3KYFA

Crystal structure of p4397 complexed with c-di-gmp
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
231
structure length
231
Chain Sequence
PQPPKVLSTPLEIAANLRQLQESHDPLIITFHDRSHRFQSYVVHVDRESNTLALDEMIPRDGEKFIENGEHFRVEGFHDGVRIAWECDHALKISEVDGHRCYSGPLPQEVTYHQRRNAFRAALKLSQLVDIILDGAHLKGNGAMRGKLLDISATGCKLRFEGNVEDRLQLGQVYERFKAGNPLGLVDTMVELRHLHYEERINTTFAGVRFHNLSGQAQRKIESFVYQLQRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Structure of PP4397 Reveals the Molecular Basis for Different c-di-GMP Binding Modes by Pilz Domain Proteins.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Unknown function
total genus 50
structure length 231
sequence length 231
ec nomenclature
pdb deposition date 2009-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07238 PilZ PilZ domain
A PF07317 YcgR Flagellar regulator YcgR
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.110.10 Mainly Beta Roll Pnp Oxidase; Chain A Electron Transport, Fmn-binding Protein; Chain A 3kyfA01
2.40.10.220 Mainly Beta Beta Barrel Thrombin, subunit H predicted glycosyltransferase like domains 3kyfA02
3A6QA 1WGBA 5EJ1A 5KGOA 3VY2A 4P02A 1RFEA 3IN6A 4L82A 1JNWA 2R0XA 3ZOHA 1FLMA 1T9MA 4HX6A 3U35A 4YWNA 4R82A 1WLKA 3R5PA 4HG6A 2QCKA 1RZ1A 3VYAA 3HY8A 1CI0A 5CHOA 4HMUA 1G78A 3B5MA 3NFWA 1I0SA 1YLNA 3BPKA 3K88A 3DNHA 4IRAA 1USCA 3ZODA 1G79A 2OU5A 1WV4A 3K87A 1AXJA 2FURA 3U0IA 5KECA 3KYFA 2IMLA 3ZOEA 2X1JA 4RT0A 2ECRA 1W9AA 4Z85A 3H96A 2A2JA 4XHYA 1W3RA 1I0RA 2AQ6A 4QVBA 1G76A 2OL5A 3BNKA 2D37A 3HMZA 5EJZA 3R5RA 4HMXA 2HQ7A 2HHZA 2ECUA 3R5YA 4FOUC 4XRNA 4N7RC 1W3OA 3A20A 1USFA 4Y9IA 2ASFA 3A6RA 2E83A 5EJLA 4F48B 2X1KA 1W3PA 2HTIA 2GJGA 2NR4A 3PFTA 3CP3A 1NRGA 2ED4A 1XXOA 2I02A 3R5WA 3TGVA 4P00A 3KYGA 3FKHA 1XHNA 3GASA 4HMSA 2RDEA 5BNCA 4HMTA 3AMFA 2D38A 3ZOGA 3DSGA 5JABA 1YWUA 5KEDA 1G77A 1EJEA 2I51A 3BA3A 4HMVA 3U5WA 3R5ZA 3ZOCA 2IABA 2QEAA 3AWHA 2PTFA 2HTDA 3F7EA 3U34A 4RT1A 5CHEC 4XJ2A 3EC6A 2Q9KA 2FHQA 3DB0A 3CNRA 2L74A 5ESCA 1Y30A 3VY5A 1W3QA 3E4VA 2ARZA 3DMBA 4I86A 2D36A 1DNLA 3R5LA 3SWJA 2D5MA 2VPAA 2IG6A 3RH7A 2RE7A 3K86A 4HMWA 2R6VA 1YOAA 4ZKYA 3CB0A 1VL7A 3FGEA 4F07A 1RZ0A 5EIYA 1WLIA 3ZOFA 1TY9A 4YBNA 2HQ9A 2FG9A
chains in the Genus database with same CATH superfamily
4Y76A 3DT0H 1WGBA 2G5NA 5A2MH 3D62A 2ZDLA 2KZ4A 1GI2A 1KTSB 5GDSH 1DVAH 1MMJN 1V3XA 1BB0B 5AHGH 1NTPA 7LPRA 1L4ZA 2O8LA 2FOGA 5A09A 1WU1A 4B75A 1TNJA 1T9MA 1OWDA 1TPAE 3HKIB 4AG1A 3VYAA 1PQ8A 1H4WA 3A7VA 5EPYA 3ZZAA 1EOLA 1DFPA 2VB0A 1PYTC 1GHBF 3GY5A 2ZTYA 2EY4C 4RN6A 3RXUA 1EOJA 1T7CA 3ZODA 4AYYB 1SGQE 2VNTA 2C8YB 2P8OB 3E1XB 2J4IA 1TABE 2H6MA 4DIHH 3LGTA 1GGDC 1ZTLA 3PTBA 3E3TA 3RLWH 1K1NA 1ZLRA 2GDEH 3MH4A 4DURA 3G01A 1FAXA 1G37A 2FLBH 2Q6GA 5LPRA 1BTUA 5EJZA 4X2VA 3TK5A 1QR3E 1P2QA 2J97A 4GAWA 1DT2A 1H8HD 1WTGH 4DOQA 1HPGA 3HPTB 2PWXA 1H8DH 1MTSA 3ATWA 1T8NA 2F3CE 2GJGA 1O35A 5E8EH 5E0JA 1C5PA 3SOSA 4HMSA 1NFUA 3DA9B 1NS3A 3RXQA 1G32B 1A1RA 3AMFA 4Y8ZA 1WV7H 2GZ7A 3T5FH 1GHBG 1UHBB 1HAPH 1G77A 1EB1H 3UOUA 1P10A 2ZU4A 4XDEA 1GPZA 2ZKSA 3MWIU 2C8XB 1LHEH 1TRMA 5EXLA 3U1JB 1X7AC 2WYGA 3BG4B 6CHAC 1Y30A 1V2JT 2JETC 5J4QA 1O2RA 1F2SE 3DCLA 3VFEA 1TRYA 1TPOA 4MNXA 2W7SA 2A4GA 1F5LA 3OEED 3TPIZ 1VITH 3K65B 4WXIA 4Z6AH 1ELEE 2HQ9A 3R0FA 4YESB 1BTYA 5F8TA 1EJMA 4ZKSU 1E79D 5EJ1A 1D3DB 3A8AA 5C1XA 1XKAC 4P02A 3BEUA 1B0EA 3LU9B 1MU6B 2G55A 4MDSA 1JNWA 3LDXH 1H9HE 1PPCE 2BD9A 3MNBA 4FUEA 1WAYB 4IBLH 2V3OH 5C17A 4HX6A 1TYNA 2DE9A 1OYQA 2HPPH 2Z9KA 4NA7A 5LPFA 1QIXB 4AG2A 1XUIA 2XNDD 3RXOA 4ZHAA 3A83A 1OP0A 3FZDA 5TCAA 4RKOB 5JBCS 3E90B 2C93B 3OTJE 5DP7A 1E35B 1HUTH 4X1SU 2H9HA 2CMYA 3ZZ6A 1OHHD 4ISLA 4IRAA 4NIYA 3QN7A 4ABJA 2ZTXA 1AXJA 2FURA 3SJOA 2OC0A 1B5GH 4GUXA 4MPWA 1O5GH 4YTAA 4JZFH 4I32A 1GJ8B 1KXAA 3H96A 2BMGB 3UNRA 5F53A 2V3HH 2OL5A 2Z3DA 3K6ZA 4Y6DA 1DX5M 1TFXA 3LJOA 3HATH 3V0XA 3PO1C 1RJXB 4K2YA 1W3OA 3RXHA 1TE0A 3FP8E 5C5NA 2ASFA 3UB0A 4W64A 1D3TB 3DSPA 2XCNA 3VB7A 1YBWA 2F9NA 2ZFFH 1SFQB 2ED4A 2PTCE 1ID5H 1SFIA 1BMAA 4JMYA 1GI7B 4O9VA 3SN8A 5A0BA 2GV7A 1NBME 5HMAA 2I6SA 2ZG0H 3A7YA 4TWYA 3RC6A 3SI3H 2BZAA 2KCYA 2ZQ1A 4OS5A 3SZNA 5C2ZA 4AFSA 3A86A 4Y11E 4I8GA 4ASUD 3UTUH 5EQRA 3MMGA 3SO3A 2SGPE 1L0ZA 5GNDA 1ZMNA 4RKJB 4AN7A 1HIAA 4CRGA 3T26A 3GY6A 2R3YA 1HBTH 3STIA 1Z8RA 1GGDB 4I86A 4BNRA 3O8RA 2JJ2D 3E0PB 2LELA 2QC2A 2F9PA 2SNVA 2ZU5A 3ESTA 1DANH 2QIQA 3MU4A 7ESTE 1IQMA 3BTWE 4Z0KA 3LGVA 3UPEA 1NO9H 1BBRE 1O34A 2K0QA 1O38A 1TNIA 1XM1A 3D65E 1AQ7A 5KGOA 1AO5A 2D2DA 2UUFB 2UWPA 3PWCA 4Y79A 4DGJA 4UDWH 1BBRK 1SLVB 2ZU2A 1P04A 2FOAA 2JDID 3ZV8A 4ZAEA 1SQTA 2J9NA 1YPHC 1ELBA 2A7JA 2H1UA 3GCOA 3QGJA 2ZNKH 2AGIX 1UMAH 2CN0H 2HNTF 1BMFD 3SJ9A 3BSQA 1DWDH 3WY8A 1NM6A 3SORA 1ELDE 4X6MA 2PUXB 1U6QA 1KLTA 3S0NA 1W10U 5TJXA 2ALVA 6CHAB 2OC8A 2JETB 5CDFE 2QA9E 3HKJB 3SUDA 1SGCA 1FPHH 3F9FA 1TWXB 4AZ2B 1HJ9A 3OE7D 3M5LA 1F92A 3NRLA 3CS0A 1RS0A 1GBMA 2G81E 1HB0B 3ZZBA 4NSVA 2OBQA 1GG6C 1CBWC 1SQRA 2B8OH 3RMMH 1TPSA 2WUCA 3ZVAA 1FJSA 3SYJA 2ANYA 1MZDA 2JH5D 1Z7KA 5JBTA 2FTLE 1O2YA 4VGCC 1DXPA 1FMGA 3E0NB 3R5WA 1ZOMA 1EXFA 4B73A 3MO6A 2D38A 1JRTA 3RC4A 1NN6A 4MNVA 1A0JA 1DWBH 5JBAS 2ZZUH 3F7EA 1N1LA 5GCHG 5ESBA 4XJ2A 1WBGB 2Q9KA 1O3OA 1W8BH 1ETSH 5FX5A 1EASA 1GI1A 4M9FA 4NA9H 5I25A 5E0GA 1O3JA 2CXVA 3SJIA 2HRVA 4GHTA 3SNDA 4E7RG 3K86A 4PROA 2Z94A 3AAVA 3PB1E 1S85A 1TOCB 4XD7D 1E36B 3FGEA 1XUHA 1PPZA 2Z3CA 5FCKA 2ZGHA 4GSOA 3NWUA 1OXGA 3PO1B 1UTOA 3PMJA 2A2XH 2AHME 1QBNA 1JIRA 3DD2H 1NRQH 3I29A 5BRRE 2H9EH 4Q7YA 5EU8A 5EW1H 2D1JA 2WPIS 3VY2A 3SU0A 3MU1A 3RXIA 4ISIH 2ULLA 1AZZA 3U1IB 1Y3WA 4A5TS 2R0XA 1IQEA 3SW2B 1C1WH 2WINI 3UY9A 1TQ7B 1GI6A 3RMNH 1LCYA 3A89A 4UEHH 3WW7A 1O32A 5DK1A 1N8OC 5IDKA 1WLKA 1O2NA 4FUJA 2VWOA 1YM0A 3BTME 3TH4H 2R2WU 2J98B 1VCQA 2BY9X 3MQKC 1I0SA 3MH7A 4FU8A 2ZHFH 3KCGH 3ZVEA 5CHAC 1S83A 2L6OA 4FU9A 1F5RA 4X6NA 3K87A 3BEIB 2PSXA 1V2QT 3U8OH 1TX6A 1GBCA 1ZHPA 1J17T 1O0DH 2ECRA 1GI0A 5ETXA 1UHBA 5B6OA 2QE7D 1TQ0B 4Z85A 2PHBA 2Z3EA 2TGAA 5T6FA 3RUOA 5HYOA 4FUFA 5EG4A 5EQSA 4NG9H 2ZDNA 1G76A 2Q6DA 1O2HA 3N7EA 1K1JA 2FOFA 2QF0A 4DT7B 2F9OA 1GHXH 1EPTB 1C5RA 1ZPBA 2A0QB 4LXBH 2TPIZ 4KKDA 5DJ7A 1LVYA 4I8HA 1V2OT 1EP6A 4Y9IA 1QZ8A 4NCYA 2K8IA 4ZKNU 2Z9GA 2QXJA 2CGAA 3PFTA 1FNIA 2ANWA 2P93A 4BAOB 1IOEA 4AOQA 3TGVA 1DUEA 2FLRH 1N6XA 1A61H 2Y5FA 3ZVDA 2ZU1A 3O8CA 1ZJDA 3E8LA 3K9XB 1NC6A 1E1QD 1SLWB 