1OZ9A

Crystal structure of aq_1354, a hypothetical protein from aquifex aeolicus
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
141
structure length
141
Chain Sequence
KNRVLVKLKKRKVRKDKIEKWAELALSALGLNNVELSVYITDDQEIRELNKTYRKKDKPTDVLSFPMGEEFGGYKILGDVVISQDTAERQARELGHSLEEEVKRLIVHGIVHLLGYDHEKGGEEEKKFRELENYVLSKLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Hypothetical protein AQ_1354
publication title Structure of the hypothetical protein AQ_1354 from Aquifex aeolicus.
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 58
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2003-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02130 UPF0054 Uncharacterized protein family UPF0054
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.30 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Metalloproteases ("zincins"), catalytic domain 1oz9A00
1OZ9A 1XM5A 1TVIA 1XAXA
chains in the Genus database with same CATH superfamily
2OXWA 966CA 1SLMA 2OY4A 1CAQA 1MNCA 1DTHA 1SATA 3USNA 3N2VA 1CIZA 1GKDA 4WKEA 5L7FA 1A85A 4HMAA 456CA 5I2ZA 1BUDA 3TSKA 4L7AA 1PWWA 1GE7A 3ZUKA 1IACA 1MMPA 4FXQA 2XS3A 1CQRA 2YUFA 1JKYA 4QKZA 2OVZA 4AIGA 1JJ9A 3LUNA 3DTEA 1IADA 3I7GA 1K7GA 3AYKA 3L0TA 1ASTA 2AYKA 3U1RA 3LKAA 4EFSA 1XFXA 3EWJA 2CKIA 1O0TA 1Y8JA 3EHYA 1XFWA 1I76A 3KMEA 1XFUA 1BSWA 1EAKA 1CK7A 1HTDA 2DDYA 1Y93A 4DD8A 1OO9A 1C3IA 3AYUA 2DDFA 1JIZA 2W15A 3LK8A 2JIHA 4DF9A 2MZHA 3KEKA 2X3CA 1JK3A 1SRPA 2Y6CA 4PKVA 4JIJA 1KBCA 2K2GA 3B2ZA 5D1TA 830CA 2Z2DA 3DPEA 1KUKA 1IAAA 1CGFA 1XUCA 3LMCA 2E2DA 1GXDA 3BA0A 1MMQA 2V4BA 4GF1A 1XFVA 1FM1A 2ERPA 1QJIA 3B8ZA 3LUMA 3SHIA 3B92A 1ROSA 4XM6A 4A7BA 1UEAA 5D7WA 4G0DA 3DL1A 1D5JA 3DNGA 2POJA 4H30A 1KUGA 1PWUA 3V96B 4H3XA 2DW0A 1YOUA 2KRJA 2OI0A 3WV1A 4GWMA 3WV3A 2OW0A 5I0LA 3KHIA 3O64A 3LE9A 1A86A 2YIGA 1EB6A 1UTZA 4H82A 4A3WA 1FLSA 4XBHA 4FU4A 1HFCA 2JSDA 1R1JA 3KMCA 1SMPA 2N8RA 1BIWA 1TVIA 4JP4A 4ON1A 1BQOA 3I7IA 1QJJA 1GO8P 1D8MA 4H49A 2MZIA 1YP1A 1HOVA 3G5CA 1YCMA 2JT6A 3OHOA 3F16A 1JH1A 3HY9A 3RTTA 3ZVSA 2L0RA 5CZMA 1OM6A 2WOAA 4IJOA 3K7NA 2W14A 3ELMA 1HFSA 3KWVC 1QIBA 5I3MA 3P1VA 3P24A 1XM5A 3EDGA 