1OZ9A

Crystal structure of aq_1354, a hypothetical protein from aquifex aeolicus
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
141
structure length
141
Chain Sequence
b'KNRVLVKLKKRKVRKDKIEKWAELALSALGLNNVELSVYITDDQEIRELNKTYRKKDKPTDVLSFPMGEEFGGYKILGDVVISQDTAERQARELGHSLEEEVKRLIVHGIVHLLGYDHEKGGEEEKKFRELENYVLSKLSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein AQ_1354
publication title Structure of the hypothetical protein AQ_1354 from Aquifex aeolicus.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Unknown function
total genus 58
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2003-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02130 UPF0054 Uncharacterized protein family UPF0054
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.30 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Metalloproteases ("zincins"), catalytic domain 1oz9A00
1XAXA 1XM5A 1TVIA 1OZ9A
chains in the Genus database with same CATH superfamily
1G9KA 1HTDA 4L7AA 1HOVA 1XURA 1R1JA 3HDAP 2OZRA 1Z3JA 1QJJA 5D1TA 2JSDA 4FXQA 3AYUA 2EROA 4PKUA 1AKLA 4H30A 2MZHA 1OS9A 2X7MA 3SHIA 1MMRA 1JIWP 4XM8A 1IAAA 3EDIA 3LMCA 1SLMA 3LKAA 4A3WA 2V4BA 1GO7P 4G0DA 1BIWA 2DW0A 2KRJA 3Q2HA 2D1NA 4DPEA 3F16A 3OHLA 1BZSA 1UTZA 2MLSA 1K7GA 3HYGA 1PWQA 4R3VA 3ZUKA 1RM8A 2W12A 1FLSA 830CA 1XFUA 2OW0A 4XBHA 2O36A 3CKIA 1EUBA 1KAPP 1QJIA 3WV3A 2DDYA 3F19A 3G42A 4GR3A 5I4OA 3BA0A 2W15A 2AYKA 2USNA 5LABA 3F15A 3RTTA 1G4KA 2POJA 4ON1A 2QPJA 4PKSA 4FVLA 1GKCA 5B5OA 4DD8A 3USNA 1HY7A 4PKWA 1Y93A 2DW1A 4G9LA 1UEAA 2CKIA 4H1QA 5B5PA 2OW2A 1JAOA 1GE6A 1B3DA 1XFVA 1HFCA 3AYKA 1JKYA 5L7FA 3B2ZA 3N2UA 4DF9A 4H3XA 1I76A 2MZIA 1G05A 3LJZA 3K7NA 1D8FA 1S4BP 1MMBA 3EWJA 4AIGA 1IABA 3KRYA 1K7QA 2Y6DA 3AIGA 1CAQA 2HU6A 2J0TA 3P24A 1ZS0A 1XUCA 1BKCE 5D3CA 2X3BA 2OXZA 5CZMA 3F1AA 3UVCA 2Y6CA 3OHOA 4L63A 3I7GA 2W13A 1MNCA 2FV5A 1BQOA 1XM5A 3TVCA 2OXUA 1CQRA 3O64A 5BOYA 2PJTA 3O2XA 1AYKA 1KBCA 2RJQA 5I43A 1ZXCA 4A7BA 5D1SA 3LUNA 2YIGA 4JPAA 1OZ9A 3KHIA 1EB6A 1XFZA 1QICA 3KECA 4HMAA 2K2GA 4GWMA 3DPEA 2E2DA 3HY7A 2Z2DA 1D7XA 1Y0VA 3LUMA 1C8TA 1JANA 1KUFA 1RMZA 4GF1A 1IAGA 1KUIA 1A86A 