U30A 3BIVH 2ZIQH 2OUAA 4AFUA 1GI7B 1QJ7B 4TPYA 2WPIS 2AIPA 1T4UH 3FN8A 1XUHA 3R3GB 2B7DH 1MZDA 1BTPA 1MAXA 3BA3A 4IN1A 1Q31A 2D2DA 3RXIA 3K6YA 2TRMA 2ZGHA 4TSFD 1FLEE 3FANA 3BTTE 2PTFA 2BDGA 1LO6A 4YO9A 5DP7A 1GMDF 1LMWB 5F03A 5HIZA 1LCYA 1QB9A 1GI3A 3P95A 2VVCA 4GHTA 1ZHMA 2HNTF 1O2SA 3LOXA 1F5LA 1AO5A 1FQ3A 1NRPH 4BTTB 3U8TH 4ABAA 1TAWA 1IHTH 3SJOA 2OC7A 3EAAA 4I8LA 5F8ZA 1AIXH 4FU7A 4Q63A 3E0NB 3LGTA 1EPTB 1S5SA 4F49A 3M5NA 2ZZUH 4U32A 1CQQA 2UUYA 4JZ1A 1LHEH 2CF8H 3M7TA 3BNKA 2Z9JA 3PWBA 1Z8RA 4AGJA 4WF8A 4IC6A 4AZ2B 6CHAB 1F5KU 1AXJA 1RTLA 3KCGH 3H96A 1OWEA 1AD8H 3BTQE 4J2YB 3I29A 2QGRA 1GHVH 2XBVA 1UHBB 1O3BA 2HLCA 3P8OA 3SNAA 1GMCG 4ABJA 3T25A 4WXVA 2QV1A 3QGJA 4IMQA 1HIAA 2ZCLP 5DO4H 2BD5A 1TQ7B 1T8MA 3MU8A 2D38A 2J4IA 1MKXK 4INLA 1DM4B 2AHME 1O3AA 4GVUA 2XW9A 4WXIA 4AB9A 3UQVA 3A86A 2AMPA 2BQ7B 3RMOH 2K1QA 3MNXA 3OY6U 3UNSA 1MBQA 1BT7A 3MFJA 2PTNA 3KQCA 1OWDA 4R82A 1C1PA 2F4LA 1G78A 1IQMA 3BEUA 3GCNA 4XE4A 4RT1A 5GNDA 5DGJA 3I78A 1GHWH 4HTCH 1TLDA 3FOAA 1LQEA 4B73A 3CB0A 2BD8A 3RDZA 4ABGA 1BJUA 3FP6E 4MLFB 3SN8A 3TK6A 1SGDE 2FOMB 2Z7FE 3SJ8A 3M5LA 1A3EH 1HYLA 2ALPA 2L1TA 3GS9A 1B5GH 1O3NA 2WUBA 1KLJH 2PV9B 3GY7A 1B7XB 4Q7XA 2TIOA 3HK3B 3RXHA 2IJOB 1C5UA 1SGEE 1LKAA 2QEAA 3MH6A 1LVOA 1ZHRA 2O8MA 1W8BH 1GBLA 3O8RA 4OS5A 3MO9A 1MH0A 3K87A 3UOUA 4ABEA 1GBMA 2FX4A 2SGFE 4LZ1H 5GCHG 3A6RA 1GBCA 1VL7A 3SI4H 4I8GA 3T29A 2Z94A 1MQ5A 3BF6H 4JYTA 1TA6A 3FZZA 1GBAA 1JXPA 4CRAA 1JRSA 1VCQA 4Y10E 3PV2A 5T6GA 1TBZH 1SSXA 5FBEA 2BD3A 1TOMH 4VGCC 2M2AA 2YMSB 4JYVH 1C5RA 1J17T 2WPHS 1SLUB 3VY2A 2XCNA 1DDJA 2ZF0H 1YPEH 1C5TA 1ZJDA 2BY8X 2D8WA 3VY5A 2GX4A 4FUDA 2FYRA 3N7DA 2Q6DA 1YOAA 1Z8IB 2RG3A 1OWJA 2RA0A 1HLTH 2ZFQH 3MYWA 4IGDA 5I46H 2H5CA 1GHBG 2ARZA 1P2KA 1UK2A 3BTFE 1TGSZ 3ZV9A 2C8ZB 4WVPE 5CE1A 1E37B 1NY22 4U2WA 1ETRH 1CA0C 2CK3D 1S6FA 2V3MA 2VWMA 2ZI2H 3BTDE 3C1KA 3SHCH 1DOJA 1GJ9B 1IQNA 1S0QA 2JETC 2J92A 2J2UA 2I6QA 1TMUH 2BB4A 3EQ0H 1AU8A 2QXHA 1TFXA 4Y0ZE 1SR5C 4ABFA 3T28A 1USFA 3GOVB 3P8NA 3RXLA 2ZTXA 1GBIA 2JKHA 1QL9A 3DMBA 1ESAA 1G3EA 3KF2A 5AFYH 4D7GA 1M9UA 4RI0A 4NIWA 1QRZA 1CBWC 3IG6B 3KQDA 4IW4E 1TNLA 2KZ4A 4WJG2 3T27A 1YC0A 3ZZ8A 1HAXB 1ZMLA 2C4FH 5CHAC 4TWWA 1ELCA 2G52A 2P8OC 3M7QA 1GMCF 3ELAH 5C1XA 4ISNA 2EC9H 2P8OB 3ZOCA 2YMSD 1K9OE 1EAWA 2ILNA 5LGOA 1P0SH 1GDUA 1MD7A 1O3PB 1A5GH 4X2WA 1W7GH 3ZVGA 1HGTH 1BTUA 3PLPA 4KTUA 3MOCA 3SJIA 1W3RA 3MU0A 1TBQH 4FUHA 2D36A 2PGQB 1A7SA 3PMHB 3EYDA 1C1NA 3TK9A 1VITG 2F3CE 3SUFA 2QCYA 4FU9A 2X1KA 3DSGA 3GASA 1WLKA 2Q9KA 3KQEA 1PQ7A 1TOCB 2PW8H 2OU5A 2C8WB 4JCNA 1NPMA 3PLKA 1GI6A 3PB1E 1A3BH 1GJ8B 1ELDE 1COWD 4B1TA 5DN6D 5FHTA 3U0IA 1G36A 1TPPA 2STBE 3OU0A 1C5NH 6ESTA 3BV9B 1SGQE 3SU3A 1A4WH 3MH7A 3VGCC 3A7TA 1BTZA 2FI4E 1TRYA 1TBRH 1O2MA 1XM1A 2OK5A 3F2FA 1A1RA 1VCWA 3TIUA 3VGCB 1ZOMA 5GCHF 1NO9H 1TE0A 1TPAE 5HXFA 4MG3A 1Y3YA 2SGAA 5A0CA 5FAHA 3BG8A 3PRBA 3PO1C 3ZVCA 3K2UA 3N99A 3Q77A 4OM9A 1GI0A 2O9QA 3DA9B 1XX9A 1ZPCA 2A32A 5TCAA 1PPZA 1SI5H 2EA3A 1O31A 1O3DA 3A6QA 1MKXH 4X2XA 1VGCC 1OSSA 2HVYB 2ZHWH 4SGAE 1TGNA 1S81A 3GYMA 2BXTH 1VGCB 1HDTH 2L6OA 2R0XA 1S6LA 2ESTE 3A20A 1OHHD 1Y59T 1GHBF 1QA7A 2WV9A 1GDQA 1GJCB 1ELTA 1LHDH 2ULLA 3GY2A 2NU3E 3T2NA 4AC9A 1WUNH 3N7OA 1FPCH 3A82A 5BRRE 2OD3B 5L30H 2F9PA 1KTTB 3OX7U 2AMDA 4ISHH 4WMFA 3ZZAA 3SUDA 1GBTA 1FZZA 4X1SU 3F2GA 4K1EA 3TJVA 2ODQA 4TT3D 2Z9IA 1O3IA 4ZKSU 2QF3A 2ANKH 1O2RA 2A4QA 2QYIA 4UE7H 2ZCKP 5CHEC 3UPEA 4H6SB 4LOYH 1C5SA 1UVTH 2CV3A 1HUTH 2BM2A 1EAIA 2OC8A 4MVNA 1FJSA 3SU6A 5CHOA 3BN9A 4RN6A 2OBOA 2VIOA 3U1JB 3AK5A 3MU1A 1O2ZA 2QXJA 1FI8A 1LPZB 2P59A 2ZU2A 3M36A 2I02A 1O3FA 4K8YA 2F83A 2ZP0H 1YM0A 2JH5D 5B6OA 3KL6A 3TGJE 2I6SA 2R3YA 3U69H 4J1YA 2WPLS 2IJD1 3SWJA 1HJ9A 4HMWA 4K3JA 3RXMA 3KN2A 3GCTG 3HGPA 3CP7A 1FLMA 3RLWH 1Z7KA 3M35A 2F9VA 1KIGH 1O2YA 3SW2B 2FLRH 1O34A 3MI4A 2A4RA 3Q3XA 5C1UA 1WSSH 1VITF 4UHVA 3K65B 2NU2E 1IQJA 1NT1A 4KGAA 3H5CB 4ABIA 4BOHA 3S0NA 4K2YA 2AMQA 5EU8A 1TNGA 1GHYH 2P93A 4UFEH 3KYGA 3GISB 4F4OC 1KDQA 2M5TA 5FCRA 4FETA 3V4HA 3GCOA 1FIWA 4X0WU 4ABDA 3WW7A 4DY7B 4OS2A 4H6TA 2ZHQH 4A7IB 3A8BA 4WH8A 2XC5A 1W7XH 2PGBB 4ASUD 5DP9A 1GGDC 2BY6X 4W64A 3P70B 5TJXA 3D23A 4THNH 3RM0H 1O2UA 1GGDB 2ZTYA 2O8TA 1ESBA 3ZVBA 3LONA 5AF9H 5C67A 2B5TB 5LPEA 1L1GA 2AIQA 4Y7BA 2GV6A 2OLGA 2HNTE 1T32A 1EX3A 3SV9A 4O97A 1AB9C 1PJPA 2BZAA 2FX6A 3RUOA 1W11U 2TGDA 5CHBA 1QZ8A 5GWZA 1YPKH 1NBMD 1G2MA 1E1QD 1NRRH 1SHYA 1BMLA 4DOQA 2HRVA 4NZQA 1GBFA 2VU8E 3SHAH 1W3OA 1NESE 4KELA 3URDA 4Q7ZA 4CH8B 2A7CA 3QGNB 2E83A 3F1SB 2PLXA 1S0RA 1SGFA 1D4PB 3TVJB 1O2GH 1SGFG 3PYHA 4YT6H 3K86A 1BJVA 3STIA 4LK4A 2TBSA 4K1TA 4XD7D 2WINI 1SGNE 5F53A 1OKXA 2GT7A 3PMAB 1LHFH 3NRLA 5A0AE 5C3NA 7LPRA 2WPKS 5FCKA 3A8AA 3D62A 1UW7A 2BY5X 1DFPA 1TRMA 2ZG0H 3SV8A 3PRDA 2CHAB 3BG4B 1Y3VA 1C4U2 2GT8A 5AHGH 3FO8D 3KGPA 1DITH 3SBKA 3SNBA 1KXBA 3R5YA 1RS0A 1GHAG 