5JABA 4X8UH 3SV2H 1SC8U 4Q63A 2QGRA 4BAMB 2ZO3H 2ZFPH 3FZZA 4WVPE 1EJNA 1W12U 4KTSA 1GI3A 3Q76A 5A0AE 1Q31A 1ZZZA 5JB9S 2VJ1A 2V0BA 1BRBE 5JDUB 4UFDH 3VY5A 3ZZCA 4A92A 4UD9H 3GY2A 4WWYA 1ELCA 2NU0E 4D7GA 2RE7A 1BJUA 1Y5UT 2C8ZB 3A7XA 1AB9C 2M2AA 4ZKYA 1SVPA 1EUFA 1LHCH 2ZU3A 2GKVE 1ANBA 1AD8H 4IW4E 1GG6B 1CBWB 2G4TA 5ESTE 1OS8A 2IPQX 2Z9JA 1GJAB 2BD2A 2A5IA 2AIPA 2O9QA 1LQDB 1JIMA 2BZ6H 4D8NA 1AN1E 2GT8A 1B0FA 2FYQA 5C0TA 8GCHF 2BTCE 3LGYA 2W6JD 1VITF 4L82A 1NRNH 4CREA 5A8YA 4MNWA 1MUEB 2BDAA 4UFEH 3P17H 1O3KA 3RC5A 1QQ4A 3NKKA 5A8XA 3C1KA 3WWBA 3R5PA 5ABWA 1C1TA 5LH8A 4TT3D 1MTWA 5CHBA 5FBEA 1ESTA 2TGPZ 3VB3A 1YPKH 1YP9A 2ZDKA 2K1QA 2FODA 2WPHS 1YF4A 1NRPH 2UUKB 1V2RT 1FONA 1UTQA 2R9PA 4NA8A 3N7DA 5HIYA 1RFNA 1GBAA 1ZSKA 3BTGE 2JH0D 2P59A 1AWFH 1D6RA 1MTUA 3HGNA 2A5AA 3LONA 1AKSB 1Z6JH 1K28D 2D8WA 3EA8A 1MU8B 1SGRE 5L6NH 1I0RA 4MLFB 4Q4LA 1HAVB 4H42U 3BNKA 1GBIA 1GBDA 2VIPA 3BEFB 4CRCA 3ATIA 2OXSA 2GUJA 1C5OH 1GJ9B 2GGVB 3R5YA 2QXIA 1QGFA 1O30A 4KTUA 4NFFA 1T8OA 1A5IA 1NU7B 1MKWK 2NR4A 1LHGH 1JWTA 1UJ1A 4K60A 1BMMH 1BBRH 1GMCG 1Q2WA 2VH0A 4B2BA 1UK3A 2KCAA 1N8OB 8KME2 1KXEA 2VWLA 2WYJA 2RDLA 4BANB 1W11U 3RU4T 1KLIH 2EI6A 1EJEA 5CHAB 1UCYK 1SGDE 2R3UA 1K0HA 3KQCA 1C1RA 1TRNA 1FY4A 3IWMA 2FHQA 2LP6A 1Y3XA 2GCHF 1EJAA 2WV5A 1A2CH 5HIZA 4THNH 4INLA 3M7QA 2D5MA 4HMWA 2FI3E 2PFEA 1K1PA 1YOAA 2XWBI 3GCNA 3A85A 3TK9A 1BTXA 2CHAB 3NZIA 3RXAA 2V3MA 1BT7A 2PGQB 2SGAA 2BXUH 5FBIA 1W0KD 2G5VA 1Q3XA 9ESTA 3UR6A 2HVYB 1GHZA 1BDAA 3RXMA 2V35A 4DG4A 1RIWC 4KTCA 3IN6A 1AE8H 1O2GH 2PTNA 1YLDA 1DLKB 4K3JA 1TIOA 4ISHH 1MABB 3F2GA 5E2OA 1LHDH 1CGJE 4MQAA 4X8TH 3SU3A 9LPRA 4YWNA 1GBLA 2QCKA 1BRCE 4TV4A 2M5TA 3FANA 3V13A 3P92A 2FX6A 2BLVA 2BD5A 6GCHG 2F43B 3HK6B 1GHWH 3UQVA 4A1VA 3FOAA 1HAGE 4ZKRU 1UK2A 5AF9H 2AIQA 3SHAH 1UO6A 1FIZA 1O3MA 2TRMA 2GCTC 3PRDA 4XE4A 1DPOA 1YPGH 3U8RH 3RXCA 5KECA 4YXWD 1HNEE 2BD7A 1JMOH 3KQDA 3Q00A 2X1JA 1NU9A 5DSFA 4ACAA 5F6MA 1IQNA 1G9IE 1TGSZ 2FMJA 3TLOA 4F55A 3M5MA 5GIBA 4XHYA 1AB9B 1IQKA 1YLCA 3H7TA 3UREA 1XUKA 2BX3A 3RXRA 4ZMAH 2ECUA 1EQ9A 1S84A 5F8XA 4E7NA 1C4Y2 2W3IA 3QO6A 1C5MD 1NRSH 2PLXA 1O3CA 4ZCNA 3CP3A 3BV9B 3ELAH 1SMFE 1PPEE 3S9BA 3FKHA 5F8ZA 1THPB 1NFWA 1WUNH 3PTNA 1XX9A 1Z71A 1TGTA 1TMUH 3IITA 2QV1A 1ZMLA 2ZECA 3ZZ4A 5C1UA 3BTFE 5GXPA 2ILNA 5HM2A 2FZZA 4LOYH 4RI0A 2ALPA 2HWLB 1QQUA 2G52A 2B5TB 1ACBE 1W3CA 3PV5A 3P8OA 2ARZA 4JZDH 2FI5E 3DMBA 3TVJB 3TGIE 2PKSC 2JJ1D 1QRXA 2VIOA 4X2XA 4I8JA 1AU8A 2J98A 1EB2A 4U32A 2KM0A 3NPSA 4CBOA 3GOVB 5DP8A 1GMHF 1TY9A 1E38B 1Z1JA 3MNXA 1QL9A 4K8YA 4Q2KA 1MTNB 2V6NA 3KHVA 1KIGH 4UFGH 1BOQA 3UQOA 1AFQB 2F9UA 2ZI2H 2ZGXH 2WV4A 3B8JA 4JZ1A 1FLMA 4E06H 2PUQH 2YNBA 3U35A 2ZEBA 1F7ZA 5JBBS 3SU1A 1O2JA 1OYTH 2WPKS 2FOHA 2G51A 1O3FA 1GJCB 1TMBH 4ACBA 4CHAC 1V6DA 3K88A 1ESBA 3DFJA 2SNWA 2BLQA 1TPPA 1GBKA 3BTDE 2V7QD 4X1PU 3SGQE 2XBYA 4IMQA 4BXWA 3UFAA 2FOMB 1J9CH 1C5TA 1GHAF 1C5SA 4WXVA 1O2OA 3M7TA 2G8TA 1O2PA 5GWZA 4BAQB 2TGDA 2AEIH 4NWKA 4SGBE 5FCRA 4BOHA 2F83A 2RCEA 3NCLA 1GMHG 3TJVA 1P11E 1WTHD 3BN9A 3TGKE 1SPJA 3R5RA 4ABAA 1FIWA 4GVUA 1RIWB 1ZSLA 3AW1A 1K21H 4X6PA 4ZUHA 5EQQA 4AC9A 4UONA 2QCYA 1O39A 5DO4H 3HE1A 4JK6A 3C27B 1XHNA 4O03A 5CE1A 3EDXB 5BNCA 4AGKA 4LK4A 1P57B 1NT1A 3PLKA 1FN6A 1C5XB 2ASUB 2A4OA 2SGQE 1NPMA 2I51A 3U5WA 3Q3XA 2P94A 1PFXC 4NWLA 3AWHA 1Z1IA 5CHEC 2BDYA 2GCTB 3FP6E 3KIDU 1GHAG 3SZEA 3RXGA 5ESCA 1O3HA 2ZCHP 1O5BB 1FLEE 1O3IA 1SGTA 2ZIQH 5DG6A 1LVMA 1QTFA 3S7KB 2D36A 3OY6U 4DVAU 1LPGB 1S81A 1YPJH 4UHVA 3F2HA 1F0RA 1GJ7B 1DS2E 4U30A 1P3CA 1BRUP 4R0IA 3MOCA 4ZKOU 5EIYA 4OM9A 1WLIA 3LC5A 3L6PA 3SHCH 3T27A 3PLPA 3BTKE 1RTLA 4HFPB 1TNHA 2SGFE 1AKSA 2AS9A 2AERH 2BDCA 1AVGH 3TJUA 4XBBA 1BIOA 4ISNA 1MKWH 4Y8YA 1SLXB 3URCA 1V2WT 4Y71A 4IN2A 1AVWA 1QBVH 1P09A 2J38A 2YMSD 1O33A 1IHTH 3F68H 5CHOA 3QWCH 2A2QH 3SU5A 3SJKA 5FPSA 7KMEH 1O3PB 4ASHA 2H5CA 2QYIA 2F91A 2Y5GA 1EPTC 4FUBA 1UCYH 1USCA 1AHTH 3OAAD 1BUIA 1ELAA 4OGYA 3A8CA 1HJ8A 2PKSB 2Y81A 1MQ5A 3SU2A 1OWEA 3EGKH 3LT3A 1W9AA 2KR7A 1BMLA 4DCDA 5EXMA 1HAHH 4TPIZ 3O8BA 1MD7A 1W0YH 2OC1A 4D9RA 1DY8A 1HFDA 3KNXA 4WH8A 3WWFA 1C2DA 2SGDE 3KEEA 1UTJA 4Z1MD 2P3FH 5FPYA 2WZQA 3T29A 4FOUC 2GTBA 3H09A 4SGAE 1L2EA 1GBHA 1PQ5A 4NGAH 2ZDAH 2ZHEH 1BTPA 1AI8H 1QRZA 1ABIH 4YO9A 4MVNA 2A5KA 5FHTA 2BX4A 1LO6A 7GCHF 2LPRA 3M3VA 4I31A 4K1EA 2I6QA 5FXLA 1UTKA 3OU0A 3B9FH 2HLCA 4WY3A 4F4OC 1S6FA 1UTPA 3D23A 3QK1A 1S0QA 3W95A 4CHAB 3N7OA 3BTQE 5LGOA 2QEAA 2BDBA 1P9UA 5DP5A 3EC6A 2GDDA 4MTBA 1VR1H 1GCTC 4ZHLU 1OWIA 2KAIA 1OPHB 1SHYA 2FM2A 2OP9A 4MNYA 1CA8B 1UK4A 2XRCA 4RSPA 1CSOE 2Y80A 1KMHB 2IJD1 2VWNA 2XBVA 5IK2D 3CB0A 2A4RA 4F07A 2KCOA 4Q80A 2BDHA 1HXFH 3LJJA 4FVDA 2FG9A 2VWMA 3UNSA 3VB5A 2XXLA 7GCHG 3SV6A 2BQ6B 4B76A 5FPTA 1ZTKA 2B0FA 3ZVCA 1TA6A 1GMDF 1SL3A 1RTFB 1AUJA 1ZSJA 1O2UA 1ZHMA 4ESTE 2VVCA 4KELA 2J2UA 4CR5A 4X0WU 4IN1A 4CRFA 1WV4A 2XC4A 3ZIAD 2OQUA 2FOBA 1ZGIA 4BXSA 2VVVA 2O8UA 2AGEX 2IMLA 4AFQA 3A82A 4RT0A 3EE7A 4QT8C 1TBQH 1CHGA 2FX4A 3KQ5A 1OOKB 2PP6A 4MTKA 4OS1A 3L3TA 1YKTA 1YPLH 1IHSH 1ZTJA 4K1TA 2GV6A 4CRDA 5JYIA 3TH2H 4BTTB 5E2PA 3M36A 3A6RA 2NU3E 1ANEA 1H9LB 1SG8B 3OTPA 1GBBA 4JK5A 1K1OA 1IQLA 3KF2A 1XXOA 1H8ED 1CT2E 4ZROA 1NESE 5F03A 1IQIA 3TH3H 2NU4E 4U01A 1A4WH 1AY6H 3BA3A 1SSXA 2CHAC 1TOMH 3A88A 3S7HB 4ABFA 1MZAA 1J8AA 2BDGA 1C1VH 1C4U2 1IQJA 1W7GH 1JRSA 3DB0A 4ABBA 4OS7A 3SQHE 3EA7A 1L1JA 1XUGA 1MQ6A 1W2KH 2J5UA 2L74A 2Z9IA 3RXPA 4B2AA 3URDA 3GYMA 1ETRH 2RG3A 4WMDA 3TGJE 3SI4H 3RXEA 3RH7A 2ZHDA 4FVBA 2XWAA 1BA8B 2PV9B 3DSOA 3IG6B 3JZ1B 1QJ1B 2KCPA 1MTVA 2DE8A 3I77A 3TIUA 1PQ7A 4A1TA 4K69A 1QB1A 1C1OA 5T3HA 1GBTA 2BY7X 2HVXA 3R3GB 1LTOA 1TNLA 1V2KT 5DPAA 1KDQB 4OS2A 2XCFA 1V2LT 1BTHH 3GY3A 1TX8A 1C9PA 4D9QA 3GY8A 5HXFA 4R82A 5CMXH 4YT6H 2OCVB 4MPUA 3HY8A 1TALA 3MH6A 3SUGA 1O5DH 1FY3A 5T6DA 3EA9A 3NFWA 3FAOA 3MNCA 3FN8A 3DNHA 2C4FH 1GCTB 1G79A 2OU5A 2G4UA 2O8MA 3SV8A 1O3LA 3QZRA 1E37B 4JZIA 3DUXH 2ZP0H 3RXSA 2OINA 4OGXA 6LPRA 3V4HA 1O37A 1MD8A 1XXDA 3QGNB 3VB6A 3MO3A 3ZYDA 1XMNB 3SNBA 2EQNA 2D37A 2Q1JA 2HALA 4GLYA 2KFWA 3UWIA 5EW2H 3ZZ8A 2BD3A 2J94A 2VINA 2ZHWH 2XOKD 4UE7H 4B1TA 4ABEA 1EKBB 1FXYA 3PMBB 1W3PA 1P2MA 5C94A 4ABGA 5C20A 2R0LA 3A84A 1ELVA 1HAXB 2F9VA 3S9CA 3KYGA 1W13U 2YMSC 1TGCA 2P3TB 1C5LH 4A6LA 5FX6A 1V2PT 1C2GA 1YWUA 5KEDA 3M61U 4HMVA 1ANDA 4YOJA 2EC9H 4XSKU 4DT4A 1O36A 4XFQA 1DE7H 1SBWA 8GCHG 2W7UA 1MTNC 3PLBA 1BHXB 