1MMPA 3DTKA 2SRTA 1JK3A 2DDFA 1CIZA 3LIRA 4Q1LA 5JMYA 1R1HA 4FU4A 3K7LA 4H84A 3DSLA 1IADA 3GBOA 3LK8A 5I3MA 1SLNA 4AUOA 2J83A 1OMJA 3B92A 3HY9A 4PKTA 3TSKA 4AYKA 1CK7A 1FM1A 3DL1A 456CA 2XS4A 1PWPA 1BSWA 1J7NA 3LE9A 1XUDA 3LQBA 1WNIA 2DW2A 1YCMA 1ZXVA 4JIJA 2WO9A 1JAPA 3EDZA 1ROSA 1IACA 2CLTA 4GR8A 3U1RA 3ELMA 1OO9A 3WV1A 1ZTQA 3KWVC 1SU3A 1PWUA 4H82A 1R1IA 3TT4A 3KMEA 3LQ0A 3RTSA 5BPAA 2FV9A 2YB9A 4GR0A 1MMQA 1B8YA 3B8ZA 3NX7A 4AXQA 4L6TA 1YP1A 2YUFA 4H2EA 1GKDA 3HBVP 3EHYA 1G12A 1Q3AA 1BQQM 3WV2A 3Q2GA 3HDBA 2OXWA 1K7IA 1IAEA 1ZVXA 2OVZA 2JIHA 4HX3A 3L0VA 4PKVA 2ERPA 2OY4A 3LILA 4GQLA 3KEKA 4GUYA 4JA1A 3G5CA 3DPFA 3V96B 1G49A 4ZR5A 1UMSA 1JJ9A 2L0RA 2WOAA 5CXAA 1XFXA 3LJGA 1QIBA 3DTIA 1BKCI 1XFWA 2OY2A 1H71P 1R54A 4PKQA 1KUKA 3VTGA 1GXDA 3P1VA 4XM7A 2OW9A 1JIZA 4ILWD 2AIGP 1JH1A 2ERQA 1FBLA 4WF6A 1JAQA 4FXYP 1PWVA 4GWNA 1UMTA 2OVXA 1HFSA 1OM8A 4I03A 1SRPA 4WK7A 1D8MA 2O3EA 1OM6A 4IUWA 1TVIA 5I2ZA 3ZXHA 2OI0A 3HBUP 3F17A 2E3XA 3KMCA 4H49A 3LEAA 5I12A 1C7KA 4WKEA 4J4MA 1ASTA 3L0TA 2W14A 4I35A 2JNPA 1QIAA 1BKCA 1A85A 2K9CA 3EDHA 4IN9A 1R55A 966CA 1D5JA 2D1OA 1DMTA 2XS3A 3VI1A 1SMPA 3LGPA 5D1UA 1SATA 1AF0A 3E8RA 4CTHA 3KEJA 1BUDA 4XM6A 1PWWA 1CXVA 2MLRA 1ND1A 1ZP5A 3DNGA 1KUHA 1BUVM 4PKRA 1Y8JA 3I7IA 3F18A 1C3IA 3LJTA 5D7WA 1XFYA 4XCTA 1USNA 3MA2A 1UTTA 1EAKA 4JP4A 1O0TA 3EDGA 2I47A 1CGFA 4EFSA 1XAXA 4IJOA 1OS2A 1OM7A 2WO8A 3EHXA 1GO8P 2RJPA 5D2BA 5BOTA 1QUAA 2TCLA 2X3CA 2A8HA 3HB2P 4QKZA 3DWBA 5CUHA 4WKIA 2X3AA 3DTEA 3ZVSA 4DV8A 1GE5A 2N8RA 5H8XA 4H76A 1GE7A 1BM6A 1HV5A 2JT5A 5I0LA 1CGLA 1I73A 1I1IP 3N2VA 1O0QA 2MZEA 3TS4A 1CGEA 3LIKA 1KUGA 2OW1A 4L19A 4JQGA 2W0DA 5L79A 1L6JA 1YQYA 2JT6A 1ATLA 1DTHA 4WZVA 1YOUA
chains in the Genus database with same CATH topology
3CQBA 1XAXA 4IL3A 4AW6A 1TVIA 1OZ9A 4JIXA 1XM5A 2YPTA 4JIUA 4QHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XAX A;  1XM5 A;  1TVI A;  1OZ9 A; 
#chains in the Genus database with same CATH topology