2FM2A 4LZ4B 2EQNA 3SNEA 2H2ZA 1P3EA 3WWFA 3NWUA 2FI5E 1OOKB 3AVZA 5J4SA 5JABA 1O2JA 3PWCA 3B9FH 3OEED 2OC1A 4Q7YA 2W7SA 1C1QA 4FOUC 2P16A 1C5WB 2FS9A 4I8HA 4A1XA 3UREA 1O30A 1EKBB 3GCTF 4MTKA 3VFEA 1GVLA 1C2EA 1DY8A 1MCVA 3UY9A 4ZROA 1YP9A 2J5UA 1NFXA 4I8JA 3V12A 4IMZA 1V2VT 3STJA 1O3LA 3R0FA 3IN6A 2IABA 2SGEE 2GV7A 4FUFA 1INCA 2AERH 3ESTA 1MTSA 1WU1A 3Q3KA 1GBKA 1YCPK 2Y7XA 4YLUA 1HAVB 1MZAA 4XFQA 2LPRA 1THRH 2QF0A 3TLOA 1EJAA 1YYY1 1BBRE 1YGCH 2BD9A 1EZSC 1TALA 1GPZA 1WDIA 2C8XB 4GAWA 4Z85A 3TNTA 2BQ6B 5L2YH 4JZIA 2XOKD 1FPHH 4X6MA 1O3KA 4OGYA 4BXWA 4K69A 1ZSJA 1GJBB 2SGQE 1SKYE 1NU7B 3RP2A 2Z9KA 3OTPA 3DNHA 1DVAH 3TK5A 2WV5A 3SJ9A 3F9FA 2FPZA 2F43B 4JZDH 3LGVA 1OYQA 1K1JA 1AHTH 5AFZH 2NWNA 1JBUH 1LHGH 2NU1E 1EOJA 1L2EA 1HAOH 1QHRB 1Y3XA 5EPYA 2FODA 5GXPA 3QZQA 5HM9A 3RU4E 1N6YA 2BLOA 5EOKA 3V0XA 3LH1A 1KYNA 3OEHD 3GY3A 3S9BA 3F0OA 1CGJE 2F9NA 1C2IA 1SHHB 1KXCA 2ZPSA 5EODA 1BHXF 3MH5A 1YPHC 3SNCA 1H8IH 3VB3A 4ZMAH 5E8EH 1XUGA 4X1RU 5JB8S 4INHA 2H5DA 5EQQA 1XUKA 5HMAA 1DNLA 3SORA 1C2GA 1SC8U 3W94A 2TGAA 1IAUA 4Z0KA 1TB6H 1SQRA 1TWXB 3PV5A 2GJGA 1WXRA 1QL8A 3L3TA 3LT3A 2FEQH 3PTBA 4MPWA 2CXVA 3E0PB 1F0RA 2A45B 4CBNA 2KCYA 1CHOG 3F9GA 1VITH 1ZTLA 2GZ9A 2GCTC 2BD4A 2DE8A 1GJDB 3V7TA 1EPTC 1TPSA 3GDVA 4UFGH 1P04A 5ESTE 4DG4A 2Q1JA 2GCTB 4N7RC 5EG4A 1GJ4H 3SV6A 5T3HA 2ZU3A 1QJ6B 1AWHB 4AFSA 1O0DH 2WPMS 6CHAC 1Y12A 1Z8GA 3ATLA 1O5CB 3DFLA 1UTNA 2KFWA 1V2TT 2H9HA 3ATKA 1HAIH 1GHAF 1C4Y2 1WBGB 1UTMA 2PWXA 2BZ6H 1C2LA 3Q3YA 3UFAA 3ODDA 1G79A 3QN7A 2A0QB 4A1VA 3P8GA 1TYNA 2PKAA 3SZEA 1Z1IA 1C2KA 2ZHFH 2X1JA 3RXTA 3AWHA 3SUEA 1GVZA 1H8HD 2ZPRA 2D26C 3I77A 1RZ1A 2GZ7A 3S9CA 1YWUA 2PTCE 3CP3A 2AS9A 2LP6A 2F9OA 1FUJA 1HAGE 2ZNKH 3W95A 3UUZA 2VIVA 1C5ZB 2Z9GA 1ANCA 1VJ9U 1YPHE 4OS4A 3AASA 1K1NA 6LPRA 3CNRA 3UNRA 1XHNA 1QY6A 5A2MH 1UJ1A 4X1NU 2PR3A 2FIRH 3ZZBA 1AUTC 1E79D 4NWLA 3QDZB 3ZVAA 3Q76A 5ESCA 3RXSA 1G2LA 1P05A 4Y79A 1C1TA 1PPEE 2FOAA 2FOHA 2HQ9A 2W6ID 4FUEA 1DS2E 1OP0A 2ZDMA 3RXGA 5EGMA 1BTYA 1GI1A 3E8LA 1P2OA 7GCHG 5FPYA 1C5OH 2W7UA 4RKJB 4A1TA 1YF4A 2C93B 1ZLRA 2G5NA 2W3KA 2FWWA 1N8OC 2ZU4A 1PQ5A 3DFJA 1G9IE 2HGTH 1KXFA 1K1OA 2W26A 4D9RA 2RDEA 1N8OB 3UIRA 4MNVA 2SNWA 1HV7A 4DW2U 1HNEE 4DT4A 2XBWA 5EQRA 2BDYA 2G5VA 2XTTB 1S84A 1EPTA 1L4DA 2HALA 4AB8A 2YMSC 1V2MT 2ZKSA 1BBRK 1YY3A 1F0SA 4YM9A 1TQ0B 2SGPE 1PPHE 1QA0A 2BVSH 4MPXA 8KME2 3U1IB 1GI4A 3U9AH 1C2JA 3A85A 3R5ZA 2A7HA 3SO3A 1P2QA 3AAUA 4CRGA 1UHBA 5IDKA 4XBBA 1MTNC 3NKKA 4Y11E 1TMBH 3ZZDA 3W1EA 1AVGH 4IS5A 5EJZA 1MTNB 1DWCH 1QB6A 2RDLA 3FKHA 5C1YA 3ATIA 1V6DA 1SQOA 2GVFA 2P94A 5T6DA 1XUJA 1CHOF 2VNTA 2KAIB 1AE5A 1O2OA 1BRCE 2F9UA 4I8KA 3A7WA 1J16A 3SGAE 4HZHA 4Y76A 3TJUA 1SMFE 1GHXH 2EEKA 1TPOA 4Y71A 2BXUH 4IC5A 1NC6A 1ZRBA 1W9AA 4X8SH 5E0GA 5EIYA 1E38B 1WLIA 3KQ5A 4WMEA 1C2FA 3KNXA 1V2NT 3VB5A 3TU7H 3BTGE 2YNAA 3VEQB 1BMNH 1P8VC 1RTKA 3CENA 3IWMA 1GBDA 4B76A 5CDFE 2JH6D 3ZZ6A 1B0FA 1AQ7A 1N6XA 4Y8ZA 2G4UA 1MBMA 3E16B 1P06A
chains in the Genus database with same CATH topology
4F48B 2HQ9A 2IMLA 3U35A 1G77A 3A6RA 5CHOA 4IRAA 4HMXA 1VL7A 3R5RA 2X1KA 1W3QA 3AMFA 5EJLA 3DSGA 3B5MA 3GASA 1W3PA 2I02A 1WLKA 4ZKYA 2D37A 2L74A 5BNCA 2Q9KA 2ECUA 2OU5A 2RE7A 1RZ0A 4F07A 3SWJA 4YWNA 4HMWA 4XJ2A 2AQ6A 3R5PA 4Y9IA 3U0IA 1T9MA 2HTIA 1FLMA 1DNLA 3VY2A 3F7EA 3RH7A 3BPKA 2VPAA 3NFWA 3VY5A 1WV4A 1YOAA 3R5YA 1I0SA 2GJGA 3FGEA 2RDEA 2HHZA 3BNKA 3HMZA 3R5WA 2HQ7A 2QCKA 3U5WA 2ARZA 3EC6A 1AXJA 3H96A 5JABA 2I51A 4QVBA 2FURA 3U34A 3ZOFA 2ED4A 1NRGA 1G76A 3PFTA 4FOUC 3KYGA 4HMTA 4P02A 2FHQA 1EJEA 4P00A 4YBNA 2ECRA 1JNWA 4N7RC 3ZOEA 3R5ZA 4HX6A 1USFA 2D38A 3A6QA 3TGVA 3DMBA 1Y30A 4HMSA 4XHYA 2FG9A 2ASFA 2R6VA 5KEDA 3IN6A 2IABA 3E4VA 5EJZA 1G79A 2R0XA 3A20A 3FKHA 2HTDA 3ZOHA 3KYFA 5EJ1A 4R82A 2X1JA 1G78A 3AWHA 4RT1A 1I0RA 2OL5A 5KECA 1RFEA 2A2JA 1USCA 3K88A 1RZ1A 1WGBA 4Z85A 3CB0A 1YWUA 3ZOCA 1XXOA 3CP3A 4HMUA 1W9AA 5EIYA 2NR4A 3DB0A 3VYAA 4XRNA 3HY8A 1WLIA 3ZOGA 3CNRA 4HMVA 1XHNA 1W3OA 4L82A 1CI0A 3ZODA 2E83A 5CHEC 4I86A 1TY9A 4HG6A 3DNHA 2D5MA 1YLNA 3BA3A 2QEAA 2IG6A 5ESCA 4RT0A 3K86A 1W3RA 3K87A 3R5LA 2PTFA 5KGOA 2D36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F48 B;  2HQ9 A;  2IML A;  3U35 A;  1G77 A;  3A6R A;  5CHO A;  4IRA A;  4HMX A;  1VL7 A;  3R5R A;  2X1K A;  1W3Q A;  3AMF A;  5EJL A;  3DSG A;  3B5M A;  3GAS A;  1W3P A;  2I02 A;  1WLK A;  4ZKY A;  2D37 A;  2L74 A;  5BNC A;  2Q9K A;  2ECU A;  2OU5 A;  2RE7 A;  1RZ0 A;  4F07 A;  3SWJ A;  4YWN A;  4HMW A;  4XJ2 A;  2AQ6 A;  3R5P A;  4Y9I A;  3U0I A;  1T9M A;  2HTI A;  1FLM A;  1DNL A;  3VY2 A;  3F7E A;  3RH7 A;  3BPK A;  2VPA A;  3NFW A;  3VY5 A;  1WV4 A;  1YOA A;  3R5Y A;  1I0S A;  2GJG A;  3FGE A;  2RDE A;  2HHZ A;  3BNK A;  3HMZ A;  3R5W A;  2HQ7 A;  2QCK A;  3U5W A;  2ARZ A;  3EC6 A;  1AXJ A;  3H96 A;  5JAB A;  2I51 A;  4QVB A;  2FUR A;  3U34 A;  