The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
166
|
sequence length |
471
|
structure length |
427
|
Chain Sequence |
GMWASLDALWEMPAEKRIFGAVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWSGLYSETEGTLILLFGGIPYLWRLSGRPEYEITQSLVFLLLATLFSALAGLPWSLYNTFVIEEKHGFNQQTLGFFMKDAIKKFVVTQCILLPVSSLLLYIIKIGGDYFFIYAWLFTLVVSLVLVTIYADYIAPLFDKFTPLPEGKLKEEIEVMAKSIDFPLTKVYVVEGSKRSSHSNAYFYGFFKNKRIVLFDTLLEQGCKNEEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDSQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMWHYSHPPLLERLQALKTM
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
The Structural Basis of Zmpste24-Dependent Laminopathies.
pubmed doi rcsb |
| molecule tags |
Hydrolase
|
| source organism |
Homo sapiens
|
| molecule keywords |
CAAX PRENYL PROTEASE 1 HOMOLOG
|
| total genus |
166
|
| structure length |
427
|
| sequence length |
471
|
| chains with identical sequence |
B, D, E
|
| ec nomenclature |
ec
3.4.24.84: Ste24 endopeptidase. |
| pdb deposition date | 2012-05-31 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01435 | Peptidase_M48 | Peptidase family M48 |
| A | PF16491 | Peptidase_M48_N | CAAX prenyl protease N-terminal, five membrane helices |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Zincin-like | Metalloproteases ("zincins"), catalytic domain |
#chains in the Genus database with same CATH superfamily 4JIX A; 2YPT A; 4IL3 A; 4QHF A; 4JIU A; 4AW6 A; 3CQB A; #chains in the Genus database with same CATH topology 1S0D A; 2XHL A; 1YVG A; 2W2D A; 3QIZ A; 3QIX A; 2G7K A; 3FFZ A; 4EL4 A; 1G9C A; 4KS6 A; 4EJ5 A; 1ZKW A; 3CQB A; 2G7N A; 3DDA A; 3BOK A; 1S0B A; 2IMA A; 1XTG A; 1S0F A; 2A8A A; 1G9A A; 3BOO A; 2ISG A; 4AW6 A; 3K3Q B; 3ZUS A; 3V0A A; 3V0B A; 3FIE A; 1T3C A; 2QN0 A; 3QW5 A; 3FII A; 4JIU A; 2ETF A; 1ZKX A; 1S0E A; 1G9D A; 3VUO A; 2NZ9 A; 3C8B A; 3BWI A; 2A97 A; 2IMB A; 4IL3 A; 4ELC A; 3E11 A; 4HEV A; 5BQN A; 3DSE A; 2NP0 A; 1T3A A; 3QW6 A; 2YPT A; 3QW8 A; 3ZUR A; 1ZN3 A; 3DEB A; 1ZL5 A; 1S0C A; 2G7Q A; 3QJ0 A; 1Z7H A; 2IMC A; 2EJQ A; 3C8A A; 4ZJX A; 3QIY A; 1G9B A; 2FPQ A; 2ISH A; 3BTA A; 3NF3 A; 4QHF A; 5BQM A; 3V0B B; 2ISE A; 3C88 A; 3DDB A; 4JIX A; 2NYY A; 3D3X A; 3QW7 A; 4ZKT B; 1S0G A; 1E1H A; 3C89 A; 1I1E A; 1F31 A; 3DS9 A; 4J1L A; 1EPW A; 3BON A; 4KTX A; 1XTF A; 1ZB7 A; 4KUF A; 1F82 A; 3ZUQ A; 3V0A B; 1ZL6 A; 2G7P A; 2ILP A; #chains in the Genus database with same CATH homology 1TVI A; 4JIX A; 1OZ9 A; 2YPT A; 1XAX A; 1XM5 A; 4IL3 A; 4QHF A; 4JIU A; 4AW6 A; 3CQB A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