 1G9K A;  1HTD A;  4L7A A;  1HOV A;  1XUR A;  1R1J A;  3HDA P;  2OZR A;  1Z3J A;  1QJJ A;  5D1T A;  2JSD A;  4FXQ A;  3AYU A;  2ERO A;  4PKU A;  1AKL A;  4H30 A;  2MZH A;  1OS9 A;  2X7M A;  3SHI A;  1MMR A;  1JIW P;  4XM8 A;  1IAA A;  3EDI A;  3LMC A;  1SLM A;  3LKA A;  4A3W A;  2V4B A;  1GO7 P;  4G0D A;  1BIW A;  2DW0 A;  2KRJ A;  3Q2H A;  2D1N A;  4DPE A;  3F16 A;  3OHL A;  1BZS A;  1UTZ A;  2MLS A;  1K7G A;  3HYG A;  1PWQ A;  4R3V A;  3ZUK A;  1RM8 A;  2W12 A;  1FLS A;  830C A;  1XFU A;  2OW0 A;  4XBH A;  2O36 A;  3CKI A;  1EUB A;  1KAP P;  1QJI A;  3WV3 A;  2DDY A;  3F19 A;  3G42 A;  4GR3 A;  5I4O A;  3BA0 A;  2W15 A;  2AYK A;  2USN A;  5LAB A;  3F15 A;  3RTT A;  1G4K A;  2POJ A;  4ON1 A;  2QPJ A;  4PKS A;  4FVL A;  1GKC A;  5B5O A;  4DD8 A;  3USN A;  1HY7 A;  4PKW A;  1Y93 A;  2DW1 A;  4G9L A;  1UEA A;  2CKI A;  4H1Q A;  5B5P A;  2OW2 A;  1JAO A;  1GE6 A;  1B3D A;  1XFV A;  1HFC A;  3AYK A;  1JKY A;  5L7F A;  3B2Z A;  3N2U A;  4DF9 A;  4H3X A;  1I76 A;  2MZI A;  1G05 A;  3LJZ A;  3K7N A;  1D8F A;  1S4B P;  1MMB A;  3EWJ A;  4AIG A;  1IAB A;  3KRY A;  1K7Q A;  2Y6D A;  3AIG A;  1CAQ A;  2HU6 A;  2J0T A;  3P24 A;  1ZS0 A;  1XUC A;  1BKC E;  5D3C A;  2X3B A;  2OXZ A;  5CZM A;  3F1A A;  3UVC A;  2Y6C A;  3OHO A;  4L63 A;  3I7G A;  2W13 A;  1MNC A;  2FV5 A;  1BQO A;  1XM5 A;  3TVC A;  2OXU A;  1CQR A;  3O64 A;  5BOY A;  2PJT A;  3O2X A;  1AYK A;  1KBC A;  2RJQ A;  5I43 A;  1ZXC A;  4A7B A;  5D1S A;  3LUN A;  2YIG A;  4JPA A;  1OZ9 A;  3KHI A;  1EB6 A;  1XFZ A;  1QIC A;  3KEC A;  4HMA A;  2K2G A;  4GWM A;  3DPE A;  2E2D A;  3HY7 A;  2Z2D A;  1D7X A;  1Y0V A;  3LUM A;  1C8T A;  1JAN A;  1KUF A;  1RMZ A;  4GF1 A;  1IAG A;  1KUI A;  1A86 A;  1MMP A;  3DTK A;  2SRT A;  1JK3 A;  2DDF A;  1CIZ A;  3LIR A;  4Q1L A;  5JMY A;  1R1H A;  4FU4 A;  3K7L A;  4H84 A;  3DSL A;  1IAD A;  3GBO A;  3LK8 A;  5I3M A;  1SLN A;  4AUO A;  2J83 A;  1OMJ A;  3B92 A;  3HY9 A;  4PKT A;  3TSK A;  4AYK A;  1CK7 A;  1FM1 A;  3DL1 A;  456C A;  2XS4 A;  1PWP A;  1BSW A;  1J7N A;  3LE9 A;  1XUD A;  3LQB A;  1WNI A;  2DW2 A;  1YCM A;  1ZXV A;  4JIJ A;  2WO9 A;  1JAP A;  3EDZ A;  1ROS A;  1IAC A;  2CLT A;  4GR8 A;  3U1R A;  3ELM A;  1OO9 A;  3WV1 A;  1ZTQ A;  3KWV C;  1SU3 A;  1PWU A;  4H82 A;  1R1I A;  3TT4 A;  3KME A;  3LQ0 A;  3RTS A;  5BPA A;  