3ZOF A;  2ED4 A;  1NRG A;  1G76 A;  3PFT A;  4FOU C;  3KYG A;  4HMT A;  4P02 A;  2FHQ A;  1EJE A;  4P00 A;  4YBN A;  2ECR A;  1JNW A;  4N7R C;  3ZOE A;  3R5Z A;  4HX6 A;  1USF A;  2D38 A;  3A6Q A;  3TGV A;  3DMB A;  1Y30 A;  4HMS A;  4XHY A;  2FG9 A;  2ASF A;  2R6V A;  5KED A;  3IN6 A;  2IAB A;  3E4V A;  5EJZ A;  1G79 A;  2R0X A;  3A20 A;  3FKH A;  2HTD A;  3ZOH A;  3KYF A;  5EJ1 A;  4R82 A;  2X1J A;  1G78 A;  3AWH A;  4RT1 A;  1I0R A;  2OL5 A;  5KEC A;  1RFE A;  2A2J A;  1USC A;  3K88 A;  1RZ1 A;  1WGB A;  4Z85 A;  3CB0 A;  1YWU A;  3ZOC A;  1XXO A;  3CP3 A;  4HMU A;  1W9A A;  5EIY A;  2NR4 A;  3DB0 A;  3VYA A;  4XRN A;  3HY8 A;  1WLI A;  3ZOG A;  3CNR A;  4HMV A;  1XHN A;  1W3O A;  4L82 A;  1CI0 A;  3ZOD A;  2E83 A;  5CHE C;  4I86 A;  1TY9 A;  4HG6 A;  3DNH A;  2D5M A;  1YLN A;  3BA3 A;  2QEA A;  2IG6 A;  5ESC A;  4RT0 A;  3K86 A;  1W3R A;  3K87 A;  3R5L A;  2PTF A;  5KGO A;  2D36 A; 
#chains in the Genus database with same CATH topology
 2GD4 B;  3BIU H;  5I25 A;  1IQH A;  3EAJ A;  2QF4 A;  3JZ2 B;  1G30 B;  2XWA A;  5EW1 H;  4ZHM U;  1W3P A;  1Z71 A;  5FXL A;  3ZZ7 A;  4LXB H;  4SGB E;  4E06 H;  3RXK A;  4ZCN A;  1V2K T;  3KQB A;  1ORF A;  4UD9 H;  1QBO A;  1V2R T;  1T9M A;  2ANW A;  2XCF A;  1DSU A;  3LH3 A;  1FNI A;  2ZQ1 A;  1AKS B;  2O8W A;  2W6J D;  3L6P A;  4ZKR U;  3A80 A;  3RXP A;  1QTF A;  3LKW A;  3UR9 A;  1I0S A;  4K8B A;  4E7R G;  1RD3 B;  2A31 A;  3HMZ A;  4Y6D A;  1G3B A;  1PPF E;  1ETT H;  1VR1 H;  1TX8 A;  4B6F A;  5LH8 A;  2XNI A;  4MPU A;  2FYQ A;  2TGP Z;  1A0H B;  3MWI U;  1SGI B;  5DKM A;  3RXV A;  1O5A B;  1F7Z A;  1P2N A;  4B74 A;  2PUX B;  4MTB A;  4YOJ A;  1LKB A;  1P12 E;  7GCH F;  1TX6 A;  3SU2 A;  4HMT A;  2GP9 B;  1C5P A;  2HOB A;  4K1S A;  2FHQ A;  2RFK C;  3JZ1 B;  1SLW B;  1DWD H;  1V2U T;  2GDE H;  4DUR A;  5JBB S;  1KSN A;  3TGV A;  2G51 A;  4FVB A;  1C5L H;  1EFR D;  1K1L A;  1NRN H;  2BLV A;  2VJ1 A;  4D9Q A;  4Z6A H;  4WWY A;  1H9I E;  5HM2 A;  3SND A;  5EPN A;  2ASF A;  3LC5 A;  1X7A C;  2KAI A;  2Z6B D;  1UTK A;  2CF9 H;  4X8V H;  2FMJ A;  5LPF A;  1KXA A;  1RJX B;  2OC0 A;  4O3T A;  4ASH A;  3ZOH A;  1XMN B;  1C2M A;  3P6Z B;  1WV7 H;  2OQ5 A;  1A46 H;  1P2J A;  1W0K D;  3UR6 A;  2UWL A;  1DIC A;  2A5I A;  1TGC A;  4ISL A;  4O3U A;  3VXF H;  1USC A;  4DIH H;  1RIW C;  3M5M A;  4NZL A;  1LVY A;  4CH2 B;  1C5M D;  3NK8 A;  3BEF B;  4HMU A;  4NSY A;  4XDE A;  4ZHL U;  1QR3 E;  3EDX B;  1RIW B;  1FDP A;  4JK5 A;  3SGQ E;  5EW2 H;  1ARC A;  5E0J A;  2IOT A;  3HY8 A;  5DP4 A;  4AYY B;  1PPC E;  1C1M A;  3QWC H;  1J8A A;  3M37 A;  1W14 U;  3QTO H;  1EAU A;  4A92 A;  2XRC A;  4HG6 A;  4KTS A;  2PKS C;  4TWY A;  4X1Q U;  3TNS A;  2BDB A;  3E1X B;  1SG8 B;  2PKS B;  1JIM A;  6GCH G;  1J14 A;  3M3S A;  1V2W T;  2BY7 X;  1H8E D;  3B23 B;  4HMX A;  1EAS A;  1YPJ H;  2ZDN A;  1T7C A;  1ELA A;  2STA E;  3FZD A;  1FIZ A;  4YOG A;  1BZX E;  1O3E A;  3SU5 A;  4H42 U;  1SGC A;  4CHA B;  5A09 A;  4HKH A;  1PFX C;  1AN1 E;  1MMJ N;  1KY9 A;  3CS0 A;  1E1R D;  2F9B H;  4D76 A;  1SVP A;  2FLB H;  4FUI A;  2ZFF H;  4I7Y H;  2ZWL H;  2A2X H;  1P03 A;  3SU1 A;  2FOE A;  3RXC A;  1H4W A;  2FOG A;  3BTE E;  1A61 H;  4CRD A;  3KID U;  1ZSK A;  4B2A A;  1CT2 E;  2V3O H;  4QT8 C;  2XXL A;  1P09 A;  1S6H A;  1YPG H;  2H9E H;  1BIT A;  1NFW A;  3ZOF A;  1BBR H;  2KX4 A;  5ABW A;  2ED4 A;  2EI6 A;  1V2O T;  1BTW A;  2XC4 A;  1UK3 A;  5AVD A;  1LVM A;  2OQU A;  1F5R A;  3M7U A;  1O5D H;  1HJA B;  1MTV A;  1Y3U A;  3V3M A;  2W3I A;  2BD2 A;  1OP2 A;  4X8T H;  3A88 A;  3E91 A;  1NFY A;  2H6M A;  5DK1 A;  3FKS D;  1NRQ H;  2FS8 A;  5SGA E;  2WYG A;  1ARB A;  1TA2 A;  1Y30 A;  4EST E;  3SQH E;  1GDN A;  3MQK C;  2ZDK A;  1QIX B;  1O3G A;  4RSP A;  1HCG A;  5DJ7 A;  1V2S T;  1WYK A;  1FMG A;  1ABJ H;  1GI9 B;  2H9T H;  4ZAE A;  1TNJ A;  2VWL A;  1I0R A;  1P3C A;  2PP6 A;  5H4I B;  1TX7 A;  2R2M B;  1HXF H;  3K88 A;  1QNJ A;  3GCH B;  2IN2 A;  2PHB A;  4BAQ B;  4X2Y A;  3A83 A;  3H09 A;  3D49 H;  4NIX A;  3BTM E;  1GBB A;  2RA3 A;  1W12 U;  5FX5 A;  3ZVF A;  5E2P A;  4BAM B;  4YZU A;  4NFF A;  4Q4L A;  1YLC A;  3KEE A;  3HE1 A;  5JDU B;  1WAY B;  4X8U H;  4BXS A;  2EI7 A;  4H4F A;  3F6U H;  1ZPZ A;  2XC0 A;  1PQA A;  1P02 A;  1AY6 H;  1RXP A;  2NU0 E;  2Y80 A;  3ITI A;  2IPH A;  1NBM E;  1P9S A;  3SYJ A;  2L74 A;  1XVO A;  3GDS A;  4IBL H;  1IQF A;  3FFG A;  2Q6F A;  1DAN H;  3ATM A;  5JYI A;  5A0B A;  1ELV A;  1FN8 A;  2R0L A;  4OS6 A;  3S9A A;  1UTJ A;  1P10 A;  1JOU B;  3F7E A;  4TV4 A;  4NA9 H;  1NRO H;  4K5Z A;  5B6L A;  1W0Y H;  2R3U A;  1O37 A;  3FGE A;  2Y5G A;  2ZDL A;  3F9H A;  6GCH F;  1A5I A;  1UTO A;  4JYU H;  2HQ7 A;  1WQS A;  3ZYD A;  1S85 A;  4NSV A;  3OE7 D;  4DII H;  2I51 A;  1EB2 A;  2KCO A;  2R0K A;  1C1S A;  1Q2W