1VITG 4WH6A 4YOIA 1ZRBA 2IOTA 3CNRA 1F0UA 2Z6BD 1DICA 3AK5A 1G30B 1C1UH 3GCTF 2VPAA 2IG6A 1T8LA 4B6FA 3TJOA 1AFQC 1P2KA 3ZZ3A 1RD3B 2FS8A 3M35A 4FUDA 1GJ5H 1NRRH 1UCYE 1BTWA 2F9BH 2W3KA 3TNSA 2G00A 2Y5HA 2KX4A 1FZZA 2Q6FA 2ZFRH 2Z9LA 5AVDA 2C3SA 1P0SH 2EA3A 3T2NA 2GP9B 3A6QA 2PKAB 3BTHE 1ZR0A 2A45B 4Y10E 3A8BA 1GJDB 3F3BA 5GJ4B 5EGMA 1FDPA 4HZHA 3ZOHA 2PSYA 4X8SH 2CK3D 1C2FA 3CS7A 1GI9B 2VVUA 2Y7ZA 2BY6X 3OFND 1QURH 1CI0A 4HMUA 1G78A 4HGCA 1Y5BT 1TA2A 1KY9A 1SKYE 1EX3A 1S6HA 1O3DA 2QAAA 1P2OA 1JXPA 1GWAA 2QY0B 1GDUA 2IN2A 2UWOA 3H5CB 4ZXYH 3U0IA 2AFQB 1EAUA 1KYNA 2VIVA 1FAKH 2K4QA 1O2IA 1T31A 2GZ9A 4I8KA 8ESTE 3OX7U 1GVLA 3LPRA 3S9AA 3V3MA 1THRH 2BLWA 3ZVGA 1O2TA 3KN2A 2ZWLH 1XVMA 3GDUA 1MH0A 1CHOF 1Z8IB 1XVOA 1QY6A 1DY9A 4XRNA 3ZVFA 3A20A 3MU5A 2GCHG 4NSYA 4DW2U 5EXNA 3LGUA 3VXFH 3KGPA 3LIWA 4K8BA 1GBJA 1FI8A 2OC7A 3A7TA 3K2UA 1TGBA 1RRKA 3LH3A 3RXJA 3V12A 2XBXA 2ZPSA 3MTYA 2BM2A 1BMNH 1GJ6A 1FY5A 1KXDA 4CBNA 4B71A 3BIVH 4OS6A 3RXTA 1DDJA 3R5ZA 2BQWB 2QF5A 2XC0A 1K1IA 2C8WB 3GICB 4CRBA 1ZYOA 2NWNA 1UW7A 4Y0YE 1VJAU 4IMZA 2D26C 4U2WA 1H1BA 2BHGA 3ODDA 3ZVBA 3M3SA 1EAXA 1P06A 3E4VA 3RLYH 3E16B 5C1YA 1W0ZU 2FIRH 3PV4A 2TBSA 1DSTA 3P70B 2R6VA 1LVOA 2CF9H 3KQBA 3BF6H 5HGGA 3A8DA 1CQQA 1XUFA 1CHOG 1O2SA 2HGTH 4OS4A 4CRAA 1MBQA 2WPMS 2UUYA 4YBNA 1BCUH 1YGCH 3OY5U 2BD8A 1FV9A 2ZGJA 3GCHC 4NZQA 1H8IH 1A5GH 2ZA5A 2NU2E 4ZHMU 1YCPH 1EZUC 3SU6A 3EYDA 1HAYB 3VEQB 1G2LA 4YOGA 1CA0C 1OWKA 3RXLA 2ZDVH 2FOEA 4AB8A 3P6ZB 1GDQA 5C0UA 3K6YA 2J95A 1PPGE 2SGEE 1INCA 2YMSB 4KP0A 4NIXA 3SV9A 2BQ7B 3BIUH 1J15A 1L4DA 1SQAA 3UOPA 4D7FA 4YZUA 1NZQH 4HG6A 1O2KA 1O3NA 1F0TA 3P95A 1Y59T 1BTZA 3MYWA 1ZJKA 1N6YA 3VB4A 1YLNA 1C5YB 1C5VA 2STBE 1MCTA 1ZMJA 2VIWA 4JYUH 5L2ZH 1OWJA 1H9IE 1OP8A 2BB4A 2XTTB 1Y3UA 1BQYA 2ZFTA 5JPMH 1AIXH 1OX1A 3ATKA 1GCDA 3RXBA 3MI4A 4HTCH 2VGCC 2EI7A 3A80A 1CT4E 1A0HB 1EPTA 1KTTB 1YPMH 3QZQA 8LPRA 3ITIA 4Y7BA 1HGTH 3GS9A 1D4PB 3AW0A 1ELGA 5SGAE 3GYLB 4X1NU 1K22H 3A7ZA 1FPCH 4JYVH 1PQAA 2A4QA 2FI4E 2HQ7A 2HHZA 3VGCC 1CT0E 2ZGCA 3ZZ5A 1P03A 2E83A 1V2TT 1BJVA 4FETA 3A81A 3NUMA 1VJ9U 2ZPRA 2VIDA 4X2WA 2HTIA 4ZH8A 1HRTH 2ZCLP 1GVZA 1QNJA 5LPEA 4P00A 1BHXF 3QTOH 1ARCA 5EODA 2EI8A 2NU1E 4HMTA 4BAKB 2FYRA 2ZCKP 3EAAA 3ZOGA 2WV9A 4ABIA 1FY8E 1QHRB 1T32A 2ANKH 3QDZB 2IABA 2WSSD 3CP7A 1F5KU 1KDQA 2PTFA 2HTDA 4RT1A 1A46H 4ABDA 1A5HA 1QA0A 1C5ZB 1L1NA 1GI5A 3PV2A 3RXFA 4B2CA 1V2VT 3AVZA 4TWWA 2FPZA 5FL7D 2B7DH 3SGAE 4AYVB 1DNLA 1ARBA 2R2MB 1WQSA 1W14U 1DOJA 2JKHA 1G3BA 2IJOB 2STAE 1FX0B 3SUFA 1ELTA 2ODQA 1EZSC 4FUCA 2QXGA 2W5EA 3F9EA 3N99A 3ZOFA 5G4BA 3MU8A 5L2YH 1CO7E 1T4VH 2EEKA 3M5NA 4E05H 3W1EA 2BOHB 4ZXXH 1HLTH 1AFEH 2AMPA 3SNAA 4F49A 1C4V2 1O5EH 5DP6A 2BD4A 1HAIH 1Y3VA 2VIQA 1C2KA 1NFYA 2A31A 4TY6A 3LH1A 2RFKC 1TBZH 1AE5A 1EP5A 1Y8TA 1QB6A 1LQEA 5BPEA 2FO9A 1NFXA 1KXCA 3H7OA 1KLJH 4H6TA 3EE0B 1O2ZA 2XBWA 3M5OA 1OWHA 2J92A 1E34B 3LKWA 4J2YB 1MKXK 1ZPZA 2DUCA 3F9HA 3GDSA 3RU4D 4YT7H 2CJIA 1D9IA 4IGDA 4WF8A 3RU4E 4R8TB 1HAVA 1GL0E 1P9SA 1NBMD 2A2JA 5E0HA 1OKXA 1TB6H 1W3RA 3HK3B 2BVRH 3GDVA 2HNTE 4XOJA 1C2EA 4JZEH 4O3TA 1TONA 1GL1A 1P3EA 4GHQA 3HMZA 1O5AB 3MNSA 3LC3A 2QN5T 2FXRA 2PR3A 1RTKA 3GCHB 1K1MA 4N7RC 4INKA 4X1RU 3M37A 5FAHA 4O3UA 1CA0B 3B23B 1FN8A 1L1GA 2XC5A 1CU1A 4Y0ZE 1UVSH 1HXEH 3FO8D 3T28A 1MAXA 1J16A 3RP2A 1G3CA 2RA3A 1DLEA 3AASA 1K1LA 3VXEH 1GHYH 1GJ4H 2PKAA 3VG8A 4NIVA 4IS5A 4CH8B 1DSUA 1C1PA 1O2LA 3U34A 2OTVA 2OUAA 1O3GA 3O8DA 2WHXA 4MPVA 1GBEA 1LDTT 1DM4B 1PPBH 3RM2H 1SGNE 2ZTZA 4MG3A 1JOUB 1SHHB 5EPNA 3ZV9A 4KGAA 1YC0A 1ZRKA 2VGCB 1WXRA 1GJBB 1O2MA 1UTLM 2H9TH 3DFLA 1TX7A 4K5ZA 3LGWA 3ODFA 3Q3KA 1O5CB 1IQGA 5T6GA 1VCWA 4X6OA 1QJ7B 3JZ2B 5DN6D 2ZDMA 3CENA 3VGCB 1QJ6B 1BRAA 2A7HA 2VH6A 1P02A 3EQ0H 5GCHF 1IAUA 1C1QA 1VGCC 2J34A 4AFZA 5A8ZA 4M7GA 3SQEE 1FUJA 4FUGA 3RXDA 3STJA 2BY5X 1M9UA 1P01A 3U98H 1DWCH 3PYHA 2ZC9H 4I7YH 3TITA 1Z8GA 1RZ1A 5C5OA 3RXKA 4WMFA 4B6EA 3SUEA 4BAHB 3M7UA 2YOLA 2ZFSA 3B5MA 1V2NT 1EZQA 2ZGBH 4ABHA 1BZXE 2OBOA 2WUBA 3U9AH 3VPKA 2P3UB 1T4UH 5GPIB 2GVFA 3ZYEA 3UWJH 4Y7AA 2Y6TA 1CGHA 1KXBA 2BXTH 3OYPA 1MAYA 3SU4A 2P5ZX 1SI5H 3M3TA 1UVPA 1T8MA 3ATMA 4FUIA 4TY7A 4Y8XA 4CR9A 4UFFH 2CV3A 4XBDA 2AQ6A 3SNCA 1LKBA 2AYWA 1LPKB 4MPXA 4X1QU 3MHWU 5T1VA 3T62A 1CVWH 1K2I1 3FP7E 3TK6A 2YNAA 4HMXA 1VZQH 5B6LA 1Z6EA 1Z8JB 1ESAA 3BG8A 1ETTH 1S5SA 1HV7A 2GT7A 3A7WA 5J4SA 2ZHQH 2OK5A 1NRGA 3UIRA 3ZZDA 2BVSH 5A0CA 3FFGA 1P05A 3U8TH 5HKKD 3DSGA 3PMHB 1YY3A 1O3AA 1DWEH 1OSSA 2AMQA 1QB9A 1TGNA 4ISOA 5DGJA 2FDAA 3FKSD 1YCPK 2LNCA 1F0SA 1PYTD 5L30H 1ELFA 1ANCA 1D6WA 1PPHE 1YCPM 1G3DA 1XXFA 1W3QA 2H5DA 1O2QA 1P2JA 3F9GA 3R5LA 1GMDG 1C5NH 1O3BA 2TIOA 4J1YA 4FU7A 3TJNA 1VL7A 3ZZ9A 1HDTH 2BVXH 2ZPQA 4DJZB 2HPQH 2ZF0H 1QA7A 3SBKA 2O8WA 1DUAA 1BITA 1FY1A 1XKBC 1HJAC 2FWWA 2BLOA 1P8VC 1ZHRA 2Y7XA 2HLDD 1C2LA 1MCVA 1TMTH 5DP9A 1O3EA 4B74A 3I78A 2VU8E 1SGYE 1SQOA 3GY7A 1SGFG 1G2MA 2FOCA 4BTIB 2R0KA 1RXPA 4IC6A 3D49H 2XNIA 1SGEE 3NK8A 3TNTA 1YYY1 4CH2B 3OSYA 4I33A 4AGJA 2GMTC 3MFJA 4HKHA 5HM9A 2Y82A 1NY22 5C3NA 2P16A 1LKAA 1LMWB 4NFEA 1P12E 1S82A 1B7XB 6ESTA 5C67A 3PMAB 1GI4A 3RMLH 1GDNA 4QVBA 1MBMA 3BTTE 3EAJA 1W7XH 1SGPE 4Q7XA 1C1NA 4XBCA 1KXFA 3PM3A 3RM0H 3SNEA 1CE5A 1SGFA 1A3EH 1QBOA 4DY7B 1USFA 1D3PB 3S69A 4A1XA 4AX9H 1VGCB 2FP7B 2Z7FE 3ENSB 3FVFB 3TU7H 5AFZH 1ABJH 1O5FH 2JIZD 1AVXA 2P95A 1SGIB 3ATLA 1AGJA 1WQVH 3AAUA 3GASA 1O31A 2RDEA 2XW9A 4A7IB 2WPDD 4TYDA 2L1TA 1CGIE 4GPGA 3T25A 4X2YA 1C5WB 4IC5A 1IQFA 1K9OE 1UVOA 3QTVH 3RXVA 1RGQA 3UR9A 5DP4A 1FQ3A 3F2FA 3PROA 3ZZ7A 5IYTA 2ZFQH 5H4IB 1SOTA 1HYLA 1YPEH 2AMDA 4WJG2 1DXWA 4DIIH 1WOFA 2GZ8A 3E91A 4YLQH 1TNGA 2VBCA 1AWHB 2HOBA 1QL8A 4VGCB 1HCGA 1G36A 1EFRD 2P8OC 1MKXH 3Q77A 1UVTH 4INHA 5JB8S 1UTNA 2ESTE 4JCNA 2HNTC 1ORFA 1EAWA 5DP3A 1AMHA 1C5QA 1GMCF 1THSH 1WYKA 3P8FA 1COWD 3UAIC 5I46H 2XYAA 1V2MT 1EZXC 1P2IA 3P8NA 4NIWA 4NZLA 2QXHA 2OD3B 1C2MA 3MO9A 1KSNA 2FS9A 2UUJB 1TLDA 4D76A 2W26A 1OP2A 3KL6A 4I8LA 1RFEA 1O2WA 2ODYB 1SLUB 4FXGH 1WSSH 3A87A 2FTMA 1ZGVA 2OLGA 4AFUA 3QLPH 1AUTC 5TCCA 2A7CA 1HIAB 4FUHA 3KQEA 3LOXA 1VKYA 1Y12A 5K7RA 1HAOH 3SJ8A 1P2NA 4O97A 2WPJS 3F0PA 4HI3A 3BPKA 1JBUH 2RA0A 5PTPA 3OEHD 3MU0A 5AFYH 1SR5C 4TSFD 1QL7A 2TGTA 1WDIA 1SOZA 3Q3YA 1G3EA 3KYFA 3GY4A 3L33A 3BG4C 3UUZA 1GBFA 1Y3YA 4AORA 4BTUB 3ZOEA 3SV7A 1A0LA 2C90B 3PWBA 1IQHA 3UNQA 3QUMP 4K1SA 4YM9A 3NXPA 2FEQH 1C1MA 1C2HA 4JYTA 3U28C 1J14A 3BTEE 5EOKA 3V7TA 3E6PH 2THFB 1O2XA 1C2JA 1VCPA 1HJAB 4YLUA 4H6SB 1E1RD 1A3BH 4AB9A 6GCHF 3MH5A 1PPFE 1AZ8A 2BOKA 4GCHF 2BY8X 5EJLA 3U69H 4F48B 2ZQ2A 1Y5AT 2X1KA 1UTMA 1QCPA 3GCTG 1LVBA 1C5UA 1PJPA 1GI8B 2PW8H 3HGPA 1EAIA 2H2ZA 1DITH 1C1SA 1A7SA 2I02A 2O8TA 2UWLA 3F1SB 4TPYA 1V2UT 1LPZB 1HAZB 1W0JD 4LZ1H 2AGGX 1QFKH 4X8VH 1TBRH 1YPHE 2GMTB 3P8GA 2ANMH 1TAWA 1GVKB 3F6UH 3ZOCA 4Q7ZA 2ODPA 2B9LA 4H4FA 2OQ5A 4WMEA 1EATA 1C9TA 3GISB 5K0HA 1V2ST 4LZ4B 1C2IA 2WPLS 1S0RA 2FESH 3LGIA 2GD4B 2A1DB 2SFAA 5DKMA 3SGBE 1QRWA 2F4LA 2BYAX 1TNKA 1ZPCA 3SWJA 2BDIA 1O2VA 3RMOH 2W6ID 2KAIB 2PGBB 3RDZA 3F0OA 3W94A 1E0FD 3QX5H 2A32A 2QF3A 1RZ0A 1S6LA 1NROH 1UVUH 2JH6D 2GX4A 3DHKH 2IPHA 3PRBA 2AH4X 1XUJA 1D3QB 2QF4A 1GHVH 1SB1H 2CF8H 4GCHG 1WCZA 1LHFH
