1OZ9A

Crystal structure of aq_1354, a hypothetical protein from aquifex aeolicus
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
141
structure length
141
Chain Sequence
KNRVLVKLKKRKVRKDKIEKWAELALSALGLNNVELSVYITDDQEIRELNKTYRKKDKPTDVLSFPMGEEFGGYKILGDVVISQDTAERQARELGHSLEEEVKRLIVHGIVHLLGYDHEKGGEEEKKFRELENYVLSKLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein AQ_1354
publication title Structure of the hypothetical protein AQ_1354 from Aquifex aeolicus.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Unknown function
total genus 58
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2003-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02130 UPF0054 Uncharacterized protein family UPF0054
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.30 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Metalloproteases ("zincins"), catalytic domain 1oz9A00
1TVIA 1XAXA 1OZ9A 1XM5A
chains in the Genus database with same CATH superfamily
1K7GA 1I73A 1BSWA 3ZUKA 2DW2A 4GUYA 3EDGA 1DMTA 3TS4A 4ILWD 2OZRA 2SRTA 2W13A 4FXYP 1FM1A 1GE7A 2QPJA 1PWQA 3N2UA 3EHYA 3DPFA 1XM5A 1AF0A 3RTTA 2WO8A 3ZVSA 2Z2DA 3LE9A 1PWPA 4JPAA 2XS3A 3AYUA 3F17A 1D8FA 2WO9A 4JP4A 3U1RA 2JT5A 1Y93A 1XFZA 1I76A 2EROA 1JJ9A 4WKEA 5I3MA 1XAXA 5BOYA 1D5JA 4H76A 3P24A 3OHOA 1ZVXA 4XM7A 1B8YA 3I7IA 3CKIA 3KWVC 1KUGA 1CGLA 3G5CA 1RMZA 1K7QA 1BQQM 1BKCI 1YQYA 1ZXCA 1CGEA 4XM6A 1HOVA 2O3EA 3DSLA 4PKTA 3LUNA 1UTTA 3LEAA 4H1QA 1KUKA 5I12A 1ZTQA 3KEKA 3E8RA 4G9LA 4L19A 1GKCA 4GQLA 1KUIA 1HV5A 1CAQA 4DPEA 1G9KA 4L6TA 2JIHA 3GBOA 4Q1LA 2X3AA 2HU6A 3HBVP 2ERQA 1H71P 4JA1A 2D1NA 3LK8A 1HTDA 3RTSA 1JK3A 3LIKA 1G05A 3ELMA 3LJZA 3TSKA 1GE5A 2POJA 3AYKA 1QIAA 2W0DA 2K2GA 3B92A 1AKLA 1MMPA 1BZSA 4PKRA 1IAAA 2W12A 3F16A 1BIWA 4GWMA 3P1VA 2DW1A 2OW9A 2DDFA 1R1IA 1ZP5A 2JNPA 2E2DA 5I4OA 1OZ9A 2CKIA 2Y6DA 5D1SA 3HDBA 4GF1A 1GO7P 1IABA 1MMQA 1Z3JA 1HY7A 1R54A 1FBLA 4H49A 5D2BA 3LILA 3EDIA 830CA 3KMEA 2X3CA 4AUOA 3B2ZA 2MZHA 966CA 1BUVM 1G49A 4H3XA 1JAPA 1YP1A 5CUHA 2JSDA 1EUBA 4HMAA 1BKCE 2DW0A 4DD8A 4QKZA 1OMJA 3KRYA 1KAPP 3HB2P 4L7AA 2FV9A 3NX7A 1JIZA 1YCMA 2MLSA 5I0LA 1QICA 3O64A 4JQGA 