A;  2CHA C;  1K28 D;  1V2P T;  1EB1 H;  3BG4 C;  5G4B A;  3RXE A;  3S7K B;  1H9L B;  3SJK A;  1D3P B;  2KM0 A;  3ZZ4 A;  2FI3 E;  1Y5B T;  4K60 A;  4M9F A;  4CRB A;  2VH6 A;  3ZOE A;  1MD8 A;  4FUG A;  1AUJ A;  1KTS B;  4Q2K A;  1F2S E;  2XWB I;  1SQA A;  1JRT A;  5K0H A;  4AOR A;  2OTV A;  3RXA A;  5K7R A;  1YLD A;  1IHS H;  1GI8 B;  1OWI A;  3E4V A;  2A5K A;  1Y5A T;  1HRT H;  1O5E H;  1GBJ A;  1K1P A;  2WPD D;  3N7E A;  3ZZ3 A;  2HWL B;  1HB0 B;  2VH0 A;  2P95 A;  1C2H A;  2BVR H;  1FY4 A;  3GY4 A;  4Y7A A;  1ELE E;  1CT0 E;  5ETX A;  1NZQ H;  4ZXY H;  2FOB A;  2FO9 A;  2WYJ A;  1C4V 2;  3E3T A;  2A7J A;  3EE0 B;  2HVX A;  1A5H A;  1ACB E;  1H9H E;  1T4V H;  1OX1 A;  1ZTK A;  2J9N A;  3AAV A;  1GBE A;  5EXN A;  2RCE A;  1EZU C;  1SGT A;  2BLQ A;  1IQI A;  1G3D A;  4YES B;  4ZUH A;  4CR5 A;  2ZGX H;  2G81 E;  4XRN A;  3RML H;  3V13 A;  4BAO B;  1V2Q T;  2KCP A;  1CO7 E;  2Y7Z A;  1ELB A;  1SPJ A;  5C2Z A;  1FY1 A;  2LNC A;  5L6N H;  1Z8J B;  2VID A;  1Z6J H;  3RXJ A;  1O33 A;  4Y8X A;  2IG6 A;  4NFE A;  4RT0 A;  5FPT A;  1HAP H;  4GPG A;  1SOT A;  4DJZ B;  3CS7 A;  4DGJ A;  2Z9L A;  4FUB A;  1Y8T A;  2GZ8 A;  1IQG A;  1BMF D;  4F48 B;  3U35 A;  2ZHE H;  5FX6 A;  2Y6T A;  1EAT A;  2ZC9 H;  3L33 A;  4HGC A;  3TGI E;  2VVV A;  3NCL A;  2FZZ A;  4ZKY A;  3VPK A;  3M5O A;  3F0P A;  3TIT A;  4F07 A;  2J94 A;  1WQV H;  4YWN A;  5JBA S;  2BX4 A;  1C5Q A;  2BDI A;  3ENS B;  3HK6 B;  7KME H;  1MUE B;  1UMA H;  1NRS H;  3IIT A;  4D8N A;  1W2K H;  1YCP M;  1ANE A;  2Q6G A;  1HAH H;  1KMH B;  4CRE A;  3AW1 A;  1NN6 A;  2QE7 D;  2ZGJ A;  3OYP A;  2AFQ B;  2QCK A;  3OTJ E;  2HPP H;  3TH2 H;  2O8U A;  1TGB A;  4QVB A;  2Y82 A;  2OIN A;  2OXS A;  1TGT A;  2ZA5 A;  2G4T A;  9LPR A;  3PV4 A;  4NGA H;  2PUQ H;  1UCY K;  4ZXX H;  1C1R A;  3VB4 A;  1BIO A;  1L4Z A;  3RXF A;  1G32 B;  1SBW A;  1XXD A;  3DSO A;  3MTY A;  2K0Q A;  5A8X A;  2V7Q D;  4HX6 A;  1RGQ A;  2KR7 A;  2OCV B;  1VJA U;  2H1U A;  5JBT A;  2ODP A;  3MNC A;  1VCP A;  1QCP A;  1K22 H;  1TMT H;  2C8Y B;  2HTD A;  4AX9 H;  1O5G H;  1PPG E;  5F8T A;  5EJ1 A;  2GMT B;  1UO6 A;  5L2Z H;  1UTP A;  1GJA B;  1SOZ A;  3A7Y A;  1QFK H;  3EGK H;  4BTU B;  5JBC S;  1W0Z U;  2B8O H;  2UWO A;  1O2T A;  2G55 A;  4X1P U;  2OP9 A;  2A5A A;  2SGD E;  1E35 B;  2GTB A;  3OY5 U;  1ZTJ A;  4CR9 A;  1HAV A;  3LGY A;  3PLB A;  1O2H A;  1HAY B;  4UEH H;  1FY8 E;  4F55 A;  4L82 A;  2V0B A;  4ISI H;  5GDS H;  5A8Z A;  7EST E;  3H7O A;  1AZZ A;  2TGT A;  2ZO3 H;  3WY8 A;  1MU6 B;  2NU4 E;  3A8C A;  3BEI B;  4KTC A;  4O03 A;  3VB7 A;  1YLN A;  5C94 A;  1DWE H;  1AFE H;  5T1V A;  4TY6 A;  3P92 A;  1QRW A;  2BMG B;  4HI3 A;  3DD2 H;  1EUF A;  2ODY B;  1NS3 A;  5C5O A;  4BAN B;  3LIW A;  4IRA A;  2VIQ A;  3SU0 A;  2JH0 D;  1O3C A;  3R5R A;  2WPJ S;  3GY5 A;  1W3Q A;  3AMF A;  1O39 A;  1TNH A;  3B5M A;  1KLT A;  2D37 A;  2YNB A;  1IQE A;  2ZQ2 A;  3MO3 A;  1C1U H;  3BTW E;  1JMO H;  4KP0 A;  1D6R A;  4XJ2 A;  3R5P A;  1DX5 M;  5C20 A;  1SGY E;  3RM2 H;  1THS H;  1L0Z A;  4Z1M D;  1SLX B;  3RH7 A;  3SOS A;  1Y3W A;  2G00 A;  4DVA U;  2ASU B;  2OBQ A;  2ZEC A;  2PSY A;  4MQA A;  1RFN A;  1WCZ A;  1CT4 E;  4ZKN U;  3DUX H;  1HFD A;  1MU8 B;  1MKW K;  1ZSL A;  1W13 U;  2K4Q A;  3SV7 A;  4CRF A;  1FXY A;  3U5W A;  4X6N A;  3EC6 A;  3ZYE A;  1FON A;  1AVW A;  3G01 A;  3C27 B;  2BLW A;  1SL3 A;  4A6L A;  3HKJ B;  1QGF A;  1RRK A;  4NWK A;  3KHV A;  1Z1J A;  1NRG A;  1UK4 A;  3HAT H;  5DG6 A;  3UOP A;  3E90 B;  1A0J A;  1WTH D;  1HBT H;  1BA8 B;  3RMN H;  1GMH F;  5DP8 A;  2VIN A;  4P00 A;  3T26 A;  1MTW A;  4YBN A;  1JNW A;  3A84 A;  1CSO E;  4UFD H;  1ELG A;  3O8B A;  2FP7 B;  1EZX C;  3U98 H;  3VG8 A;  1DXP A;  2Y5F A;  3LDX H;  4BNR A;  1O36 A;  2FG9 A;  1C5Y B;  2R6V A;  3HGN A;  4JK6 A;  2XBX A;  3LJO A;  3UWI A;  3AW0 A;  1EQ9 A;  1JIR A;  1MCT A;  2JDI D;  1IQK A;  2DUC A;  1ELF A;  1O2W A;  1NFU A;  5C5N A;  3RC6 A;  1H1B A;  1LPK B;  3O8C A;  1IOE A;  1WGB A;  4OS7 A;  4PRO A;  4JZF H;  5GPI B;  4U01 A;  2A1D B;  4HFP B;  3LGW A;  1AGJ A;  2BQW B;  2IPQ X;  3M61 U;  3SV2 H;  5GIB A;  2QA9 E;  2ZFS A;  4GCH F;  4ACB A;  1CHG A;  2V3H H;  1GVK B;  4XBD A;  1CE5 A;  1CI0 A;  3LPR A;  4AOQ A;  1YCP H;  4M7G A;  3GIC B;  1HXE H;  4NCY A;  1YPM H;  5EQS A;  1O2L A;  2BD7 A;  2R9P A;  4VGC B;  2FTL E;  2AGE X;  4YTA A;  1DUA A;  1ZHP A;  3QUM P;  1B0E A;  2ZU5 A;  2DE9 A;  3LGI A;  1GL1 A;  3FP8 E;  4Q80 A;  1PYT C;  3FAO A;  4Y8Y A;  3F68 H;  3F9E A;  1KXD A;  2TPI Z;  1S83 A;  2ZFR H;  3RXR A;  2W5E A;  2ECU A;  5C0T A;  5J4Q A;  1EZQ A;  5E2O A;  2AQ6 A;  1BRU P;  4Y9I A;  3Q00 A;  1CA0 B;  2Y5H A;  5F6M A;  1Y5U T;  1S82 A;  4MNY A;  3QLP H;  1DLE A;  3BTK E;  3QX5 H;  1SGR E;  1FN6 A;  3BPK A;  2FOC A;  2JET B;  1BMM H;  