chains in the Genus database with same CATH topology
3A6QA 1WGBA 5EJ1A 5KGOA 3VY2A 4P02A 1RFEA 3IN6A 4L82A 1JNWA 2R0XA 3ZOHA 1FLMA 1T9MA 4HX6A 3U35A 4YWNA 4R82A 1WLKA 3R5PA 4HG6A 2QCKA 1RZ1A 3VYAA 3HY8A 1CI0A 5CHOA 4HMUA 1G78A 3B5MA 3NFWA 1I0SA 1YLNA 3BPKA 3K88A 3DNHA 4IRAA 1USCA 3ZODA 1G79A 2OU5A 1WV4A 3K87A 1AXJA 2FURA 3U0IA 5KECA 3KYFA 2IMLA 3ZOEA 2X1JA 4RT0A 2ECRA 1W9AA 4Z85A 3H96A 2A2JA 4XHYA 1W3RA 1I0RA 2AQ6A 4QVBA 1G76A 2OL5A 3BNKA 2D37A 3HMZA 5EJZA 3R5RA 4HMXA 2HQ7A 2HHZA 2ECUA 3R5YA 4FOUC 4XRNA 4N7RC 1W3OA 3A20A 1USFA 4Y9IA 2ASFA 3A6RA 2E83A 5EJLA 4F48B 2X1KA 1W3PA 2HTIA 2GJGA 2NR4A 3PFTA 3CP3A 1NRGA 2ED4A 1XXOA 2I02A 3R5WA 3TGVA 4P00A 3KYGA 3FKHA 1XHNA 3GASA 4HMSA 2RDEA 5BNCA 4HMTA 3AMFA 2D38A 3ZOGA 3DSGA 5JABA 1YWUA 5KEDA 1G77A 1EJEA 2I51A 3BA3A 4HMVA 3U5WA 3R5ZA 3ZOCA 2IABA 2QEAA 3AWHA 2PTFA 2HTDA 3F7EA 3U34A 4RT1A 5CHEC 4XJ2A 3EC6A 2Q9KA 2FHQA 3DB0A 3CNRA 2L74A 5ESCA 1Y30A 3VY5A 1W3QA 3E4VA 2ARZA 3DMBA 4I86A 2D36A 1DNLA 3R5LA 3SWJA 2D5MA 2VPAA 2IG6A 3RH7A 2RE7A 3K86A 4HMWA 2R6VA 1YOAA 4ZKYA 3CB0A 1VL7A 3FGEA 4F07A 1RZ0A 5EIYA 1WLIA 3ZOFA 1TY9A 4YBNA 2HQ9A 2FG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A6Q A;  1WGB A;  5EJ1 A;  5KGO A;  3VY2 A;  4P02 A;  1RFE A;  3IN6 A;  4L82 A;  1JNW A;  2R0X A;  3ZOH A;  1FLM A;  1T9M A;  4HX6 A;  3U35 A;  4YWN A;  4R82 A;  1WLK A;  3R5P A;  4HG6 A;  2QCK A;  1RZ1 A;  3VYA A;  3HY8 A;  1CI0 A;  5CHO A;  4HMU A;  1G78 A;  3B5M A;  3NFW A;  1I0S A;  1YLN A;  3BPK A;  3K88 A;  3DNH A;  4IRA A;  1USC A;  3ZOD A;  1G79 A;  2OU5 A;  1WV4 A;  3K87 A;  1AXJ A;  2FUR A;  3U0I A;  5KEC A;  3KYF A;  2IML A;  3ZOE A;  2X1J A;  4RT0 A;  2ECR A;  1W9A A;  4Z85 A;  3H96 A;  2A2J A;  4XHY A;  1W3R A;  1I0R A;  2AQ6 A;  4QVB A;  1G76 A;  2OL5 A;  3BNK A;  2D37 A;  3HMZ A;  5EJZ A;  3R5R A;  4HMX A;  2HQ7 A;  2HHZ A;  2ECU A;  3R5Y A;  4FOU C;  4XRN A;  4N7R C;  1W3O A;  3A20 A;  1USF A;  4Y9I A;  2ASF A;  3A6R A;  2E83 A;  5EJL A;  4F48 B;  2X1K A;  1W3P A;  2HTI A;  2GJG A;  2NR4 A;  3PFT A;  3CP3 A;  1NRG A;  2ED4 A;  1XXO A;  2I02 A;  3R5W A;  3TGV A;  4P00 A;  3KYG A;  3FKH A;  1XHN A;  3GAS A;  4HMS A;  2RDE A;  5BNC A;  4HMT A;  3AMF A;  2D38 A;  3ZOG A;  3DSG A;  5JAB A;  1YWU A;  5KED A;  1G77 A;  1EJE A;  2I51 A;  3BA3 A;  4HMV A;  3U5W A;  3R5Z A;  3ZOC A;  2IAB A;  2QEA A;  3AWH A;  2PTF A;  2HTD A;  3F7E A;  3U34 A;  4RT1 A;  5CHE C;  4XJ2 A;  3EC6 A;  2Q9K A;  2FHQ A;  3DB0 A;  3CNR A;  2L74 A;  5ESC A;  1Y30 A;  3VY5 A;  1W3Q A;  3E4V A;  2ARZ A;  3DMB A;  4I86 A;  2D36 A;  1DNL A;  3R5L A;  3SWJ A;  2D5M A;  2VPA A;  2IG6 A;  3RH7 A;  2RE7 A;  3K86 A;  4HMW A;  2R6V A;  1YOA A;  4ZKY A;  3CB0 A;  1VL7 A;  3FGE A;  4F07 A;  1RZ0 A;  5EIY A;  1WLI A;  3ZOF A;  1TY9 A;  4YBN A;  2HQ9 A;  2FG9 A; 
#chains in the Genus database with same CATH topology
 4Y76 A;  3DT0 H;  1WGB A;  2G5N A;  5A2M H;  3D62 A;  2ZDL A;  2KZ4 A;  1GI2 A;  1KTS B;  5GDS H;  1DVA H;  1MMJ N;  1V3X A;  1BB0 B;  5AHG H;  1NTP A;  7LPR A;  1L4Z A;  2O8L A;  2FOG A;  5A09 A;  1WU1 A;  4B75 A;  1TNJ A;  1T9M A;  1OWD A;  1TPA E;  3HKI B;  4AG1 A;  3VYA A;  1PQ8 A;  1H4W A;  3A7V A;  5EPY A;  3ZZA A;  1EOL A;  1DFP A;  2VB0 A;  1PYT C;  1GHB F;  3GY5 A;  2ZTY A;  2EY4 C;  4RN6 A;  3RXU A;  1EOJ A;  1T7C A;  3ZOD A;  4AYY B;  1SGQ E;  2VNT A;  2C8Y B;  2P8O B;  3E1X B;  2J4I A;  1TAB E;  2H6M A;  4DIH H;  3LGT A;  1GGD C;  1ZTL A;  3PTB A;  3E3T A;  3RLW H;  1K1N A;  1ZLR A;  2GDE H;  3MH4 A;  4DUR A;  3G01 A;  1FAX A;  1G37 A;  2FLB H;  2Q6G A;  5LPR A;  1BTU A;  5EJZ A;  4X2V A;  3TK5 A;  1QR3 E;  1P2Q A;  2J97 A;  4GAW A;  1DT2 A;  1H8H D;  1WTG H;  4DOQ A;  1HPG A;  3HPT B;  2PWX A;  1H8D H;  1MTS A;  3ATW A;  1T8N A;  2F3C E;  2GJG A;  1O35 A;  5E8E H;  5E0J A;  1C5P A;  3SOS A;  4HMS A;  1NFU A;  3DA9 B;  1NS3 A;  3RXQ A;  1G32 B;  1A1R A;  3AMF A;  4Y8Z A;  1WV7 H;  2GZ7 A;  3T5F H;  1GHB G;  1UHB B;  1HAP H;  1G77 A;  1EB1 H;  3UOU A;  1P10 A;  2ZU4 A;  4XDE A;  1GPZ A;  2ZKS A;  3MWI U;  2C8X B;  1LHE H;  1TRM A;  5EXL A;  3U1J B;  1X7A C;  2WYG A;  3BG4 B;  6CHA C;  1Y30 A;  1V2J T;  2JET C;  5J4Q A;  1O2R A;  1F2S E;  3DCL A;  3VFE A;  1TRY A;  1TPO A;  4MNX A;  2W7S A;  2A4G A;  1F5L A;  3OEE D;  3TPI Z;  1VIT H;  3K65 B;  4WXI A;  4Z6A H;  1ELE E;  2HQ9 A;  3R0F A;  4YES B;  1BTY A;  5F8T A;  1EJM A;  4ZKS U;  1E79 D;  5EJ1 A;  1D3D B;  3A8A A;  5C1X A;  1XKA C;  4P02 A;  3BEU A;  1B0E A;  3LU9 B;  1MU6 B;  2G55 A;  4MDS A;  1JNW A;  3LDX H;  1H9H E;  1PPC E;  2BD9 A;  3MNB A;  4FUE A;  1WAY B;  4IBL H;  2V3O H;  5C17 A;  4HX6 A;  1TYN A;  2DE9 A;  1OYQ A;  2HPP H;  2Z9K A;  4NA7 A;  5LPF A;  1QIX B;  4AG2 A;  1XUI A;  2XND D;  3RXO A;  4ZHA A;  3A83 A;  1OP0 A;  3FZD A;  5TCA A;  4RKO B;  5JBC S;  3E90 B;  2C93 B;  3OTJ E;  5DP7 A;  1E35 B;  1HUT H;  4X1S U;  2H9H A;  2CMY A;  3ZZ6 A;  1OHH D;  4ISL A;  4IRA A;  4NIY A;  3QN7 A;  4ABJ A;  2ZTX A;  1AXJ A;  2FUR A;  3SJO A;  2OC0 A;  1B5G H;  4GUX A;  4MPW A;  1O5G H;  4YTA A;  4JZF H;  4I32 A;  1GJ8 B;  1KXA A;  3H96 A;  2BMG B;  3UNR A;  5F53 A;  2V3H H;  2OL5 A;  2Z3D A;  3K6Z A;  4Y6D A;  1DX5 M;  1TFX A;  3LJO A;  3HAT H;  3V0X A;  3PO1 C;  1RJX B;  4K2Y A;  1W3O A;  3RXH A;  1TE0 A;  3FP8 E;  5C5N A;  2ASF A;  3UB0 A;  4W64 A;  1D3T B;  3DSP A;  2XCN A;  3VB7 A;  1YBW A;  2F9N A;  2ZFF H;  1SFQ B;  2ED4 A;  2PTC E;  1ID5 H;  1SFI A;  1BMA A;  4JMY A;  1GI7 B;  4O9V A;  3SN8 A;  5A0B A;  2GV7 A;  1NBM E;  5HMA A;  