5LABA 1Y0VA 1R55A 1K7QA 1OZ9A 1BM6A 1R54A 3DPFA 1XURA 1PWQA 2A8HA 4H1QA 1D8FA 3KRYA 2OW1A 1Z3JA 1MMRA 1GE5A 5BPAA 1D7XA 1AKLA 2ERQA 1ATLA 1Q3AA 1KAPP 1UMSA 4I35A 1B3DA 4WK7A 1OS9A 3TT4A 1I73A 2EROA 3HBVP 5JMYA 3VI1A 2MLRA 4AYKA 2Y6DA 3HBUP 5D2BA 1BQQM 4PKWA 1KUIA 4JPAA 2E3XA 1CXVA 2X3BA 1USNA 3DWBA 4G9LA 1HY7A 3Q2HA 2OXZA 3HDAP 4L6TA 1QICA 4J4MA 2HU6A 1OM7A 4XCTA 1BKCI 3MA2A 1IAGA 1JIWP 1G12A 2TCLA 4FVLA 1GO7P 3KECA 1JANA 1ZVXA 5L79A 5CUHA 4PKUA 1UTTA 2D1NA 2O3EA 4CTHA 1OS2A 1MMBA 4HX3A 3TS4A 4PKTA 1GE6A 3TVCA 5B5OA 5H8XA 2W0DA 1AYKA 3LJTA 2MLSA 1AF0A 2W12A 3CKIA 1R1HA 1G49A 3G42A 4GR3A 1WNIA 5I12A 1SU3A 1RM8A 2WO9A 1ZXVA 4WKIA 1ND1A 1S4BP 3E8RA 3LGPA 3EDIA 3O2XA 1BZSA 2J83A 1G05A 4XM8A 2DW1A 1PWVA 1XUDA 1CGLA 2XS4A 2DW2A 3EDHA 4L19A 1RMZA 4JA1A 2CLTA 3K7LA 5D1SA 1HV5A 1IAEA 1IABA 1C7KA 2USNA 4H2EA 5D1UA 1PWPA 3F1AA 1QUAA 3AIGA 4I03A 1UMTA 1ZS0A 2MZEA 3EDZA 4PKRA 1H71P 5I43A 2J0TA 4WF6A 1C8TA 1G4KA 4JQGA 4ZR5A 4GR8A 3HDBA 4AXQA 2I47A 3RTSA 5BOTA 1J7NA 3LEAA 4DPEA 3DTIA 3LJGA 4IUWA 2D1OA 4PKSA 1XFYA 1QIAA 3LIRA 5CXAA 3EHXA 3Q2GA 4WZVA 4IN9A 1FBLA 2AIGP 3F15A 3LJZA 4PKQA 4GUYA 2YB9A 2K9CA 4GWNA 2JNPA 4ILWD 3HY7A 4Q1LA 1KUHA 2FV9A 4XM7A 1L6JA 4GQLA 1BKCE 3DTKA 3F19A 3VTGA 3HB2P 2FV5A 4L63A 2JT5A 3DSLA 3LQ0A 3OHLA 4FXYP 1XFZA 1EUBA 2O36A 3N2UA 2RJQA 3HYGA 4DV8A 1K7IA 3GBOA 4H76A 1JAOA 4AUOA 3NX7A 4GR0A 2OXUA 5B5PA 3UVCA 2PJTA 1KUFA 3F18A 1B8YA 4R3VA 2QPJA 1R1IA 2OZRA 1SLNA 3KEJA 1O0QA 3LQBA 1CGEA 3L0VA 1G9KA 2WO8A 1ZXCA 1I1IP 1JAQA 2RJPA 1XAXA 1DMTA 2OVXA 1BKCA 1OMJA 1GKCA 5BOYA 3ZXHA 1BUVM 1JAPA 5I4OA 2SRTA 1ZTQA 2X3AA 5D3CA 2OW2A 3WV2A 3F17A 2W13A 2X7MA 1ZP5A 1OM8A 2OW9A 4H84A 3LILA 1YQYA 3LIKA 2OY2A
chains in the Genus database with same CATH topology
1OZ9A 4QHFA 1XAXA 4AW6A 2YPTA 3CQBA 1XM5A 1TVIA 4JIXA 4JIUA 4IL3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OZ9 A;  1XM5 A;  1TVI A;  1XAX A; 
#chains in the Genus database with same CATH topology