3DT0 H;  2VPA A;  4UFF H;  1SQT A;  4NA7 A;  3MO6 A;  3PTN A;  1ZPB A;  2HHZ A;  2ZTZ A;  1TNK A;  3GY6 A;  3RXD A;  3R5W A;  4Y0Y E;  4FVD A;  1QUR H;  1GBH A;  3PMB B;  2J98 B;  3SQE E;  1CBW B;  2ZPQ A;  3U34 A;  2GDD A;  2GUJ A;  3HKI B;  3RU4 T;  3DSP A;  1L1J A;  3K6Z A;  4AN7 A;  1UCY H;  2ZGB H;  2J38 A;  2BY9 X;  3A7V A;  1FY5 A;  3A7Z A;  2PSX A;  5CHA B;  5ESB A;  2GGV B;  1FV9 A;  4FUC A;  3K9X B;  1GHZ A;  2J97 A;  3BTH E;  1LVB A;  4B6E A;  2ALV A;  3PMJ A;  4B2C A;  2PFE A;  2VBC A;  4UON A;  1DPO A;  2CJI A;  2V6N A;  1WTG H;  4GLY A;  1N1L A;  1DT2 A;  3SGB E;  4DCD A;  1QBV H;  1AFQ C;  3OAA D;  1AMH A;  2C3S A;  3QO6 A;  1P9U A;  3HPT B;  1O2X A;  1AFQ B;  1RFE A;  1PYT D;  2QY0 B;  1BRA A;  1GCD A;  4YLQ H;  2BOH B;  1BMA A;  5HYO A;  3MU4 A;  2WV4 A;  1TNI A;  1BUI A;  2CGA A;  2VIW A;  3TJN A;  1CA8 B;  1OWH A;  1UTQ A;  1W0J D;  3DB0 A;  4WY3 A;  3VYA A;  5FBI A;  8GCH G;  3A8D A;  4HMV A;  1K2I 1;  4BTI B;  3RLY H;  5LPR A;  1C1V H;  2JJ1 D;  1O38 A;  9EST A;  1D9I A;  4AGK A;  1TY9 A;  1O3M A;  4X6P A;  1ZMN A;  2FOF A;  4E7N A;  3T62 A;  2O8L A;  5EXM A;  1LDT T;  2P5Z X;  4R0I A;  3R5L A;  3LU9 B;  1MAB B;  5BNC A;  1QB1 A;  3S7H B;  1O3J A;  1O5B B;  3MH4 A;  1WOF A;  3MU5 A;  3MMG A;  4FUJ A;  2VWO A;  4WMD A;  1ZGI A;  3BSQ A;  1O2I A;  2BDH A;  2R2W U;  1QRX A;  3EA8 A;  1EP6 A;  1LQD B;  1C2D A;  2XND D;  3NUM A;  4OGX A;  4ABB A;  2RE7 A;  1RZ0 A;  1Z6E A;  1V2L T;  3OSY A;  2THF B;  4MNW A;  1HJ8 A;  2HTI A;  4B2B A;  2UUF B;  3SI3 H;  4XOJ A;  3PO1 B;  4YOI A;  8LPR A;  1KLI H;  1ZR0 A;  3UNQ A;  2FXR A;  4R8T B;  3NFW A;  2J98 A;  3TGK E;  1TON A;  4MPV A;  1P2I A;  1MKW H;  1KDQ B;  1FX0 B;  4AYV B;  1EXF A;  1MTU A;  3E6P H;  3LC3 A;  2A2Q H;  2YOL A;  2ZGC A;  2BHG A;  1HAZ B;  1D6W A;  1CGH A;  1EOL A;  3QZR A;  4E05 H;  3T5F H;  4CHA C;  4AFQ A;  1OYT H;  1AKS A;  2A4O A;  2ZU1 A;  2KCA A;  4AG1 A;  3EA9 A;  4DT7 B;  1UVP A;  2GKV E;  1SLV B;  1EAX A;  3EE7 A;  3RXB A;  5DSF A;  5CMX H;  1XKB C;  2P3F H;  2WUC A;  1EJE A;  2D1J A;  3UB0 A;  2HLD D;  4ZKO U;  1PQ8 A;  1P01 A;  2QXG A;  3ATW A;  1P11 E;  1BTX A;  1DLK B;  1V2J T;  5KED A;  3RMM H;  3TH4 H;  3NPS A;  4X6O A;  2FDA A;  4I33 A;  4B71 A;  1ABI H;  2J95 A;  1BHX B;  2Z3D A;  3M3V A;  1HJA C;  1BB0 B;  1QJ1 B;  5FL7 D;  3A7X A;  1L1N A;  1FY3 A;  1VKY A;  4NIV A;  1BTH H;  3TH3 H;  1GI2 A;  1QBN A;  2CN0 H;  1XKA C;  1H8D H;  3UTU H;  1O2V A;  2J34 A;  2UUK B;  1QL7 A;  5JPM H;  2HNT C;  1W3C A;  3F2H A;  2ZEB A;  5E0H A;  3FP7 E;  1ZRK A;  2NR4 A;  2HPQ H;  3EA7 A;  2GCH G;  1O5F H;  1ZYO A;  3ZOG A;  2BX3 A;  5DP6 A;  1C9T A;  1QQU A;  2EY4 C;  1DY9 A;  2BYA X;  1G3C A;  4X2V A;  3NXP A;  3URC A;  4I86 A;  1SB1 H;  3GCH C;  4I31 A;  4BAH B;  1A0L A;  3VB6 A;  3DHK H;  5GJ4 B;  3SUG A;  1AWF H;  3RXU A;  1UTL M;  1T8O A;  1UCY E;  2QAA A;  1XXF A;  2IML A;  1G77 A;  1T8N A;  5JB9 S;  1K1I A;  3A89 A;  4NIY A;  1KXE A;  3U28 C;  2QXI A;  4ZH8 A;  1T8L A;  2QC2 A;  5T6F A;  2UUJ B;  2JIZ D;  4ACA A;  1GCT C;  5TCC A;  8GCH F;  5HKK D;  1GI5 A;  2AEI H;  1GCT B;  4FU8 A;  1RTF B;  2JJ2 D;  5C17 A;  2Y81 A;  3ODF A;  4GSO A;  1O3O A;  1FAK H;  2ZFT A;  1NU9 A;  2CMY A;  1E36 B;  4OS1 A;  1WV4 A;  1GJ5 H;  4ISO A;  4JMY A;  4JZE H;  1XUF A;  1VZQ H;  4YT7 H;  2UWP A;  2WSS D;  4TYD A;  2QN5 T;  3MNB A;  2FUR A;  1LTO A;  4KKD A;  3D65 E;  1OXG A;  1U6Q A;  2K8I A;  1NM6 A;  1G76 A;  3PFT A;  2VB0 A;  1P57 B;  3MNS A;  1F92 A;  4WH6 A;  2VIP A;  5BPE A;  1OPH B;  1HPG A;  5PTP A;  1OS8 A;  4P02 A;  1V3X A;  3ZVD A;  2ZDA H;  1K0H A;  3OFN D;  1JWT A;  5EXL A;  1K1M A;  1Q3X A;  2B9L A;  3ZZC A;  4O9V A;  1AB9 B;  2A4G A;  1AVX A;  1DE7 H;  1BCU H;  4HMS A;  1C9P A;  1C5X B;  2Z3C A;  1NTP A;  5F8X A;  1LHC H;  3GDU A;  3S69 A;  1AE8 H;  5HGG A;  3RXQ A;  3WWB A;  5C0U A;  3H7T A;  1GJ6 A;  1O2Q A;  1OWK A;  1A2C H;  4GUX A;  2OL5 A;  1GJ7 B;  1BQY A;  3UWJ H;  5FPS A;  1GMD G;  1O32 A;  3GYL B;  1BDA A;  4B75 A;  3RC4 A;  1CU1 A;  3SZN A;  2WZQ A;  3GY8 A;  1CGI E;  4A5T S;  4D7F A;  1TRN A;  3RC5 A;  1BOQ A;  2QIQ A;  1OP8 A;  1SGP E;  3UAI C;  1IQL A;  2EI8 A;  1O2P A;  4RKO B;  3ZOD A;  4ABH A;  3PRO A;  2F91 A;  3B8J A;  4UDW H;  1LPG B;  5IYT A;  3MHW U;  2D5M A;  1DXW A;  3SU4 A;  2FES H;  3NZI A;  1EJM A;  5KGO A;  1GWA A;  5DP3 A;  3F3B A;  1EJN A;  2XBY A;  2VWN A;  1ZZZ A;  2BDC A;  3DCL A;  3P17 H;  5EJL A;  2LEL A;  4TPI Z;  2ZCH P;  1AZ8 A;  1J9C H;  1MAY A;  1G37 A;  2VVU A;  1ETS H;  1ID5 H;  2SFA A;  1O2K A;  2ZDV H;  5DP5 A;  4XBC A;  1XVM A;  2GCH F;  4ZHA A;  2AGI X;  2ZHD A;  4IN2 A;  4AFZ A;  1TIO A;  2BOK A;  3A81 A;  2P3U B;  8EST E;  1GG6 C;  2V35 A;  3QTV H;  4MNX A;  3TPI Z;  3UQO A;  4BAK B;  2G8T A;  3PM3 A;  1K21 