2I6S A;  2ZG0 H;  3A7Y A;  4TWY A;  3RC6 A;  3SI3 H;  2BZA A;  2KCY A;  2ZQ1 A;  4OS5 A;  3SZN A;  5C2Z A;  4AFS A;  3A86 A;  4Y11 E;  4I8G A;  4ASU D;  3UTU H;  5EQR A;  3MMG A;  3SO3 A;  2SGP E;  1L0Z A;  5GND A;  1ZMN A;  4RKJ B;  4AN7 A;  1HIA A;  4CRG A;  3T26 A;  3GY6 A;  2R3Y A;  1HBT H;  3STI A;  1Z8R A;  1GGD B;  4I86 A;  4BNR A;  3O8R A;  2JJ2 D;  3E0P B;  2LEL A;  2QC2 A;  2F9P A;  2SNV A;  2ZU5 A;  3EST A;  1DAN H;  2QIQ A;  3MU4 A;  7EST E;  1IQM A;  3BTW E;  4Z0K A;  3LGV A;  3UPE A;  1NO9 H;  1BBR E;  1O34 A;  2K0Q A;  1O38 A;  1TNI A;  1XM1 A;  3D65 E;  1AQ7 A;  5KGO A;  1AO5 A;  2D2D A;  2UUF B;  2UWP A;  3PWC A;  4Y79 A;  4DGJ A;  4UDW H;  1BBR K;  1SLV B;  2ZU2 A;  1P04 A;  2FOA A;  2JDI D;  3ZV8 A;  4ZAE A;  1SQT A;  2J9N A;  1YPH C;  1ELB A;  2A7J A;  2H1U A;  3GCO A;  3QGJ A;  2ZNK H;  2AGI X;  1UMA H;  2CN0 H;  2HNT F;  1BMF D;  3SJ9 A;  3BSQ A;  1DWD H;  3WY8 A;  1NM6 A;  3SOR A;  1ELD E;  4X6M A;  2PUX B;  1U6Q A;  1KLT A;  3S0N A;  1W10 U;  5TJX A;  2ALV A;  6CHA B;  2OC8 A;  2JET B;  5CDF E;  2QA9 E;  3HKJ B;  3SUD A;  1SGC A;  1FPH H;  3F9F A;  1TWX B;  4AZ2 B;  1HJ9 A;  3OE7 D;  3M5L A;  1F92 A;  3NRL A;  3CS0 A;  1RS0 A;  1GBM A;  2G81 E;  1HB0 B;  3ZZB A;  4NSV A;  2OBQ A;  1GG6 C;  1CBW C;  1SQR A;  2B8O H;  3RMM H;  1TPS A;  2WUC A;  3ZVA A;  1FJS A;  3SYJ A;  2ANY A;  1MZD A;  2JH5 D;  1Z7K A;  5JBT A;  2FTL E;  1O2Y A;  4VGC C;  1DXP A;  1FMG A;  3E0N B;  3R5W A;  1ZOM A;  1EXF A;  4B73 A;  3MO6 A;  2D38 A;  1JRT A;  3RC4 A;  1NN6 A;  4MNV A;  1A0J A;  1DWB H;  5JBA S;  2ZZU H;  3F7E A;  1N1L A;  5GCH G;  5ESB A;  4XJ2 A;  1WBG B;  2Q9K A;  1O3O A;  1W8B H;  1ETS H;  5FX5 A;  1EAS A;  1GI1 A;  4M9F A;  4NA9 H;  5I25 A;  5E0G A;  1O3J A;  2CXV A;  3SJI A;  2HRV A;  4GHT A;  3SND A;  4E7R G;  3K86 A;  4PRO A;  2Z94 A;  3AAV A;  3PB1 E;  1S85 A;  1TOC B;  4XD7 D;  1E36 B;  3FGE A;  1XUH A;  1PPZ A;  2Z3C A;  5FCK A;  2ZGH A;  4GSO A;  3NWU A;  1OXG A;  3PO1 B;  1UTO A;  3PMJ A;  2A2X H;  2AHM E;  1QBN A;  1JIR A;  3DD2 H;  1NRQ H;  3I29 A;  5BRR E;  2H9E H;  4Q7Y A;  5EU8 A;  5EW1 H;  2D1J A;  2WPI S;  3VY2 A;  3SU0 A;  3MU1 A;  3RXI A;  4ISI H;  2ULL A;  1AZZ A;  3U1I B;  1Y3W A;  4A5T S;  2R0X A;  1IQE A;  3SW2 B;  1C1W H;  2WIN I;  3UY9 A;  1TQ7 B;  1GI6 A;  3RMN H;  1LCY A;  3A89 A;  4UEH H;  3WW7 A;  1O32 A;  5DK1 A;  1N8O C;  5IDK A;  1WLK A;  1O2N A;  4FUJ A;  2VWO A;  1YM0 A;  3BTM E;  3TH4 H;  2R2W U;  2J98 B;  1VCQ A;  2BY9 X;  3MQK C;  1I0S A;  3MH7 A;  4FU8 A;  2ZHF H;  3KCG H;  3ZVE A;  5CHA C;  1S83 A;  2L6O A;  4FU9 A;  1F5R A;  4X6N A;  3K87 A;  3BEI B;  2PSX A;  1V2Q T;  3U8O H;  1TX6 A;  1GBC A;  1ZHP A;  1J17 T;  1O0D H;  2ECR A;  1GI0 A;  5ETX A;  1UHB A;  5B6O A;  2QE7 D;  1TQ0 B;  4Z85 A;  2PHB A;  2Z3E A;  2TGA A;  5T6F A;  3RUO A;  5HYO A;  4FUF A;  5EG4 A;  5EQS A;  4NG9 H;  2ZDN A;  1G76 A;  2Q6D A;  1O2H A;  3N7E A;  1K1J A;  2FOF A;  2QF0 A;  4DT7 B;  2F9O A;  1GHX H;  1EPT B;  1C5R A;  1ZPB A;  2A0Q B;  4LXB H;  2TPI Z;  4KKD A;  5DJ7 A;  1LVY A;  4I8H A;  1V2O T;  1EP6 A;  4Y9I A;  1QZ8 A;  4NCY A;  2K8I A;  4ZKN U;  2Z9G A;  2QXJ A;  2CGA A;  3PFT A;  1FNI A;  2ANW A;  2P93 A;  4BAO B;  1IOE A;  4AOQ A;  3TGV A;  1DUE A;  2FLR H;  1N6X A;  1A61 H;  2Y5F A;  3ZVD A;  2ZU1 A;  3O8C A;  1ZJD A;  3E8L A;  3K9X B;  1NC6 A;  1E1Q D;  1SLW B;  5JAB A;  4X8U H;  3SV2 H;  1SC8 U;  4Q63 A;  2QGR A;  4BAM B;  2ZO3 H;  2ZFP H;  3FZZ A;  4WVP E;  1EJN A;  1W12 U;  4KTS A;  1GI3 A;  3Q76 A;  5A0A E;  1Q31 A;  1ZZZ A;  5JB9 S;  2VJ1 A;  2V0B A;  1BRB E;  5JDU B;  4UFD H;  3VY5 A;  3ZZC A;  4A92 A;  4UD9 H;  3GY2 A;  4WWY A;  1ELC A;  2NU0 E;  4D7G A;  2RE7 A;  1BJU A;  1Y5U T;  2C8Z B;  3A7X A;  1AB9 C;  2M2A A;  4ZKY A;  1SVP A;  1EUF A;  1LHC H;  2ZU3 A;  2GKV E;  1ANB A;  1AD8 H;  4IW4 E;  1GG6 B;  1CBW B;  2G4T A;  5EST E;  1OS8 A;  2IPQ X;  2Z9J A;  1GJA B;  2BD2 A;  2A5I A;  2AIP A;  2O9Q A;  1LQD B;  1JIM A;  2BZ6 H;  4D8N A;  1AN1 E;  2GT8 A;  1B0F A;  2FYQ A;  5C0T A;  8GCH F;  2BTC E;  3LGY A;  2W6J D;  1VIT F;  4L82 A;  1NRN H;  4CRE A;  5A8Y A;  4MNW A;  1MUE B;  2BDA A;  4UFE H;  3P17 H;  1O3K A;  3RC5 A;  1QQ4 A;  3NKK A;  5A8X A;  3C1K A;  3WWB A;  3R5P A;  5ABW A;  1C1T A;  5LH8 A;  4TT3 D;  1MTW A;  5CHB A;  5FBE A;  1EST A;  2TGP Z;  3VB3 A;  1YPK H;  1YP9 A;  2ZDK A;  2K1Q A;  2FOD A;  2WPH S;  1YF4 A;  1NRP H;  2UUK B;  1V2R T;  1FON A;  1UTQ A;  2R9P A;  4NA8 A;  3N7D A;  5HIY A;  1RFN A;  1GBA A;  1ZSK A;  3BTG E;  2JH0 D;  2P59 A;  1AWF H;  1D6R A;  1MTU A;  3HGN A;  2A5A A;  3LON A;  1AKS B;  1Z6J H;  1K28 D;  2D8W A;  3EA8 A;  1MU8 B;  1SGR E;  5L6N H;  1I0R A;  4MLF B;  4Q4L A;  1HAV B;  4H42 U;  3BNK A;  1GBI A;  1GBD A;  2VIP A;  3BEF B;  4CRC A;  3ATI A;  2OXS A;  2GUJ A;  1C5O H;  1GJ9 B;  2GGV B;  3R5Y A;  2QXI A;  1QGF A;  1O30 A;  4KTU A;  4NFF A;  1T8O A;  1A5I A;  1NU7 B;  1MKW K;  2NR4 A;  1LHG H;  1JWT A;  1UJ1 A;  4K60 A;  1BMM H;  1BBR H;  1GMC G;  1Q2W A;  2VH0 A;  4B2B A;  1UK3 A;  2KCA A;  1N8O B;  8KME 2;  1KXE A;  2VWL A;  2WYJ A;  2RDL A;  4BAN B;  1W11 U;  3RU4 T;  1KLI H;  2EI6 A;  1EJE A;  5CHA B;  1UCY K;  1SGD E;  2R3U A;  1K0H A;  3KQC A;  1C1R A;  1TRN A;  1FY4 A;  3IWM A;  2FHQ A;  2LP6 A;  1Y3X A;  2GCH F;  1EJA A;  2WV5 A;  1A2C H;  5HIZ A;  4THN H;  4INL A;  3M7Q A;  2D5M A;  4HMW A;  2FI3 E;  2PFE A;  1K1P A;  1YOA A;  2XWB I;  3GCN A;  3A85 A;  3TK9 A;  1BTX A;  2CHA B;  3NZI A;  3RXA A;  2V3M A;  1BT7 A;  2PGQ B;  2SGA A;  2BXU H;  5FBI A;  1W0K D;  2G5V A;  1Q3X A;  9EST A;  3UR6 A;  2HVY B;  1GHZ A;  1BDA A;  3RXM A;  2V35 A;  4DG4 A;  1RIW C;  4KTC A;  3IN6 A;  1AE8 H;  1O2G H;  2PTN A;  1YLD A;  1DLK B;  4K3J A;  1TIO A;  4ISH H;  1MAB B;  3F2G A;  5E2O A;  1LHD H;  1CGJ E;  4MQA A;  4X8T H;  3SU3 A;  9LPR A;  4YWN A;  1GBL A;  2QCK A;  1BRC E;  4TV4 A;  2M5T A;  3FAN A;  3V13 A;  3P92 A;  2FX6 A;  2BLV A;  2BD5 A;  6GCH G;  2F43 B;  3HK6 B;  1GHW H;  3UQV A;  4A1V A;  3FOA A;  1HAG E;  4ZKR U;  1UK2 A;  5AF9 H;  2AIQ A;  3SHA H;  1UO6 A;  1FIZ A;  1O3M A;  2TRM A;  2GCT C;  3PRD A;  4XE4 A;  1DPO A;  1YPG H;  3U8R H;  3RXC A;  5KEC A;  4YXW D;  1HNE E;  2BD7 A;  1JMO H;  3KQD A;  3Q00 A;  2X1J A;  1NU9 A;  5DSF A;  4ACA A;  5F6M A;  