The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
9
|
sequence length |
156
|
structure length |
156
|
Chain Sequence |
GAMMPVPNPTMPVKGAGTTLWVYKGSGDPYANPLSDVDWSRLAKVKDLTPGELTAESYDDSYLDDEDADWTATGQGQKSAGDTSFTLAWMPGEQGQQALLAWFNEGDTRAYKIRFPNGTVDVFRGWVSSIGKAVTAKEVITRTVKVTNVGRPSMAE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
The phage lambda major tail protein structure reveals a common evolution for long-tailed phages and the type VI bacterial secretion system.
pubmed doi rcsb |
| molecule tags |
Viral protein
|
| source organism |
Enterobacteria phage lambda
|
| molecule keywords |
Major tail protein V
|
| total genus |
9
|
| structure length |
156
|
| sequence length |
156
|
| ec nomenclature | |
| pdb deposition date | 2008-06-16 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF16461 | Phage_TTP_12 | Lambda phage tail tube protein, TTP |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Roll | Pnp Oxidase; Chain A | Pnp Oxidase; Chain A |
#chains in the Genus database with same CATH superfamily 2K4Q A; #chains in the Genus database with same CATH topology 2P5Z X; 3ZOC A; 3RH7 A; 3ZOG A; 3IN6 A; 2R0X A; 3ZOD A; 4XHY A; 1XHN A; 4L82 A; 2Q9K A; 4Z85 A; 4HMT A; 2A2J A; 2IAB A; 1T9M A; 2HQ9 A; 2ASF A; 5CHE C; 3V4H A; 1W3P A; 3K87 A; 1XXO A; 5CHO A; 1YOA A; 2D37 A; 3DNH A; 3ZOH A; 2HQ7 A; 4TV4 A; 5JAB A; 3A6Q A; 1DNL A; 3BNK A; 3A6R A; 3TGV A; 4XJ2 A; 2IML A; 3AWH A; 5BNC A; 3HMZ A; 3VY2 A; 2D38 A; 3EC6 A; 4R82 A; 3HY8 A; 1G77 A; 3R5W A; 1RFE A; 1G78 A; 1Y30 A; 3ZOE A; 1EJE A; 2L1T A; 2FG9 A; 2FUR A; 1YLN A; 1WV4 A; 2GUJ A; 4YWN A; 1W3Q A; 3CB0 A; 3EAA A; 3DB0 A; 1G79 A; 2RDE A; 1USF A; 3DMB A; 3U34 A; 2ECU A; 1FLM A; 2RE7 A; 3R5P A; 3FGE A; 2HTD A; 4HMU A; 4HMS A; 3K86 A; 1TY9 A; 4HMV A; 3NFW A; 2HTI A; 2K4Q A; 2AQ6 A; 3KYG A; 3SWJ A; 3B5M A; 3HE1 A; 1CI0 A; 3VYA A; 2PTF A; 2OU5 A; 4Y9I A; 1W9A A; 2OL5 A; 4QVB A; 4MTK A; 1Y12 A; 4N7R C; 3F7E A; 1I0S A; 2X1K A; 2QCK A; 1RZ1 A; 4HKH A; 3R5L A; 2QEA A; 1USC A; 4HX6 A; 4W64 A; 1G76 A; 2ED4 A; 1VL7 A; 3CP3 A; 2X1J A; 1W3R A; 1NRG A; 1W3O A; 2GJG A; 3R5Z A; 3R5R A; 3U5W A; 2E83 A; 3U35 A; 2HHZ A; 4ZKY A; 2VPA A; 2R6V A; 3VY5 A; 1JNW A; 3E4V A; 2D5M A; 4HMW A; 3A20 A; 3H96 A; 2ARZ A; 1WGB A; 2IG6 A; 3FKH A; 3GAS A; 2FHQ A; 2I02 A; 3KYF A; 4YBN A; 1WLI A; 3K88 A; 2D36 A; 4IRA A; 3ZOF A; 2ECR A; 2NR4 A; 2I51 A; 1AXJ A; 3PFT A; 3U0I A; 1WLK A; 4UHV A; 3AMF A; 4HMX A; 3R5Y A; 3BA3 A; 3BPK A; 1I0R A; 1RZ0 A; 5ESC A; 4F07 A; #chains in the Genus database with same CATH homology 2P5Z X; 2GUJ A; 4MTK A; 2L1T A; 4UHV A; 2K4Q A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