H;  2AGG X;  4GHQ A;  2AYW A;  4AG2 A;  4TY7 A;  1GG6 B;  1FAX A;  3FVF B;  4XSK U;  1P2M A;  3A87 A;  4FXG H;  4CRC A;  2QF5 A;  1C5V A;  2BTC E;  5DPA A;  1EST A;  1UVS H;  3LGU A;  2BVX H;  1DWB H;  2VGC C;  4NG9 H;  2XYA A;  1UVU H;  1AI8 H;  1O3H A;  3O8D A;  3U8R H;  1CVW H;  1GMH G;  3VXE H;  1TAB E;  2VGC B;  2Z3E A;  1ZJK A;  3TJO A;  1C1W H;  3ZIA D;  1O2N A;  5A8Y A;  2ECR A;  1DUE A;  2PKA B;  2P3T B;  1F0U A;  1PPB H;  1ZGV A;  1BRB E;  2SNV A;  4YXW D;  1EP5 A;  1D3Q B;  3QK1 A;  1SFI A;  4XHY A;  1HIA B;  1T31 A;  3U8O H;  1SFQ B;  1AND A;  4I32 A;  1ANB A;  4NA8 A;  1XUI A;  1YBW A;  1YPL H;  3RXO A;  1DST A;  1YKT A;  3KYF A;  1MQ6 A;  2B0F A;  1D3D B;  5IK2 D;  1E34 B;  1J15 A;  2WHX A;  3ZVE A;  1E0F D;  3ZV8 A;  2FTM A;  5KEC A;  4MDS A;  3ZZ9 A;  2AH4 X;  2A2J A;  1F0T A;  1GL0 E;  2ZFP H;  1W10 U;  1QQ4 A;  1ZMJ A;  4INK A;  2C90 B;  1XXO A;  1THP B;  3ZZ5 A;  1C1O A;  2ANM H;  3RU4 D;  1O35 A;  1UVO A;  3LJJ A;  4GCH G;  2BDA A;  5HIY A;  3M3T A;  4CBO A;  2ANY A;  1D3T B;  3P8F A;  2GMT C;  4U30 A;  3BIV H;  2ZIQ H;  2OUA A;  4AFU A;  1GI7 B;  1QJ7 B;  4TPY A;  2WPI S;  2AIP A;  1T4U H;  3FN8 A;  1XUH A;  3R3G B;  2B7D H;  1MZD A;  1BTP A;  1MAX A;  3BA3 A;  4IN1 A;  1Q31 A;  2D2D A;  3RXI A;  3K6Y A;  2TRM A;  2ZGH A;  4TSF D;  1FLE E;  3FAN A;  3BTT E;  2PTF A;  2BDG A;  1LO6 A;  4YO9 A;  5DP7 A;  1GMD F;  1LMW B;  5F03 A;  5HIZ A;  1LCY A;  1QB9 A;  1GI3 A;  3P95 A;  2VVC A;  4GHT A;  1ZHM A;  2HNT F;  1O2S A;  3LOX A;  1F5L A;  1AO5 A;  1FQ3 A;  1NRP H;  4BTT B;  3U8T H;  4ABA A;  1TAW A;  1IHT H;  3SJO A;  2OC7 A;  3EAA A;  4I8L A;  5F8Z A;  1AIX H;  4FU7 A;  4Q63 A;  3E0N B;  3LGT A;  1EPT B;  1S5S A;  4F49 A;  3M5N A;  2ZZU H;  4U32 A;  1CQQ A;  2UUY A;  4JZ1 A;  1LHE H;  2CF8 H;  3M7T A;  3BNK A;  2Z9J A;  3PWB A;  1Z8R A;  4AGJ A;  4WF8 A;  4IC6 A;  4AZ2 B;  6CHA B;  1F5K U;  1AXJ A;  1RTL A;  3KCG H;  3H96 A;  1OWE A;  1AD8 H;  3BTQ E;  4J2Y B;  3I29 A;  2QGR A;  1GHV H;  2XBV A;  1UHB B;  1O3B A;  2HLC A;  3P8O A;  3SNA A;  1GMC G;  4ABJ A;  3T25 A;  4WXV A;  2QV1 A;  3QGJ A;  4IMQ A;  1HIA A;  2ZCL P;  5DO4 H;  2BD5 A;  1TQ7 B;  1T8M A;  3MU8 A;  2D38 A;  2J4I A;  1MKX K;  4INL A;  1DM4 B;  2AHM E;  1O3A A;  4GVU A;  2XW9 A;  4WXI A;  4AB9 A;  3UQV A;  3A86 A;  2AMP A;  2BQ7 B;  3RMO H;  2K1Q A;  3MNX A;  3OY6 U;  3UNS A;  1MBQ A;  1BT7 A;  3MFJ A;  2PTN A;  3KQC A;  1OWD A;  4R82 A;  1C1P A;  2F4L A;  1G78 A;  1IQM A;  3BEU A;  3GCN A;  4XE4 A;  4RT1 A;  5GND A;  5DGJ A;  3I78 A;  1GHW H;  4HTC H;  1TLD A;  3FOA A;  1LQE A;  4B73 A;  3CB0 A;  2BD8 A;  3RDZ A;  4ABG A;  1BJU A;  3FP6 E;  4MLF B;  3SN8 A;  3TK6 A;  1SGD E;  2FOM B;  2Z7F E;  3SJ8 A;  3M5L A;  1A3E H;  1HYL A;  2ALP A;  2L1T A;  3GS9 A;  1B5G H;  1O3N A;  2WUB A;  1KLJ H;  2PV9 B;  3GY7 A;  1B7X B;  4Q7X A;  2TIO A;  3HK3 B;  3RXH A;  2IJO B;  1C5U A;  1SGE E;  1LKA A;  2QEA A;  3MH6 A;  1LVO A;  1ZHR A;  2O8M A;  1W8B H;  1GBL A;  3O8R A;  4OS5 A;  3MO9 A;  1MH0 A;  3K87 A;  3UOU A;  4ABE A;  1GBM A;  2FX4 A;  2SGF E;  4LZ1 H;  5GCH G;  3A6R A;  1GBC A;  1VL7 A;  3SI4 H;  4I8G A;  3T29 A;  2Z94 A;  1MQ5 A;  3BF6 H;  4JYT A;  1TA6 A;  3FZZ A;  1GBA A;  1JXP A;  4CRA A;  1JRS A;  1VCQ A;  4Y10 E;  3PV2 A;  5T6G A;  1TBZ H;  1SSX A;  5FBE A;  2BD3 A;  1TOM H;  4VGC C;  2M2A A;  2YMS B;  4JYV H;  1C5R A;  1J17 T;  2WPH S;  1SLU B;  3VY2 A;  2XCN A;  1DDJ A;  2ZF0 H;  1YPE H;  1C5T A;  1ZJD A;  2BY8 X;  2D8W A;  3VY5 A;  2GX4 A;  4FUD A;  2FYR A;  3N7D A;  2Q6D A;  1YOA A;  1Z8I B;  2RG3 A;  1OWJ A;  2RA0 A;  1HLT H;  2ZFQ H;  3MYW A;  4IGD A;  5I46 H;  2H5C A;  1GHB G;  2ARZ A;  1P2K A;  1UK2 A;  3BTF E;  1TGS Z;  3ZV9 A;  2C8Z B;  4WVP E;  5CE1 A;  1E37 B;  1NY2 2;  4U2W A;  1ETR H;  1CA0 C;  2CK3 D;  1S6F A;  2V3M A;  2VWM A;  2ZI2 H;  3BTD E;  3C1K A;  3SHC H;  1DOJ A;  1GJ9 B;  1IQN A;  1S0Q A;  2JET C;  2J92 A;  2J2U A;  2I6Q A;  1TMU H;  2BB4 A;  3EQ0 H;  1AU8 A;  2QXH A;  1TFX A;  4Y0Z E;  1SR5 C;  4ABF A;  3T28 A;  1USF A;  3GOV B;  3P8N A;  3RXL A;  2ZTX A;  1GBI A;  2JKH A;  1QL9 A;  3DMB A;  1ESA A;  1G3E A;  3KF2 A;  5AFY H;  4D7G A;  1M9U A;  4RI0 A;  4NIW A;  1QRZ A;  1CBW C;  3IG6 B;  3KQD A;  4IW4 E;  1TNL A;  2KZ4 A;  4WJG 2;  3T27 A;  1YC0 A;  3ZZ8 A;  1HAX B;  1ZML A;  2C4F H;  5CHA C;  4TWW A;  1ELC A;  2G52 A;  2P8O C;  3M7Q A;  1GMC F;  3ELA H;  5C1X A;  4ISN A;  2EC9 H;  2P8O B;  3ZOC A;  2YMS D;  1K9O E;  1EAW A;  2ILN A;  5LGO A;  1P0S H;  1GDU A;  1MD7 A;  1O3P B;  1A5G H;  4X2W A;  1W7G H;  3ZVG A;  1HGT H;  1BTU A;  3PLP A;  4KTU A;  3MOC A;  3SJI A;  1W3R A;  3MU0 A;  1TBQ H;  4FUH A;  2D36 A;  2PGQ B;  1A7S A;  3PMH B;  3EYD A;  1C1N A;  3TK9 A;  1VIT G;  2F3C E;  3SUF A;  2QCY A;  4FU9 A;  2X1K A;  3DSG A;  