1O0TA 1Y8JA 2CLTA 3DTEA 4GR0A 5CXAA 4JIJA 3KHIA 1B3DA 2W14A 1WNIA 2AIGP 4WKIA 3MA2A 4FVLA 1IAEA 1XFYA 4AYKA 3DL1A 1ZXVA 5JMYA 5B5PA 3EDHA 1QJJA 4AXQA 1HFSA 2YB9A 4WF6A 1MNCA 1BQOA 1C3IA 1OM8A 4PKSA 4I35A 2KRJA 2I47A 1G4KA 5BOTA 2MLRA 1K7IA 1UMSA 2A8HA 3ZXHA 4CTHA 2XS4A 5D7WA 3HDAP 1O0QA 1MMRA 1ROSA 1KUHA 3UVCA 3F18A 4PKUA 4H2EA 4DF9A 4EFSA 1UTZA 1S4BP 2OVXA 1JAQA 3HY7A 2X7MA 2MZEA 1CK7A 5I43A 2K9CA 1AYKA 2DDYA 4XM8A 3HYGA 1J7NA 1SLMA 4IN9A 3DTIA 1Q3AA 1RM8A 4GR8A 1DTHA 1L6JA 1OM7A 3KEJA 1YOUA 3HY9A 1XUDA 2YUFA 2D1OA 5L7FA 4FU4A 1KBCA 2RJPA 1QUAA 2FV5A 5D1UA 3LQBA 1GXDA 2MZIA 1Y0VA 3WV2A 4PKQA 4A7BA 3N2VA 2ERPA 3WV1A 2OVZA 3F15A 2RJQA 3LJTA 5H8XA 1XFVA 1CGFA 1XFWA 1EB6A 2OW1A 4WZVA 3B8ZA 3LKAA 3VTGA 1USNA 5LABA 1QIBA 1SRPA 2X3BA 1A86A 3L0TA 3Q2GA 3DPEA 1G12A 3G42A 5BPAA 3O2XA 2J0TA 2N8RA 2V4BA 4G0DA 4XCTA 4DV8A 2L0RA 2W15A 1ND1A 2OXZA 4H84A 3VI1A 3WV3A 3BA0A 3DNGA 1BUDA 2OXUA 4FXQA 1XFUA 4H30A 1OO9A 1XUCA 5L79A 3Q2HA 1PWVA 1JKYA 4PKWA 2Y6CA 1C8TA 1PWUA 3SHIA 2PJTA 1GKDA 2OY2A 2JT6A 1GE6A 2YIGA 2OY4A 1BKCA 3EHXA 4IJOA 2OW0A 1HFCA 1R1JA 1I1IP 3TVCA 1SLNA 4GR3A 4ON1A 5B5OA 1GO8P 4XBHA 3LJGA 2OXWA 3LUMA 1C7KA 1XFXA 2O36A 3LGPA 3DWBA 1SU3A 1UEAA 3K7NA 4L63A 3EDZA 2J83A 2OW2A 3KMCA 4I03A 1D7XA 2E3XA 1IAGA 3I7GA 1JAOA 3L0VA 1TVIA 1UMTA 456CA 4GWNA 5I2ZA 1D8MA 3LIRA 1CXVA 2TCLA 3AIGA 3LMCA 3F1AA 3KECA 1KUFA 4HX3A 2WOAA 1IADA 1PWWA 3V96B 3USNA 1OS9A 1CIZA 1BM6A 5D1TA 4J4MA 4R3VA 1QJIA 1SMPA 4ZR5A 1JANA 1CQRA 3DTKA 1R1HA 4AIGA 3LQ0A 3TT4A 5D3CA 1IACA 2USNA 4PKVA 1OM6A 3OHLA 1R55A 1ASTA 1XURA 2OI0A 1MMBA 3EWJA 1FLSA 1JIWP 1ZS0A 4A3WA 1SATA 3K7LA 1A85A 5CZMA 1JH1A 1ATLA 4H82A 3F19A 1EAKA 2AYKA 4IUWA 4WK7A 3HBUP 1OS2A
chains in the Genus database with same CATH topology
1TVIA 4JIUA 1OZ9A 1XM5A 4AW6A 4JIXA 1XAXA 4QHFA 3CQBA 4IL3A 2YPTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TVI A;  1XAX A;  1OZ9 A;  1XM5 A; 
#chains in the Genus database with same CATH topology