2FV9 A;  2YB9 A;  4GR0 A;  1MMQ A;  1B8Y A;  3B8Z A;  3NX7 A;  4AXQ A;  4L6T A;  1YP1 A;  2YUF A;  4H2E A;  1GKD A;  3HBV P;  3EHY A;  1G12 A;  1Q3A A;  1BQQ M;  3WV2 A;  3Q2G A;  3HDB A;  2OXW A;  1K7I A;  1IAE A;  1ZVX A;  2OVZ A;  2JIH A;  4HX3 A;  3L0V A;  4PKV A;  2ERP A;  2OY4 A;  3LIL A;  4GQL A;  3KEK A;  4GUY A;  4JA1 A;  3G5C A;  3DPF A;  3V96 B;  1G49 A;  4ZR5 A;  1UMS A;  1JJ9 A;  2L0R A;  2WOA A;  5CXA A;  1XFX A;  3LJG A;  1QIB A;  3DTI A;  1BKC I;  1XFW A;  2OY2 A;  1H71 P;  1R54 A;  4PKQ A;  1KUK A;  3VTG A;  1GXD A;  3P1V A;  4XM7 A;  2OW9 A;  1JIZ A;  4ILW D;  2AIG P;  1JH1 A;  2ERQ A;  1FBL A;  4WF6 A;  1JAQ A;  4FXY P;  1PWV A;  4GWN A;  1UMT A;  2OVX A;  1HFS A;  1OM8 A;  4I03 A;  1SRP A;  4WK7 A;  1D8M A;  2O3E A;  1OM6 A;  4IUW A;  1TVI A;  5I2Z A;  3ZXH A;  2OI0 A;  3HBU P;  3F17 A;  2E3X A;  3KMC A;  4H49 A;  3LEA A;  5I12 A;  1C7K A;  4WKE A;  4J4M A;  1AST A;  3L0T A;  2W14 A;  4I35 A;  2JNP A;  1QIA A;  1BKC A;  1A85 A;  2K9C A;  3EDH A;  4IN9 A;  1R55 A;  966C A;  1D5J A;  2D1O A;  1DMT A;  2XS3 A;  3VI1 A;  1SMP A;  3LGP A;  5D1U A;  1SAT A;  1AF0 A;  3E8R A;  4CTH A;  3KEJ A;  1BUD A;  4XM6 A;  1PWW A;  1CXV A;  2MLR A;  1ND1 A;  1ZP5 A;  3DNG A;  1KUH A;  1BUV M;  4PKR A;  1Y8J A;  3I7I A;  3F18 A;  1C3I A;  3LJT A;  5D7W A;  1XFY A;  4XCT A;  1USN A;  3MA2 A;  1UTT A;  1EAK A;  4JP4 A;  1O0T A;  3EDG A;  2I47 A;  1CGF A;  4EFS A;  1XAX A;  4IJO A;  1OS2 A;  1OM7 A;  2WO8 A;  3EHX A;  1GO8 P;  2RJP A;  5D2B A;  5BOT A;  1QUA A;  2TCL A;  2X3C A;  2A8H A;  3HB2 P;  4QKZ A;  3DWB A;  5CUH A;  4WKI A;  2X3A A;  3DTE A;  3ZVS A;  4DV8 A;  1GE5 A;  2N8R A;  5H8X A;  4H76 A;  1GE7 A;  1BM6 A;  1HV5 A;  2JT5 A;  5I0L A;  1CGL A;  1I73 A;  1I1I P;  3N2V A;  1O0Q A;  2MZE A;  3TS4 A;  1CGE A;  3LIK A;  1KUG A;  2OW1 A;  4L19 A;  4JQG A;  2W0D A;  5L79 A;  1L6J A;  1YQY A;  2JT6 A;  1ATL A;  1DTH A;  4WZV A;  1YOU A; 
#chains in the Genus database with same CATH homology
 3CQB A;  1XAX A;  4IL3 A;  4AW6 A;  1TVI A;  1OZ9 A;  4JIX A;  1XM5 A;  2YPT A;  4JIU A;  4QHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...