 2OXW A;  966C A;  1SLM A;  2OY4 A;  1CAQ A;  1MNC A;  1DTH A;  1SAT A;  3USN A;  3N2V A;  1CIZ A;  1GKD A;  4WKE A;  5L7F A;  1A85 A;  4HMA A;  456C A;  5I2Z A;  1BUD A;  3TSK A;  4L7A A;  1PWW A;  1GE7 A;  3ZUK A;  1IAC A;  1MMP A;  4FXQ A;  2XS3 A;  1CQR A;  2YUF A;  1JKY A;  4QKZ A;  2OVZ A;  4AIG A;  1JJ9 A;  3LUN A;  3DTE A;  1IAD A;  3I7G A;  1K7G A;  3AYK A;  3L0T A;  1AST A;  2AYK A;  3U1R A;  3LKA A;  4EFS A;  1XFX A;  3EWJ A;  2CKI A;  1O0T A;  1Y8J A;  3EHY A;  1XFW A;  1I76 A;  3KME A;  1XFU A;  1BSW A;  1EAK A;  1CK7 A;  1HTD A;  2DDY A;  1Y93 A;  4DD8 A;  1OO9 A;  1C3I A;  3AYU A;  2DDF A;  1JIZ A;  2W15 A;  3LK8 A;  2JIH A;  4DF9 A;  2MZH A;  3KEK A;  2X3C A;  1JK3 A;  1SRP A;  2Y6C A;  4PKV A;  4JIJ A;  1KBC A;  2K2G A;  3B2Z A;  5D1T A;  830C A;  2Z2D A;  3DPE A;  1KUK A;  1IAA A;  1CGF A;  1XUC A;  3LMC A;  2E2D A;  1GXD A;  3BA0 A;  1MMQ A;  2V4B A;  4GF1 A;  1XFV A;  1FM1 A;  2ERP A;  1QJI A;  3B8Z A;  3LUM A;  3SHI A;  3B92 A;  1ROS A;  4XM6 A;  4A7B A;  1UEA A;  5D7W A;  4G0D A;  3DL1 A;  1D5J A;  3DNG A;  2POJ A;  4H30 A;  1KUG A;  1PWU A;  3V96 B;  4H3X A;  2DW0 A;  1YOU A;  2KRJ A;  2OI0 A;  3WV1 A;  4GWM A;  3WV3 A;  2OW0 A;  5I0L A;  3KHI A;  3O64 A;  3LE9 A;  1A86 A;  2YIG A;  1EB6 A;  1UTZ A;  4H82 A;  4A3W A;  1FLS A;  4XBH A;  4FU4 A;  1HFC A;  2JSD A;  1R1J A;  3KMC A;  1SMP A;  2N8R A;  1BIW A;  1TVI A;  4JP4 A;  4ON1 A;  1BQO A;  3I7I A;  1QJJ A;  1GO8 P;  1D8M A;  4H49 A;  2MZI A;  1YP1 A;  1HOV A;  3G5C A;  1YCM A;  2JT6 A;  3OHO A;  3F16 A;  1JH1 A;  3HY9 A;  3RTT A;  3ZVS A;  2L0R A;  5CZM A;  1OM6 A;  2WOA A;  4IJO A;  3K7N A;  2W14 A;  3ELM A;  1HFS A;  3KWV C;  1QIB A;  5I3M A;  3P1V A;  3P24 A;  1XM5 A;  3EDG A;  5LAB A;  1Y0V A;  1R55 A;  1K7Q A;  1OZ9 A;  1BM6 A;  1R54 A;  3DPF A;  1XUR A;  1PWQ A;  2A8H A;  4H1Q A;  1D8F A;  3KRY A;  2OW1 A;  1Z3J A;  1MMR A;  1GE5 A;  5BPA A;  1D7X A;  1AKL A;  2ERQ A;  1ATL A;  1Q3A A;  1KAP P;  1UMS A;  4I35 A;  1B3D A;  4WK7 A;  1OS9 A;  3TT4 A;  1I73 A;  2ERO A;  3HBV P;  5JMY A;  3VI1 A;  2MLR A;  4AYK A;  2Y6D A;  3HBU P;  5D2B A;  1BQQ M;  4PKW A;  1KUI A;  4JPA A;  2E3X A;  1CXV A;  2X3B A;  1USN A;  3DWB A;  4G9L A;  1HY7 A;  3Q2H A;  2OXZ A;  3HDA P;  4L6T A;  1QIC A;  4J4M A;  2HU6 A;  1OM7 A;  4XCT A;  1BKC I;  3MA2 A;  1IAG