3GAS A;  1WLK A;  2Q9K A;  3KQE A;  1PQ7 A;  1TOC B;  2PW8 H;  2OU5 A;  2C8W B;  4JCN A;  1NPM A;  3PLK A;  1GI6 A;  3PB1 E;  1A3B H;  1GJ8 B;  1ELD E;  1COW D;  4B1T A;  5DN6 D;  5FHT A;  3U0I A;  1G36 A;  1TPP A;  2STB E;  3OU0 A;  1C5N H;  6EST A;  3BV9 B;  1SGQ E;  3SU3 A;  1A4W H;  3MH7 A;  3VGC C;  3A7T A;  1BTZ A;  2FI4 E;  1TRY A;  1TBR H;  1O2M A;  1XM1 A;  2OK5 A;  3F2F A;  1A1R A;  1VCW A;  3TIU A;  3VGC B;  1ZOM A;  5GCH F;  1NO9 H;  1TE0 A;  1TPA E;  5HXF A;  4MG3 A;  1Y3Y A;  2SGA A;  5A0C A;  5FAH A;  3BG8 A;  3PRB A;  3PO1 C;  3ZVC A;  3K2U A;  3N99 A;  3Q77 A;  4OM9 A;  1GI0 A;  2O9Q A;  3DA9 B;  1XX9 A;  1ZPC A;  2A32 A;  5TCA A;  1PPZ A;  1SI5 H;  2EA3 A;  1O31 A;  1O3D A;  3A6Q A;  1MKX H;  4X2X A;  1VGC C;  1OSS A;  2HVY B;  2ZHW H;  4SGA E;  1TGN A;  1S81 A;  3GYM A;  2BXT H;  1VGC B;  1HDT H;  2L6O A;  2R0X A;  1S6L A;  2EST E;  3A20 A;  1OHH D;  1Y59 T;  1GHB F;  1QA7 A;  2WV9 A;  1GDQ A;  1GJC B;  1ELT A;  1LHD H;  2ULL A;  3GY2 A;  2NU3 E;  3T2N A;  4AC9 A;  1WUN H;  3N7O A;  1FPC H;  3A82 A;  5BRR E;  2OD3 B;  5L30 H;  2F9P A;  1KTT B;  3OX7 U;  2AMD A;  4ISH H;  4WMF A;  3ZZA A;  3SUD A;  1GBT A;  1FZZ A;  4X1S U;  3F2G A;  4K1E A;  3TJV A;  2ODQ A;  4TT3 D;  2Z9I A;  1O3I A;  4ZKS U;  2QF3 A;  2ANK H;  1O2R A;  2A4Q A;  2QYI A;  4UE7 H;  2ZCK P;  5CHE C;  3UPE A;  4H6S B;  4LOY H;  1C5S A;  1UVT H;  2CV3 A;  1HUT H;  2BM2 A;  1EAI A;  2OC8 A;  4MVN A;  1FJS A;  3SU6 A;  5CHO A;  3BN9 A;  4RN6 A;  2OBO A;  2VIO A;  3U1J B;  3AK5 A;  3MU1 A;  1O2Z A;  2QXJ A;  1FI8 A;  1LPZ B;  2P59 A;  2ZU2 A;  3M36 A;  2I02 A;  1O3F A;  4K8Y A;  2F83 A;  2ZP0 H;  1YM0 A;  2JH5 D;  5B6O A;  3KL6 A;  3TGJ E;  2I6S A;  2R3Y A;  3U69 H;  4J1Y A;  2WPL S;  2IJD 1;  3SWJ A;  1HJ9 A;  4HMW A;  4K3J A;  3RXM A;  3KN2 A;  3GCT G;  3HGP A;  3CP7 A;  1FLM A;  3RLW H;  1Z7K A;  3M35 A;  2F9V A;  1KIG H;  1O2Y A;  3SW2 B;  2FLR H;  1O34 A;  3MI4 A;  2A4R A;  3Q3X A;  5C1U A;  1WSS H;  1VIT F;  4UHV A;  3K65 B;  2NU2 E;  1IQJ A;  1NT1 A;  4KGA A;  3H5C B;  4ABI A;  4BOH A;  3S0N A;  4K2Y A;  2AMQ A;  5EU8 A;  1TNG A;  1GHY H;  2P93 A;  4UFE H;  3KYG A;  3GIS B;  4F4O C;  1KDQ A;  2M5T A;  5FCR A;  4FET A;  3V4H A;  3GCO A;  1FIW A;  4X0W U;  4ABD A;  3WW7 A;  4DY7 B;  4OS2 A;  4H6T A;  2ZHQ H;  4A7I B;  3A8B A;  4WH8 A;  2XC5 A;  1W7X H;  2PGB B;  4ASU D;  5DP9 A;  1GGD C;  2BY6 X;  4W64 A;  3P70 B;  5TJX A;  3D23 A;  4THN H;  3RM0 H;  1O2U A;  1GGD B;  2ZTY A;  2O8T A;  1ESB A;  3ZVB A;  3LON A;  5AF9 H;  5C67 A;  2B5T B;  5LPE A;  1L1G A;  2AIQ A;  4Y7B A;  2GV6 A;  2OLG A;  2HNT E;  1T32 A;  1EX3 A;  3SV9 A;  4O97 A;  1AB9 C;  1PJP A;  2BZA A;  2FX6 A;  3RUO A;  1W11 U;  2TGD A;  5CHB A;  1QZ8 A;  5GWZ A;  1YPK H;  1NBM D;  1G2M A;  1E1Q D;  1NRR H;  1SHY A;  1BML A;  4DOQ A;  2HRV A;  4NZQ A;  1GBF A;  2VU8 E;  3SHA H;  1W3O A;  1NES E;  4KEL A;  3URD A;  4Q7Z A;  4CH8 B;  2A7C A;  3QGN B;  2E83 A;  3F1S B;  2PLX A;  1S0R A;  1SGF A;  1D4P B;  3TVJ B;  1O2G H;  1SGF G;  3PYH A;  4YT6 H;  3K86 A;  1BJV A;  3STI A;  4LK4 A;  2TBS A;  4K1T A;  4XD7 D;  2WIN I;  1SGN E;  5F53 A;  1OKX A;  2GT7 A;  3PMA B;  1LHF H;  3NRL A;  5A0A E;  5C3N A;  7LPR A;  2WPK S;  5FCK A;  3A8A A;  3D62 A;  1UW7 A;  2BY5 X;  1DFP A;  1TRM A;  2ZG0 H;  3SV8 A;  3PRD A;  2CHA B;  3BG4 B;  1Y3V A;  1C4U 2;  2GT8 A;  5AHG H;  3FO8 D;  3KGP A;  1DIT H;  3SBK A;  3SNB A;  1KXB A;  3R5Y A;  1RS0 A;  1GHA G;  2FM2 A;  4LZ4 B;  2EQN A;  3SNE A;  2H2Z A;  1P3E A;  3WWF A;  3NWU A;  2FI5 E;  1OOK B;  3AVZ A;  5J4S A;  5JAB A;  1O2J A;  3PWC A;  3B9F H;  3OEE D;  2OC1 A;  4Q7Y A;  2W7S A;  1C1Q A;  4FOU C;  2P16 A;  1C5W B;  2FS9 A;  4I8H A;  4A1X A;  3URE A;  1O30 A;  1EKB B;  3GCT F;  4MTK A;  3VFE A;  1GVL A;  1C2E A;  1DY8 A;  1MCV A;  3UY9 A;  4ZRO A;  1YP9 A;  2J5U A;  1NFX A;  4I8J A;  3V12 A;  4IMZ A;  1V2V T;  3STJ A;  1O3L A;  3R0F A;  3IN6 A;  2IAB A;  2SGE E;  2GV7 A;  4FUF A;  1INC A;  2AER H;  3EST A;  1MTS A;  1WU1 A;  3Q3K A;  1GBK A;  1YCP K;  2Y7X A;  4YLU A;  1HAV B;  1MZA A;  4XFQ A;  2LPR A;  1THR H;  2QF0 A;  3TLO A;  1EJA A;  1YYY 1;  1BBR E;  1YGC H;  2BD9 A;  1EZS C;  1TAL A;  1GPZ A;  1WDI A;  2C8X B;  4GAW A;  4Z85 A;  3TNT A;  2BQ6 B;  5L2Y H;  4JZI A;  2XOK D;  1FPH H;  4X6M A;  1O3K A;  4OGY A;  4BXW A;  4K69 A;  1ZSJ A;  1GJB B;  2SGQ E;  1SKY E;  1NU7 B;  3RP2 A;  2Z9K A;  3OTP A;  3DNH A;  1DVA H;  3TK5 A;  2WV5 A;  3SJ9 A;  3F9F A;  2FPZ A;  2F43 B;  4JZD H;  3LGV A;  1OYQ A;  1K1J A;  1AHT H;  5AFZ H;  2NWN A;  1JBU H;  1LHG H;  2NU1 E;  1EOJ A;  1L2E A;  1HAO H;  1QHR B;  1Y3X A;  5EPY A;  2FOD A;  5GXP A;  3QZQ A;  5HM9 A;  3RU4 E;  1N6Y A;  2BLO A;  5EOK A;  3V0X A;  3LH1 A;  1KYN A;  3OEH D;  3GY3 A;  3S9B A;  3F0O A;  1CGJ E;  2F9N