 1K7G A;  1I73 A;  1BSW A;  3ZUK A;  2DW2 A;  4GUY A;  3EDG A;  1DMT A;  3TS4 A;  4ILW D;  2OZR A;  2SRT A;  2W13 A;  4FXY P;  1FM1 A;  1GE7 A;  2QPJ A;  1PWQ A;  3N2U A;  3EHY A;  3DPF A;  1XM5 A;  1AF0 A;  3RTT A;  2WO8 A;  3ZVS A;  2Z2D A;  3LE9 A;  1PWP A;  4JPA A;  2XS3 A;  3AYU A;  3F17 A;  1D8F A;  2WO9 A;  4JP4 A;  3U1R A;  2JT5 A;  1Y93 A;  1XFZ A;  1I76 A;  2ERO A;  1JJ9 A;  4WKE A;  5I3M A;  1XAX A;  5BOY A;  1D5J A;  4H76 A;  3P24 A;  3OHO A;  1ZVX A;  4XM7 A;  1B8Y A;  3I7I A;  3CKI A;  3KWV C;  1KUG A;  1CGL A;  3G5C A;  1RMZ A;  1K7Q A;  1BQQ M;  1BKC I;  1YQY A;  1ZXC A;  1CGE A;  4XM6 A;  1HOV A;  2O3E A;  3DSL A;  4PKT A;  3LUN A;  1UTT A;  3LEA A;  4H1Q A;  1KUK A;  5I12 A;  1ZTQ A;  3KEK A;  3E8R A;  4G9L A;  4L19 A;  1GKC A;  4GQL A;  1KUI A;  1HV5 A;  1CAQ A;  4DPE A;  1G9K A;  4L6T A;  2JIH A;  3GBO A;  4Q1L A;  2X3A A;  2HU6 A;  3HBV P;  2ERQ A;  1H71 P;  4JA1 A;  2D1N A;  3LK8 A;  1HTD A;  3RTS A;  1JK3 A;  3LIK A;  1G05 A;  3ELM A;  3LJZ A;  3TSK A;  1GE5 A;  2POJ A;  3AYK A;  1QIA A;  2W0D A;  2K2G A;  3B92 A;  1AKL A;  1MMP A;  1BZS A;  4PKR A;  1IAA A;  2W12 A;  3F16 A;  1BIW A;  4GWM A;  3P1V A;  2DW1 A;  2OW9 A;  2DDF A;  1R1I A;  1ZP5 A;  2JNP A;  2E2D A;  5I4O A;  1OZ9 A;  2CKI A;  2Y6D A;  5D1S A;  3HDB A;  4GF1 A;  1GO7 P;  1IAB A;  1MMQ A;  1Z3J A;  1HY7 A;  1R54 A;  1FBL A;  4H49 A;  5D2B A;  3LIL A;  3EDI A;  830C A;  3KME A;  2X3C A;  4AUO A;  3B2Z A;  2MZH A;  966C A;  1BUV M;  1G49 A;  4H3X A;  1JAP A;  1YP1 A;  5CUH A;  2JSD A;  1EUB A;  4HMA A;  1BKC E;  2DW0 A;  4DD8 A;  4QKZ A;  1OMJ A;  3KRY A;  1KAP P;  3HB2 P;  4L7A A;  2FV9 A;  3NX7 A;  1JIZ A;  1YCM A;  2MLS A;  5I0L A;  1QIC A;  3O64 A;  4JQG A;  1O0T A;  1Y8J A;  2CLT A;  3DTE A;  4GR0 A;  5CXA A;  4JIJ A;  3KHI A;  1B3D A;  2W14 A;  1WNI A;  2AIG P;  4WKI A;  3MA2 A;  4FVL A;  1IAE A;  1XFY A;  4AYK A;  3DL1 A;  1ZXV A;  5JMY A;  5B5P A;  3EDH A;  1QJJ A;  4AXQ A;  1HFS A;  2YB9 A;  4WF6 A;  1MNC A;  1BQO A;  1C3I A;  1OM8 A;  4PKS A;  4I35 A;  2KRJ A;  2I47 A;  1G4K A;  5BOT A;  2MLR A;  1K7I A;  1UMS A;  2A8H A;  3ZXH A;  4CTH A;  2XS4 A;  5D7W A;  3HDA P;  1O0Q A;  1MMR A;  1ROS A;  1KUH A;  3UVC A;  3F18 A;  4PKU A;  4H2E A;  4DF9 A;  4EFS A;  1UTZ A;  1S4B P;  2OVX A;  1JAQ A;  3HY7 A;  2X7M A;  2MZE A;  1CK7 