A;  1JIW P;  1G12 A;  2TCL A;  4FVL A;  1GO7 P;  3KEC A;  1JAN A;  1ZVX A;  5L79 A;  5CUH A;  4PKU A;  1UTT A;  2D1N A;  2O3E A;  4CTH A;  1OS2 A;  1MMB A;  4HX3 A;  3TS4 A;  4PKT A;  1GE6 A;  3TVC A;  5B5O A;  5H8X A;  2W0D A;  1AYK A;  3LJT A;  2MLS A;  1AF0 A;  2W12 A;  3CKI A;  1R1H A;  1G49 A;  3G42 A;  4GR3 A;  1WNI A;  5I12 A;  1SU3 A;  1RM8 A;  2WO9 A;  1ZXV A;  4WKI A;  1ND1 A;  1S4B P;  3E8R A;  3LGP A;  3EDI A;  3O2X A;  1BZS A;  2J83 A;  1G05 A;  4XM8 A;  2DW1 A;  1PWV A;  1XUD A;  1CGL A;  2XS4 A;  2DW2 A;  3EDH A;  4L19 A;  1RMZ A;  4JA1 A;  2CLT A;  3K7L A;  5D1S A;  1HV5 A;  1IAE A;  1IAB A;  1C7K A;  2USN A;  4H2E A;  5D1U A;  1PWP A;  3F1A A;  1QUA A;  3AIG A;  4I03 A;  1UMT A;  1ZS0 A;  2MZE A;  3EDZ A;  4PKR A;  1H71 P;  5I43 A;  2J0T A;  4WF6 A;  1C8T A;  1G4K A;  4JQG A;  4ZR5 A;  4GR8 A;  3HDB A;  4AXQ A;  2I47 A;  3RTS A;  5BOT A;  1J7N A;  3LEA A;  4DPE A;  3DTI A;  3LJG A;  4IUW A;  2D1O A;  4PKS A;  1XFY A;  1QIA A;  3LIR A;  5CXA A;  3EHX A;  3Q2G A;  4WZV A;  4IN9 A;  1FBL A;  2AIG P;  3F15 A;  3LJZ A;  4PKQ A;  4GUY A;  2YB9 A;  2K9C A;  4GWN A;  2JNP A;  4ILW D;  3HY7 A;  4Q1L A;  1KUH A;  2FV9 A;  4XM7 A;  1L6J A;  4GQL A;  1BKC E;  3DTK A;  3F19 A;  3VTG A;  3HB2 P;  2FV5 A;  4L63 A;  2JT5 A;  3DSL A;  3LQ0 A;  3OHL A;  4FXY P;  1XFZ A;  1EUB A;  2O36 A;  3N2U A;  2RJQ A;  3HYG A;  4DV8 A;  1K7I A;  3GBO A;  4H76 A;  1JAO A;  4AUO A;  3NX7 A;  4GR0 A;  2OXU A;  5B5P A;  3UVC A;  2PJT A;  1KUF A;  3F18 A;  1B8Y A;  4R3V A;  2QPJ A;  1R1I A;  2OZR A;  1SLN A;  3KEJ A;  1O0Q A;  3LQB A;  1CGE A;  3L0V A;  1G9K A;  2WO8 A;  1ZXC A;  1I1I P;  1JAQ A;  2RJP A;  1XAX A;  1DMT A;  2OVX A;  1BKC A;  1OMJ A;  1GKC A;  5BOY A;  3ZXH A;  1BUV M;  1JAP A;  5I4O A;  2SRT A;  1ZTQ A;  2X3A A;  5D3C A;  2OW2 A;  3WV2 A;  3F17 A;  2W13 A;  2X7M A;  1ZP5 A;  1OM8 A;  2OW9 A;  4H84 A;  3LIL A;  1YQY A;  3LIK A;  2OY2 A; 
#chains in the Genus database with same CATH homology
 1OZ9 A;  4QHF A;  1XAX A;  4AW6 A;  2YPT A;  3CQB A;  1XM5 A;  1TVI A;  4JIX A;  4JIU A;  4IL3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...