A;  1C2I A;  1SHH B;  1KXC A;  2ZPS A;  5EOD A;  1BHX F;  3MH5 A;  1YPH C;  3SNC A;  1H8I H;  3VB3 A;  4ZMA H;  5E8E H;  1XUG A;  4X1R U;  5JB8 S;  4INH A;  2H5D A;  5EQQ A;  1XUK A;  5HMA A;  1DNL A;  3SOR A;  1C2G A;  1SC8 U;  3W94 A;  2TGA A;  1IAU A;  4Z0K A;  1TB6 H;  1SQR A;  1TWX B;  3PV5 A;  2GJG A;  1WXR A;  1QL8 A;  3L3T A;  3LT3 A;  2FEQ H;  3PTB A;  4MPW A;  2CXV A;  3E0P B;  1F0R A;  2A45 B;  4CBN A;  2KCY A;  1CHO G;  3F9G A;  1VIT H;  1ZTL A;  2GZ9 A;  2GCT C;  2BD4 A;  2DE8 A;  1GJD B;  3V7T A;  1EPT C;  1TPS A;  3GDV A;  4UFG H;  1P04 A;  5EST E;  4DG4 A;  2Q1J A;  2GCT B;  4N7R C;  5EG4 A;  1GJ4 H;  3SV6 A;  5T3H A;  2ZU3 A;  1QJ6 B;  1AWH B;  4AFS A;  1O0D H;  2WPM S;  6CHA C;  1Y12 A;  1Z8G A;  3ATL A;  1O5C B;  3DFL A;  1UTN A;  2KFW A;  1V2T T;  2H9H A;  3ATK A;  1HAI H;  1GHA F;  1C4Y 2;  1WBG B;  1UTM A;  2PWX A;  2BZ6 H;  1C2L A;  3Q3Y A;  3UFA A;  3ODD A;  1G79 A;  3QN7 A;  2A0Q B;  4A1V A;  3P8G A;  1TYN A;  2PKA A;  3SZE A;  1Z1I A;  1C2K A;  2ZHF H;  2X1J A;  3RXT A;  3AWH A;  3SUE A;  1GVZ A;  1H8H D;  2ZPR A;  2D26 C;  3I77 A;  1RZ1 A;  2GZ7 A;  3S9C A;  1YWU A;  2PTC E;  3CP3 A;  2AS9 A;  2LP6 A;  2F9O A;  1FUJ A;  1HAG E;  2ZNK H;  3W95 A;  3UUZ A;  2VIV A;  1C5Z B;  2Z9G A;  1ANC A;  1VJ9 U;  1YPH E;  4OS4 A;  3AAS A;  1K1N A;  6LPR A;  3CNR A;  3UNR A;  1XHN A;  1QY6 A;  5A2M H;  1UJ1 A;  4X1N U;  2PR3 A;  2FIR H;  3ZZB A;  1AUT C;  1E79 D;  4NWL A;  3QDZ B;  3ZVA A;  3Q76 A;  5ESC A;  3RXS A;  1G2L A;  1P05 A;  4Y79 A;  1C1T A;  1PPE E;  2FOA A;  2FOH A;  2HQ9 A;  2W6I D;  4FUE A;  1DS2 E;  1OP0 A;  2ZDM A;  3RXG A;  5EGM A;  1BTY A;  1GI1 A;  3E8L A;  1P2O A;  7GCH G;  5FPY A;  1C5O H;  2W7U A;  4RKJ B;  4A1T A;  1YF4 A;  2C93 B;  1ZLR A;  2G5N A;  2W3K A;  2FWW A;  1N8O C;  2ZU4 A;  1PQ5 A;  3DFJ A;  1G9I E;  2HGT H;  1KXF A;  1K1O A;  2W26 A;  4D9R A;  2RDE A;  1N8O B;  3UIR A;  4MNV A;  2SNW A;  1HV7 A;  4DW2 U;  1HNE E;  4DT4 A;  2XBW A;  5EQR A;  2BDY A;  2G5V A;  2XTT B;  1S84 A;  1EPT A;  1L4D A;  2HAL A;  4AB8 A;  2YMS C;  1V2M T;  2ZKS A;  1BBR K;  1YY3 A;  1F0S A;  4YM9 A;  1TQ0 B;  2SGP E;  1PPH E;  1QA0 A;  2BVS H;  4MPX A;  8KME 2;  3U1I B;  1GI4 A;  3U9A H;  1C2J A;  3A85 A;  3R5Z A;  2A7H A;  3SO3 A;  1P2Q A;  3AAU A;  4CRG A;  1UHB A;  5IDK A;  4XBB A;  1MTN C;  3NKK A;  4Y11 E;  1TMB H;  3ZZD A;  3W1E A;  1AVG H;  4IS5 A;  5EJZ A;  1MTN B;  1DWC H;  1QB6 A;  2RDL A;  3FKH A;  5C1Y A;  3ATI A;  1V6D A;  1SQO A;  2GVF A;  2P94 A;  5T6D A;  1XUJ A;  1CHO F;  2VNT A;  2KAI B;  1AE5 A;  1O2O A;  1BRC E;  2F9U A;  4I8K A;  3A7W A;  1J16 A;  3SGA E;  4HZH A;  4Y76 A;  3TJU A;  1SMF E;  1GHX H;  2EEK A;  1TPO A;  4Y71 A;  2BXU H;  4IC5 A;  1NC6 A;  1ZRB A;  1W9A A;  4X8S H;  5E0G A;  5EIY A;  1E38 B;  1WLI A;  3KQ5 A;  4WME A;  1C2F A;  3KNX A;  1V2N T;  3VB5 A;  3TU7 H;  3BTG E;  2YNA A;  3VEQ B;  1BMN H;  1P8V C;  1RTK A;  3CEN A;  3IWM A;  1GBD A;  4B76 A;  5CDF E;  2JH6 D;  3ZZ6 A;  1B0F A;  1AQ7 A;  1N6X A;  4Y8Z A;  2G4U A;  1MBM A;  3E16 B;  1P06 A; 
#chains in the Genus database with same CATH homology
 4F48 B;  2HQ9 A;  2IML A;  3U35 A;  1G77 A;  3A6R A;  5CHO A;  4IRA A;  4HMX A;  1VL7 A;  3R5R A;  2X1K A;  1W3Q A;  3AMF A;  5EJL A;  3DSG A;  3B5M A;  3GAS A;  1W3P A;  2I02 A;  1WLK A;  4ZKY A;  2D37 A;  2L74 A;  5BNC A;  2Q9K A;  2ECU A;  2OU5 A;  2RE7 A;  1RZ0 A;  4F07 A;  3SWJ A;  4YWN A;  4HMW A;  4XJ2 A;  2AQ6 A;  3R5P A;  4Y9I A;  3U0I A;  1T9M A;  2HTI A;  1FLM A;  1DNL A;  3VY2 A;  3F7E A;  3RH7 A;  3BPK A;  2VPA A;  3NFW A;  3VY5 A;  1WV4 A;  1YOA A;  3R5Y A;  1I0S A;  2GJG A;  3FGE A;  2RDE A;  2HHZ A;  3BNK A;  3HMZ A;  3R5W A;  2HQ7 A;  2QCK A;  3U5W A;  2ARZ A;  3EC6 A;  1AXJ A;  3H96 A;  5JAB A;  2I51 A;  4QVB A;  2FUR A;  3U34 A;  3ZOF A;  2ED4 A;  1NRG A;  1G76 A;  3PFT A;  4FOU C;  3KYG A;  4HMT A;  4P02 A;  2FHQ A;  1EJE A;  4P00 A;  4YBN A;  2ECR A;  1JNW A;  4N7R C;  3ZOE A;  3R5Z A;  4HX6 A;  1USF A;  2D38 A;  3A6Q A;  3TGV A;  3DMB A;  1Y30 A;  4HMS A;  4XHY A;  2FG9 A;  2ASF A;  2R6V A;  5KED A;  3IN6 A;  2IAB A;  3E4V A;  5EJZ A;  1G79 A;  2R0X A;  3A20 A;  3FKH A;  2HTD A;  3ZOH A;  3KYF A;  5EJ1 A;  4R82 A;  2X1J A;  1G78 A;  3AWH A;  4RT1 A;  1I0R A;  2OL5 A;  5KEC A;  1RFE A;  2A2J A;  1USC A;  3K88 A;  1RZ1 A;  1WGB A;  4Z85 A;  3CB0 A;  1YWU A;  3ZOC A;  1XXO A;  3CP3 A;  4HMU A;  1W9A A;  5EIY A;  2NR4 A;  3DB0 A;  3VYA A;  4XRN A;  3HY8 A;  1WLI A;  3ZOG A;  3CNR A;  4HMV A;  1XHN A;  1W3O A;  4L82 A;  1CI0 A;  3ZOD A;  2E83 A;  5CHE C;  4I86 A;  1TY9 A;  4HG6 A;  3DNH A;  2D5M A;  1YLN A;  3BA3 A;  2QEA A;  2IG6 A;  5ESC A;  4RT0 A;  3K86 A;  1W3R A;  3K87 A;  3R5L A;  2PTF A;  5KGO A;  2D36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...