1IQN A;  1G9I E;  1TGS Z;  2FMJ A;  3TLO A;  4F55 A;  3M5M A;  5GIB A;  4XHY A;  1AB9 B;  1IQK A;  1YLC A;  3H7T A;  3URE A;  1XUK A;  2BX3 A;  3RXR A;  4ZMA H;  2ECU A;  1EQ9 A;  1S84 A;  5F8X A;  4E7N A;  1C4Y 2;  2W3I A;  3QO6 A;  1C5M D;  1NRS H;  2PLX A;  1O3C A;  4ZCN A;  3CP3 A;  3BV9 B;  3ELA H;  1SMF E;  1PPE E;  3S9B A;  3FKH A;  5F8Z A;  1THP B;  1NFW A;  1WUN H;  3PTN A;  1XX9 A;  1Z71 A;  1TGT A;  1TMU H;  3IIT A;  2QV1 A;  1ZML A;  2ZEC A;  3ZZ4 A;  5C1U A;  3BTF E;  5GXP A;  2ILN A;  5HM2 A;  2FZZ A;  4LOY H;  4RI0 A;  2ALP A;  2HWL B;  1QQU A;  2G52 A;  2B5T B;  1ACB E;  1W3C A;  3PV5 A;  3P8O A;  2ARZ A;  4JZD H;  2FI5 E;  3DMB A;  3TVJ B;  3TGI E;  2PKS C;  2JJ1 D;  1QRX A;  2VIO A;  4X2X A;  4I8J A;  1AU8 A;  2J98 A;  1EB2 A;  4U32 A;  2KM0 A;  3NPS A;  4CBO A;  3GOV B;  5DP8 A;  1GMH F;  1TY9 A;  1E38 B;  1Z1J A;  3MNX A;  1QL9 A;  4K8Y A;  4Q2K A;  1MTN B;  2V6N A;  3KHV A;  1KIG H;  4UFG H;  1BOQ A;  3UQO A;  1AFQ B;  2F9U A;  2ZI2 H;  2ZGX H;  2WV4 A;  3B8J A;  4JZ1 A;  1FLM A;  4E06 H;  2PUQ H;  2YNB A;  3U35 A;  2ZEB A;  1F7Z A;  5JBB S;  3SU1 A;  1O2J A;  1OYT H;  2WPK S;  2FOH A;  2G51 A;  1O3F A;  1GJC B;  1TMB H;  4ACB A;  4CHA C;  1V6D A;  3K88 A;  1ESB A;  3DFJ A;  2SNW A;  2BLQ A;  1TPP A;  1GBK A;  3BTD E;  2V7Q D;  4X1P U;  3SGQ E;  2XBY A;  4IMQ A;  4BXW A;  3UFA A;  2FOM B;  1J9C H;  1C5T A;  1GHA F;  1C5S A;  4WXV A;  1O2O A;  3M7T A;  2G8T A;  1O2P A;  5GWZ A;  4BAQ B;  2TGD A;  2AEI H;  4NWK A;  4SGB E;  5FCR A;  4BOH A;  2F83 A;  2RCE A;  3NCL A;  1GMH G;  3TJV A;  1P11 E;  1WTH D;  3BN9 A;  3TGK E;  1SPJ A;  3R5R A;  4ABA A;  1FIW A;  4GVU A;  1RIW B;  1ZSL A;  3AW1 A;  1K21 H;  4X6P A;  4ZUH A;  5EQQ A;  4AC9 A;  4UON A;  2QCY A;  1O39 A;  5DO4 H;  3HE1 A;  4JK6 A;  3C27 B;  1XHN A;  4O03 A;  5CE1 A;  3EDX B;  5BNC A;  4AGK A;  4LK4 A;  1P57 B;  1NT1 A;  3PLK A;  1FN6 A;  1C5X B;  2ASU B;  2A4O A;  2SGQ E;  1NPM A;  2I51 A;  3U5W A;  3Q3X A;  2P94 A;  1PFX C;  4NWL A;  3AWH A;  1Z1I A;  5CHE C;  2BDY A;  2GCT B;  3FP6 E;  3KID U;  1GHA G;  3SZE A;  3RXG A;  5ESC A;  1O3H A;  2ZCH P;  1O5B B;  1FLE E;  1O3I A;  1SGT A;  2ZIQ H;  5DG6 A;  1LVM A;  1QTF A;  3S7K B;  2D36 A;  3OY6 U;  4DVA U;  1LPG B;  1S81 A;  1YPJ H;  4UHV A;  3F2H A;  1F0R A;  1GJ7 B;  1DS2 E;  4U30 A;  1P3C A;  1BRU P;  4R0I A;  3MOC A;  4ZKO U;  5EIY A;  4OM9 A;  1WLI A;  3LC5 A;  3L6P A;  3SHC H;  3T27 A;  3PLP A;  3BTK E;  1RTL A;  4HFP B;  1TNH A;  2SGF E;  1AKS A;  2AS9 A;  2AER H;  2BDC A;  1AVG H;  3TJU A;  4XBB A;  1BIO A;  4ISN A;  1MKW H;  4Y8Y A;  1SLX B;  3URC A;  1V2W T;  4Y71 A;  4IN2 A;  1AVW A;  1QBV H;  1P09 A;  2J38 A;  2YMS D;  1O33 A;  1IHT H;  3F68 H;  5CHO A;  3QWC H;  2A2Q H;  3SU5 A;  3SJK A;  5FPS A;  7KME H;  1O3P B;  4ASH A;  2H5C A;  2QYI A;  2F91 A;  2Y5G A;  1EPT C;  4FUB A;  1UCY H;  1USC A;  1AHT H;  3OAA D;  1BUI A;  1ELA A;  4OGY A;  3A8C A;  1HJ8 A;  2PKS B;  2Y81 A;  1MQ5 A;  3SU2 A;  1OWE A;  3EGK H;  3LT3 A;  1W9A A;  2KR7 A;  1BML A;  4DCD A;  5EXM A;  1HAH H;  4TPI Z;  3O8B A;  1MD7 A;  1W0Y H;  2OC1 A;  4D9R A;  1DY8 A;  1HFD A;  3KNX A;  4WH8 A;  3WWF A;  1C2D A;  2SGD E;  3KEE A;  1UTJ A;  4Z1M D;  2P3F H;  5FPY A;  2WZQ A;  3T29 A;  4FOU C;  2GTB A;  3H09 A;  4SGA E;  1L2E A;  1GBH A;  1PQ5 A;  4NGA H;  2ZDA H;  2ZHE H;  1BTP A;  1AI8 H;  1QRZ A;  1ABI H;  4YO9 A;  4MVN A;  2A5K A;  5FHT A;  2BX4 A;  1LO6 A;  7GCH F;  2LPR A;  3M3V A;  4I31 A;  4K1E A;  2I6Q A;  5FXL A;  1UTK A;  3OU0 A;  3B9F H;  2HLC A;  4WY3 A;  4F4O C;  1S6F A;  1UTP A;  3D23 A;  3QK1 A;  1S0Q A;  3W95 A;  4CHA B;  3N7O A;  3BTQ E;  5LGO A;  2QEA A;  2BDB A;  1P9U A;  5DP5 A;  3EC6 A;  2GDD A;  4MTB A;  1VR1 H;  1GCT C;  4ZHL U;  1OWI A;  2KAI A;  1OPH B;  1SHY A;  2FM2 A;  2OP9 A;  4MNY A;  1CA8 B;  1UK4 A;  2XRC A;  4RSP A;  1CSO E;  2Y80 A;  1KMH B;  2IJD 1;  2VWN A;  2XBV A;  5IK2 D;  3CB0 A;  2A4R A;  4F07 A;  2KCO A;  4Q80 A;  2BDH A;  1HXF H;  3LJJ A;  4FVD A;  2FG9 A;  2VWM A;  3UNS A;  3VB5 A;  2XXL A;  7GCH G;  3SV6 A;  2BQ6 B;  4B76 A;  5FPT A;  1ZTK A;  2B0F A;  3ZVC A;  1TA6 A;  1GMD F;  1SL3 A;  1RTF B;  1AUJ A;  1ZSJ A;  1O2U A;  1ZHM A;  4EST E;  2VVC A;  4KEL A;  2J2U A;  4CR5 A;  4X0W U;  4IN1 A;  4CRF A;  1WV4 A;  2XC4 A;  3ZIA D;  2OQU A;  2FOB A;  1ZGI A;  4BXS A;  2VVV A;  2O8U A;  2AGE X;  2IML A;  4AFQ A;  3A82 A;  4RT0 A;  3EE7 A;  4QT8 C;  1TBQ H;  1CHG A;  2FX4 A;  3KQ5 A;  1OOK B;  2PP6 A;  4MTK A;  4OS1 A;  3L3T A;  1YKT A;  1YPL H;  1IHS H;  1ZTJ A;  4K1T A;  2GV6 A;  4CRD A;  5JYI A;  3TH2 H;  4BTT B;  5E2P A;  3M36 A;  3A6R A;  2NU3 E;  1ANE A;  1H9L B;  1SG8 B;  3OTP A;  1GBB A;  4JK5 A;  1K1O A;  1IQL A;  3KF2 A;  1XXO A;  1H8E D;  1CT2 E;  4ZRO A;  1NES E;  5F03 A;  1IQI A;  3TH3 H;  2NU4 E;  4U01 A;  1A4W H;  1AY6 H;  3BA3 A;  1SSX A;  2CHA C;  1TOM H;  3A88 A;  3S7H B;  4ABF A;  1MZA A;  1J8A A;  2BDG A;  1C1V H;  1C4U 2;  1IQJ A;  1W7G H;  1JRS A;  3DB0 A;  4ABB A;  4OS7 A;  3SQH E;  3EA7 A;  1L1J A;  1XUG A;  1MQ6 A;  1W2K H;  2J5U A;  2L74 A;  2Z9I A;  3RXP A;  4B2A A;  3URD A;  3GYM A;  1ETR H;  2RG3 A;  4WMD A;  3TGJ E;  3SI4 H;  3RXE A;  3RH7 A;  2ZHD A;  4FVB A;  2XWA A;  1BA8 B;  2PV9 B;  3DSO A;  3IG6 B;  3JZ1 B;  1QJ1 B;  2KCP A;  1MTV A;  2DE8 A;  3I77 A;  3TIU A;  1PQ7 A;  4A1T A;  4K69 A;  1QB1 A;  1C1O A;  5T3H A;  1GBT A;  2BY7 X;  2HVX A;  3R3G B;  1LTO A;  1TNL A;  1V2K T;  5DPA A;  1KDQ B;  4OS2 A;  2XCF A;  1V2L T;  1BTH H;  3GY3 A;  1TX8 A;  1C9P A;  4D9Q A;  3GY8 A;  5HXF A;  4R82 A;  5CMX H;  4YT6 H;  2OCV B;  4MPU A;  3HY8 A;  1TAL A;  3MH6 A;  3SUG A;  1O5D H;  1FY3 A;  5T6D A;  3EA9 A;  3NFW A;  3FAO A;  3MNC A;  3FN8 A;  3DNH A;  2C4F H;  1GCT B;  1G79 A;  2OU5 A;  2G4U A;  2O8M A;  3SV8 A;  1O3L A;  3QZR A;  1E37 B;  4JZI A;  3DUX H;  2ZP0 H;  3RXS A;  2OIN A;  4OGX A;  6LPR A;  3V4H A;  1O37 A;  1MD8 A;  1XXD A;  3QGN B;  3VB6 A;  3MO3 A;  3ZYD A;  1XMN B;  3SNB A;  2EQN A;  2D37 A;  2Q1J A;  2HAL A;  4GLY A;  2KFW A;  3UWI A;  5EW2 H;  3ZZ8 A;  2BD3 A;  2J94 A;  2VIN A;  2ZHW H;  2XOK D;  4UE7 H;  4B1T A;  4ABE A;  1EKB B;  1FXY A;  3PMB B;  1W3P A;  1P2M A;  5C94 A;  4ABG A;  5C20 A;  2R0L A;  3A84 A;  1ELV A;  1HAX B;  2F9V A;  3S9C A;  3KYG A;  1W13 U;  