A;  5I43 A;  2K9C A;  1AYK A;  2DDY A;  4XM8 A;  3HYG A;  1J7N A;  1SLM A;  4IN9 A;  3DTI A;  1Q3A A;  1RM8 A;  4GR8 A;  1DTH A;  1L6J A;  1OM7 A;  3KEJ A;  1YOU A;  3HY9 A;  1XUD A;  2YUF A;  2D1O A;  5L7F A;  4FU4 A;  1KBC A;  2RJP A;  1QUA A;  2FV5 A;  5D1U A;  3LQB A;  1GXD A;  2MZI A;  1Y0V A;  3WV2 A;  4PKQ A;  4A7B A;  3N2V A;  2ERP A;  3WV1 A;  2OVZ A;  3F15 A;  2RJQ A;  3LJT A;  5H8X A;  1XFV A;  1CGF A;  1XFW A;  1EB6 A;  2OW1 A;  4WZV A;  3B8Z A;  3LKA A;  3VTG A;  1USN A;  5LAB A;  1QIB A;  1SRP A;  2X3B A;  1A86 A;  3L0T A;  3Q2G A;  3DPE A;  1G12 A;  3G42 A;  5BPA A;  3O2X A;  2J0T A;  2N8R A;  2V4B A;  4G0D A;  4XCT A;  4DV8 A;  2L0R A;  2W15 A;  1ND1 A;  2OXZ A;  4H84 A;  3VI1 A;  3WV3 A;  3BA0 A;  3DNG A;  1BUD A;  2OXU A;  4FXQ A;  1XFU A;  4H30 A;  1OO9 A;  1XUC A;  5L79 A;  3Q2H A;  1PWV A;  1JKY A;  4PKW A;  2Y6C A;  1C8T A;  1PWU A;  3SHI A;  2PJT A;  1GKD A;  2OY2 A;  2JT6 A;  1GE6 A;  2YIG A;  2OY4 A;  1BKC A;  3EHX A;  4IJO A;  2OW0 A;  1HFC A;  1R1J A;  1I1I P;  3TVC A;  1SLN A;  4GR3 A;  4ON1 A;  5B5O A;  1GO8 P;  4XBH A;  3LJG A;  2OXW A;  3LUM A;  1C7K A;  1XFX A;  2O36 A;  3LGP A;  3DWB A;  1SU3 A;  1UEA A;  3K7N A;  4L63 A;  3EDZ A;  2J83 A;  2OW2 A;  3KMC A;  4I03 A;  1D7X A;  2E3X A;  1IAG A;  3I7G A;  1JAO A;  3L0V A;  1TVI A;  1UMT A;  456C A;  4GWN A;  5I2Z A;  1D8M A;  3LIR A;  1CXV A;  2TCL A;  3AIG A;  3LMC A;  3F1A A;  3KEC A;  1KUF A;  4HX3 A;  2WOA A;  1IAD A;  1PWW A;  3V96 B;  3USN A;  1OS9 A;  1CIZ A;  1BM6 A;  5D1T A;  4J4M A;  4R3V A;  1QJI A;  1SMP A;  4ZR5 A;  1JAN A;  1CQR A;  3DTK A;  1R1H A;  4AIG A;  3LQ0 A;  3TT4 A;  5D3C A;  1IAC A;  2USN A;  4PKV A;  1OM6 A;  3OHL A;  1R55 A;  1AST A;  1XUR A;  2OI0 A;  1MMB A;  3EWJ A;  1FLS A;  1JIW P;  1ZS0 A;  4A3W A;  1SAT A;  3K7L A;  1A85 A;  5CZM A;  1JH1 A;  1ATL A;  4H82 A;  3F19 A;  1EAK A;  2AYK A;  4IUW A;  4WK7 A;  3HBU P;  1OS2 A; 
#chains in the Genus database with same CATH homology
 1TVI A;  4JIU A;  1OZ9 A;  1XM5 A;  4AW6 A;  4JIX A;  1XAX A;  4QHF A;  3CQB A;  4IL3 A;  2YPT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...