2YMS C;  1TGC A;  2P3T B;  1C5L H;  4A6L A;  5FX6 A;  1V2P T;  1C2G A;  1YWU A;  5KED A;  3M61 U;  4HMV A;  1AND A;  4YOJ A;  2EC9 H;  4XSK U;  4DT4 A;  1O36 A;  4XFQ A;  1DE7 H;  1SBW A;  8GCH G;  2W7U A;  1MTN C;  3PLB A;  1BHX B;  1VIT G;  4WH6 A;  4YOI A;  1ZRB A;  2IOT A;  3CNR A;  1F0U A;  2Z6B D;  1DIC A;  3AK5 A;  1G30 B;  1C1U H;  3GCT F;  2VPA A;  2IG6 A;  1T8L A;  4B6F A;  3TJO A;  1AFQ C;  1P2K A;  3ZZ3 A;  1RD3 B;  2FS8 A;  3M35 A;  4FUD A;  1GJ5 H;  1NRR H;  1UCY E;  1BTW A;  2F9B H;  2W3K A;  3TNS A;  2G00 A;  2Y5H A;  2KX4 A;  1FZZ A;  2Q6F A;  2ZFR H;  2Z9L A;  5AVD A;  2C3S A;  1P0S H;  2EA3 A;  3T2N A;  2GP9 B;  3A6Q A;  2PKA B;  3BTH E;  1ZR0 A;  2A45 B;  4Y10 E;  3A8B A;  1GJD B;  3F3B A;  5GJ4 B;  5EGM A;  1FDP A;  4HZH A;  3ZOH A;  2PSY A;  4X8S H;  2CK3 D;  1C2F A;  3CS7 A;  1GI9 B;  2VVU A;  2Y7Z A;  2BY6 X;  3OFN D;  1QUR H;  1CI0 A;  4HMU A;  1G78 A;  4HGC A;  1Y5B T;  1TA2 A;  1KY9 A;  1SKY E;  1EX3 A;  1S6H A;  1O3D A;  2QAA A;  1P2O A;  1JXP A;  1GWA A;  2QY0 B;  1GDU A;  2IN2 A;  2UWO A;  3H5C B;  4ZXY H;  3U0I A;  2AFQ B;  1EAU A;  1KYN A;  2VIV A;  1FAK H;  2K4Q A;  1O2I A;  1T31 A;  2GZ9 A;  4I8K A;  8EST E;  3OX7 U;  1GVL A;  3LPR A;  3S9A A;  3V3M A;  1THR H;  2BLW A;  3ZVG A;  1O2T A;  3KN2 A;  2ZWL H;  1XVM A;  3GDU A;  1MH0 A;  1CHO F;  1Z8I B;  1XVO A;  1QY6 A;  1DY9 A;  4XRN A;  3ZVF A;  3A20 A;  3MU5 A;  2GCH G;  4NSY A;  4DW2 U;  5EXN A;  3LGU A;  3VXF H;  3KGP A;  3LIW A;  4K8B A;  1GBJ A;  1FI8 A;  2OC7 A;  3A7T A;  3K2U A;  1TGB A;  1RRK A;  3LH3 A;  3RXJ A;  3V12 A;  2XBX A;  2ZPS A;  3MTY A;  2BM2 A;  1BMN H;  1GJ6 A;  1FY5 A;  1KXD A;  4CBN A;  4B71 A;  3BIV H;  4OS6 A;  3RXT A;  1DDJ A;  3R5Z A;  2BQW B;  2QF5 A;  2XC0 A;  1K1I A;  2C8W B;  3GIC B;  4CRB A;  1ZYO A;  2NWN A;  1UW7 A;  4Y0Y E;  1VJA U;  4IMZ A;  2D26 C;  4U2W A;  1H1B A;  2BHG A;  3ODD A;  3ZVB A;  3M3S A;  1EAX A;  1P06 A;  3E4V A;  3RLY H;  3E16 B;  5C1Y A;  1W0Z U;  2FIR H;  3PV4 A;  2TBS A;  1DST A;  3P70 B;  2R6V A;  1LVO A;  2CF9 H;  3KQB A;  3BF6 H;  5HGG A;  3A8D A;  1CQQ A;  1XUF A;  1CHO G;  1O2S A;  2HGT H;  4OS4 A;  4CRA A;  1MBQ A;  2WPM S;  2UUY A;  4YBN A;  1BCU H;  1YGC H;  3OY5 U;  2BD8 A;  1FV9 A;  2ZGJ A;  3GCH C;  4NZQ A;  1H8I H;  1A5G H;  2ZA5 A;  2NU2 E;  4ZHM U;  1YCP H;  1EZU C;  3SU6 A;  3EYD A;  1HAY B;  3VEQ B;  1G2L A;  4YOG A;  1CA0 C;  1OWK A;  3RXL A;  2ZDV H;  2FOE A;  4AB8 A;  3P6Z B;  1GDQ A;  5C0U A;  3K6Y A;  2J95 A;  1PPG E;  2SGE E;  1INC A;  2YMS B;  4KP0 A;  4NIX A;  3SV9 A;  2BQ7 B;  3BIU H;  1J15 A;  1L4D A;  1SQA A;  3UOP A;  4D7F A;  4YZU A;  1NZQ H;  4HG6 A;  1O2K A;  1O3N A;  1F0T A;  3P95 A;  1Y59 T;  1BTZ A;  3MYW A;  1ZJK A;  1N6Y A;  3VB4 A;  1YLN A;  1C5Y B;  1C5V A;  2STB E;  1MCT A;  1ZMJ A;  2VIW A;  4JYU H;  5L2Z H;  1OWJ A;  1H9I E;  1OP8 A;  2BB4 A;  2XTT B;  1Y3U A;  1BQY A;  2ZFT A;  5JPM H;  1AIX H;  1OX1 A;  3ATK A;  1GCD A;  3RXB A;  3MI4 A;  4HTC H;  2VGC C;  2EI7 A;  3A80 A;  1CT4 E;  1A0H B;  1EPT A;  1KTT B;  1YPM H;  3QZQ A;  8LPR A;  3ITI A;  4Y7B A;  1HGT H;  3GS9 A;  1D4P B;  3AW0 A;  1ELG A;  5SGA E;  3GYL B;  4X1N U;  1K22 H;  3A7Z A;  1FPC H;  4JYV H;  1PQA A;  2A4Q A;  2FI4 E;  2HQ7 A;  2HHZ A;  3VGC C;  1CT0 E;  2ZGC A;  3ZZ5 A;  1P03 A;  2E83 A;  1V2T T;  1BJV A;  4FET A;  3A81 A;  3NUM A;  1VJ9 U;  2ZPR A;  2VID A;  4X2W A;  2HTI A;  4ZH8 A;  1HRT H;  2ZCL P;  1GVZ A;  1QNJ A;  5LPE A;  4P00 A;  1BHX F;  3QTO H;  1ARC A;  5EOD A;  2EI8 A;  2NU1 E;  4HMT A;  4BAK B;  2FYR A;  2ZCK P;  3EAA A;  3ZOG A;  2WV9 A;  4ABI A;  1FY8 E;  1QHR B;  1T32 A;  2ANK H;  3QDZ B;  2IAB A;  2WSS D;  3CP7 A;  1F5K U;  1KDQ A;  2PTF A;  2HTD A;  4RT1 A;  1A46 H;  4ABD A;  1A5H A;  1QA0 A;  1C5Z B;  1L1N A;  1GI5 A;  3PV2 A;  3RXF A;  4B2C A;  1V2V T;  3AVZ A;  4TWW A;  2FPZ A;  5FL7 D;  2B7D H;  3SGA E;  4AYV B;  1DNL A;  1ARB A;  2R2M B;  1WQS A;  1W14 U;  1DOJ A;  2JKH A;  1G3B A;  2IJO B;  2STA E;  1FX0 B;  3SUF A;  1ELT A;  2ODQ A;  1EZS C;  4FUC A;  2QXG A;  2W5E A;  3F9E A;  3N99 A;  3ZOF A;  5G4B A;  3MU8 A;  5L2Y H;  1CO7 E;  1T4V H;  2EEK A;  3M5N A;  4E05 H;  3W1E A;  2BOH B;  4ZXX H;  1HLT H;  1AFE H;  2AMP A;  3SNA A;  4F49 A;  1C4V 2;  1O5E H;  5DP6 A;  2BD4 A;  1HAI H;  1Y3V A;  2VIQ A;  1C2K A;  1NFY A;  2A31 A;  4TY6 A;  3LH1 A;  2RFK C;  1TBZ H;  1AE5 A;  1EP5 A;  1Y8T A;  1QB6 A;  1LQE A;  5BPE A;  2FO9 A;  1NFX A;  1KXC A;  3H7O A;  1KLJ H;  4H6T A;  3EE0 B;  1O2Z A;  2XBW A;  3M5O A;  1OWH A;  2J92 A;  1E34 B;  3LKW A;  4J2Y B;  1MKX K;  1ZPZ A;  2DUC A;  3F9H A;  3GDS A;  3RU4 D;  4YT7 H;  2CJI A;  1D9I A;  4IGD A;  4WF8 A;  3RU4 E;  4R8T B;  1HAV A;  1GL0 E;  1P9S A;  1NBM D;  2A2J A;  5E0H A;  1OKX A;  1TB6 H;  1W3R A;  3HK3 B;  2BVR H;  3GDV A;  2HNT E;  4XOJ A;  1C2E A;  4JZE H;  4O3T A;  1TON A;  1GL1 A;  1P3E A;  4GHQ A;  3HMZ A;  1O5A B;  3MNS A;  3LC3 A;  2QN5 T;  2FXR A;  2PR3 A;  1RTK A;  3GCH B;  1K1M A;  4N7R C;  4INK A;  4X1R U;  3M37 A;  5FAH A;  4O3U A;  1CA0 B;  3B23 B;  1FN8 A;  1L1G A;  2XC5 A;  1CU1 A;  4Y0Z E;  1UVS H;  1HXE H;  3FO8 D;  3T28 A;  1MAX A;  1J16 A;  3RP2 A;  1G3C A;  2RA3 A;  1DLE A;  3AAS A;  1K1L A;  3VXE H;  1GHY H;  1GJ4 H;  2PKA A;  3VG8 A;  4NIV A;  4IS5 A;  4CH8 B;  1DSU A;  1C1P A;  1O2L A;  3U34 A;  2OTV A;  2OUA A;  1O3G A;  3O8D A;  2WHX A;  4MPV A;  1GBE A;  1LDT T;  1DM4 B;  1PPB H;  3RM2 H;  1SGN E;  2ZTZ A;  4MG3 A;  1JOU B;  1SHH B;  5EPN A;  3ZV9 A;  4KGA A;  1YC0 A;  1ZRK A;  2VGC B;  1WXR A;  1GJB B;  1O2M A;  1UTL M;  2H9T H;  3DFL A;  1TX7 A;  4K5Z A;  3LGW A;  3ODF A;  3Q3K A;  1O5C B;  1IQG A;  5T6G A;  1VCW A;  4X6O A;  1QJ7 B;  3JZ2 B;  5DN6 D;  2ZDM A;  3CEN A;  3VGC B;  1QJ6 B;  1BRA A;  2A7H A;  2VH6 A;  1P02 A;  3EQ0 H;  5GCH F;  1IAU A;  1C1Q A;  1VGC C;  2J34 A;  4AFZ A;  5A8Z A;  4M7G A;  3SQE E;  1FUJ A;  4FUG A;  3RXD A;  3STJ A;  2BY5 X;  1M9U A;  1P01 A;  3U98 H;  1DWC H;  3PYH A;  2ZC9 H;  4I7Y H;  3TIT A;  1Z8G A;  1RZ1 A;  5C5O A;  3RXK A;  4WMF A;  4B6E A;  3SUE A;  4BAH B;  3M7U A;  2YOL A;  2ZFS A;  3B5M A;  1V2N T;  1EZQ A;  2ZGB H;  4ABH A;  1BZX E;  2OBO A;  2WUB A;  3U9A H;  3VPK A;  2P3U B;  1T4U H;  5GPI B;  2GVF A;  3ZYE A;  3UWJ H;  4Y7A A;  2Y6T A;  1CGH A;  1KXB A;  2BXT H;  3OYP A;  1MAY A;  3SU4 A;  2P5Z X;  1SI5 H;  3M3T A;  1UVP A;  1T8M A;  3ATM A;  4FUI A;  4TY7 A;  4Y8X A;  4CR9 A;  4UFF H;  2CV3 A;  4XBD A;  2AQ6 A;  3SNC A;  1LKB A;  2AYW A;  1LPK B;  4MPX A;  4X1Q U;  3MHW U;  5T1V A;  3T62 A;  1CVW H;  1K2I 1;  3FP7 E;  3TK6 A;  2YNA A;  4HMX A;  1VZQ H;  5B6L A;  1Z6E A;  1Z8J B;  1ESA A;  3BG8 A;  1ETT H;  1S5S A;  1HV7 A;  2GT7 A;  3A7W A;  5J4S A;  2ZHQ H;  2OK5 A;  1NRG A;  3UIR A;  3ZZD A;  2BVS H;  5A0C A;  3FFG A;  1P05 A;  3U8T H;  5HKK D;  3DSG A;  3PMH B;  1YY3 A;  1O3A A;  1DWE H;  1OSS A;  2AMQ A;  1QB9 A;  1TGN A;  4ISO A;  5DGJ A;  2FDA A;  3FKS D;  1YCP K;  2LNC A;  1F0S A;  1PYT D;  5L30 H;  1ELF A;  1ANC A;  1D6W A;  1PPH E;  1YCP M;  1G3D A;  1XXF A;  1W3Q A;  2H5D A;  1O2Q A;  1P2J A;  3F9G A;  3R5L A;  1GMD G;  1C5N H;  1O3B A;  2TIO A;  4J1Y A;  4FU7 A;  3TJN A;  1VL7 A;  3ZZ9 A;  1HDT H;  2BVX H;  2ZPQ A;  4DJZ B;  2HPQ H;  2ZF0 H;  1QA7 A;  3SBK A;  2O8W A;  1DUA A;  1BIT A;  1FY1 A;  1XKB C;  1HJA C;  2FWW A;  2BLO A;  1P8V C;  1ZHR A;  2Y7X A;  2HLD D;  1C2L A;  1MCV A;  1TMT H;  5DP9 A;  1O3E A;  4B74 A;  3I78 A;  2VU8 E;  1SGY E;  1SQO A;  3GY7 A;  1SGF G;  1G2M A;  2FOC A;  4BTI B;  2R0K A;  1RXP A;  4IC6 A;  3D49 H;  2XNI A;  1SGE E;  3NK8 A;  3TNT A;  1YYY 1;  4CH2 B;  3OSY A;  4I33 A;  4AGJ A;  2GMT C;  3MFJ A;  4HKH A;  5HM9 A;  2Y82 A;  1NY2 2;  5C3N A;  2P16 A;  1LKA A;  1LMW B;  4NFE A;  1P12 E;  1S82 A;  1B7X B;  6EST A;  5C67 A;  3PMA B;  1GI4 A;  3RML H;  1GDN A;  4QVB A;  1MBM A;  3BTT E;  3EAJ A;  1W7X H;  1SGP E;  4Q7X A;  1C1N A;  4XBC A;  1KXF A;  3PM3 A;  3RM0 H;  3SNE A;  1CE5 A;  1SGF A;  1A3E H;  1QBO A;  4DY7 B;  1USF A;  1D3P B;  3S69 A;  4A1X A;  4AX9 H;  1VGC B;  2FP7 B;  2Z7F E;  3ENS B;  3FVF B;  3TU7 H;  5AFZ H;  1ABJ H;  1O5F H;  2JIZ D;  1AVX A;  2P95 A;  1SGI B;  3ATL A;  1AGJ A;  1WQV H;  3AAU A;  3GAS A;  1O31 A;  2RDE A;  2XW9 A;  4A7I B;  2WPD D;  4TYD A;  2L1T A;  1CGI E;  4GPG A;  3T25 A;  4X2Y A;  1C5W B;  4IC5 A;  1IQF A;  1K9O E;  1UVO A;  3QTV H;  3RXV A;  1RGQ A;  3UR9 A;  5DP4 A;  1FQ3 A;  3F2F A;  3PRO A;  3ZZ7 A;  5IYT A;  2ZFQ H;  5H4I B;  1SOT A;  1HYL A;  1YPE H;  2AMD A;  4WJG 2;  1DXW A;  4DII H;  1WOF A;  2GZ8 A;  3E91 A;  4YLQ H;  1TNG A;  2VBC A;  1AWH B;  2HOB A;  1QL8 A;  4VGC B;  1HCG A;  1G36 A;  1EFR D;  2P8O C;  1MKX H;  3Q77 A;  1UVT H;  4INH A;  5JB8 S;  1UTN A;  2EST E;  4JCN A;  2HNT C;  1ORF A;  1EAW A;  5DP3 A;  1AMH A;  1C5Q A;  1GMC F;  1THS H;  1WYK A;  3P8F A;  1COW D;  3UAI C;  5I46 H;  2XYA A;  1V2M T;  1EZX C;  1P2I A;  3P8N A;  4NIW A;  4NZL A;  2QXH A;  2OD3 B;  1C2M A;  3MO9 A;  1KSN A;  2FS9 A;  2UUJ B;  1TLD A;  4D76 A;  2W26 A;  1OP2 A;  3KL6 A;  4I8L A;  1RFE A;  1O2W A;  2ODY B;  1SLU B;  4FXG H;  1WSS H;  3A87 A;  2FTM A;  1ZGV A;  2OLG A;  4AFU A;  3QLP H;  1AUT C;  5TCC A;  2A7C A;  1HIA B;  4FUH A;  3KQE A;  3LOX A;  1VKY A;  1Y12 A;  5K7R A;  1HAO H;  3SJ8 A;  1P2N A;  4O97 A;  2WPJ S;  3F0P A;  4HI3 A;  3BPK A;  1JBU H;  2RA0 A;  5PTP A;  3OEH D;  3MU0 A;  5AFY H;  1SR5 C;  4TSF D;  1QL7 A;  2TGT A;  1WDI A;  1SOZ A;  3Q3Y A;  1G3E A;  3KYF A;  3GY4 A;  3L33 A;  3BG4 C;  3UUZ A;  1GBF A;  1Y3Y A;  4AOR A;  4BTU B;  3ZOE A;  3SV7 A;  1A0L A;  2C90 B;  3PWB A;  1IQH A;  3UNQ A;  3QUM P;  4K1S A;  4YM9 A;  3NXP A;  2FEQ H;  1C1M A;  1C2H A;  4JYT A;  3U28 C;  1J14 A;  3BTE E;  5EOK A;  3V7T A;  3E6P H;  2THF B;  1O2X A;  1C2J A;  1VCP A;  1HJA B;  4YLU A;  4H6S B;  1E1R D;  1A3B H;  4AB9 A;  6GCH F;  3MH5 A;  1PPF E;  1AZ8 A;  2BOK A;  4GCH F;  2BY8 X;  5EJL A;  3U69 H;  4F48 B;  2ZQ2 A;  1Y5A T;  2X1K A;  1UTM A;  1QCP A;  3GCT G;  1LVB A;  1C5U A;  1PJP A;  1GI8 B;  2PW8 H;  3HGP A;  1EAI A;  2H2Z A;  1DIT H;  1C1S A;  1A7S A;  2I02 A;  2O8T A;  2UWL A;  3F1S B;  4TPY A;  1V2U T;  1LPZ B;  1HAZ B;  1W0J D;  4LZ1 H;  2AGG X;  1QFK H;  4X8V H;  1TBR H;  1YPH E;  2GMT B;  3P8G A;  2ANM H;  1TAW A;  1GVK B;  3F6U H;  3ZOC A;  4Q7Z A;  2ODP A;  2B9L A;  4H4F A;  2OQ5 A;  4WME A;  1EAT A;  1C9T A;  3GIS B;  5K0H A;  1V2S T;  4LZ4 B;  1C2I A;  2WPL S;  1S0R A;  2FES H;  3LGI A;  2GD4 B;  2A1D B;  2SFA A;  5DKM A;  3SGB E;  1QRW A;  2F4L A;  2BYA X;  1TNK A;  1ZPC A;  3SWJ A;  2BDI A;  1O2V A;  3RMO H;  2W6I D;  2KAI B;  2PGB B;  3RDZ A;  3F0O A;  3W94 A;  1E0F D;  3QX5 H;  2A32 A;  2QF3 A;  1RZ0 A;  1S6L A;  1NRO H;  1UVU H;  2JH6 D;  2GX4 A;  3DHK H;  2IPH A;  3PRB A;  2AH4 X;  1XUJ A;  1D3Q B;  2QF4 A;  1GHV H;  1SB1 H;  2CF8 H;  4GCH G;  1WCZ A;  1LHF H; 
#chains in the Genus database with same CATH homology
 3A6Q A;  1WGB A;  5EJ1 A;  5KGO A;  3VY2 A;  4P02 A;  1RFE A;  3IN6 A;  4L82 A;  1JNW A;  2R0X A;  3ZOH A;  1FLM A;  1T9M A;  4HX6 A;  3U35 A;  4YWN A;  4R82 A;  1WLK A;  3R5P A;  4HG6 A;  2QCK A;  1RZ1 A;  3VYA A;  3HY8 A;  1CI0 A;  5CHO A;  4HMU A;  1G78 A;  3B5M A;  3NFW A;  1I0S A;  1YLN A;  3BPK A;  3K88 A;  3DNH A;  4IRA A;  1USC A;  3ZOD A;  1G79 A;  2OU5 A;  1WV4 A;  3K87 A;  1AXJ A;  2FUR A;  3U0I A;  5KEC A;  3KYF A;  2IML A;  3ZOE A;  2X1J A;  4RT0 A;  2ECR A;  1W9A A;  4Z85 A;  3H96 A;  2A2J A;  4XHY A;  1W3R A;  1I0R A;  2AQ6 A;  4QVB A;  1G76 A;  2OL5 A;  3BNK A;  2D37 A;  3HMZ A;  5EJZ A;  3R5R A;  4HMX A;  2HQ7 A;  2HHZ A;  2ECU A;  3R5Y A;  4FOU C;  4XRN A;  4N7R C;  1W3O A;  3A20 A;  1USF A;  4Y9I A;  2ASF A;  3A6R A;  2E83 A;  5EJL A;  4F48 B;  2X1K A;  1W3P A;  2HTI A;  2GJG A;  2NR4 A;  3PFT A;  3CP3 A;  1NRG A;  2ED4 A;  1XXO A;  2I02 A;  3R5W A;  3TGV A;  4P00 A;  3KYG A;  3FKH A;  1XHN A;  3GAS A;  4HMS A;  2RDE A;  5BNC A;  4HMT A;  3AMF A;  2D38 A;  3ZOG A;  3DSG A;  5JAB A;  1YWU A;  5KED A;  1G77 A;  1EJE A;  2I51 A;  3BA3 A;  4HMV A;  3U5W A;  3R5Z A;  3ZOC A;  2IAB A;  2QEA A;  3AWH A;  2PTF A;  2HTD A;  3F7E A;  3U34 A;  4RT1 A;  5CHE C;  4XJ2 A;  3EC6 A;  2Q9K A;  2FHQ A;  3DB0 A;  3CNR A;  2L74 A;  5ESC A;  1Y30 A;  3VY5 A;  1W3Q A;  3E4V A;  2ARZ A;  3DMB A;  4I86 A;  2D36 A;  1DNL A;  3R5L A;  3SWJ A;  2D5M A;  2VPA A;  2IG6 A;  3RH7 A;  2RE7 A;  3K86 A;  4HMW A;  2R6V A;  1YOA A;  4ZKY A;  3CB0 A;  1VL7 A;  3FGE A;  4F07 A;  1RZ0 A;  5EIY A;  1WLI A;  3ZOF A;  1TY9 A;  4YBN A;  2HQ9 A;  2FG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...