The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
32
|
sequence length |
157
|
structure length |
149
|
Chain Sequence |
AIPVYLWLKDDGGADIKGSVDVQDREGSIEVVAQEHCLYIPTDNNTGKLTGTRIHTPFLFTKEIDSSSPYLYKAVTTGQTLKSAEFKWYKIWDAGQEVEYFNTKLENVKVVKVNPVMHDHNHLEQVELRYEKITWTYKDGNIIHSDAWW
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structure of the Hcp1 protein from E. coli EAEC 042 pathovar, mutants N93W-S158W
rcsb |
| molecule keywords |
Putative type VI secretion protein
|
| molecule tags |
Protein binding
|
| source organism |
Escherichia coli
|
| total genus |
32
|
| structure length |
149
|
| sequence length |
157
|
| chains with identical sequence |
B, D, E, F, G
|
| ec nomenclature | |
| pdb deposition date | 2012-10-15 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF05638 | T6SS_HCP | Type VI secretion system effector, Hcp |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Roll | Pnp Oxidase; Chain A | Hcp1-like |
#chains in the Genus database with same CATH superfamily 3EAA A; 4TV4 A; 1Y12 A; 4HKH A; 4W64 A; 3V4H A; 3HE1 A; #chains in the Genus database with same CATH topology 3A20 A; 3F7E A; 1USF A; 1W3Q A; 2IML A; 3R5R A; 2HQ7 A; 3U0I A; 2E83 A; 3R5L A; 4XHY A; 1CI0 A; 2HTI A; 3DMB A; 4HMV A; 3ZOE A; 3SWJ A; 4TV4 A; 1WGB A; 3V4H A; 3TGV A; 4HMW A; 1G78 A; 3K87 A; 4HX6 A; 2OL5 A; 3BNK A; 3IN6 A; 1WLK A; 2D38 A; 3AWH A; 1W3O A; 4Y9I A; 3VY2 A; 2R6V A; 5ESC A; 3CP3 A; 3DB0 A; 2AQ6 A; 2IAB A; 2IG6 A; 4W64 A; 3R5Z A; 3CB0 A; 1G77 A; 1AXJ A; 1RZ1 A; 3ZOC A; 1W3P A; 3R5Y A; 4YWN A; 2I02 A; 4IRA A; 1Y30 A; 1YLN A; 3VYA A; 3BA3 A; 3U35 A; 2NR4 A; 2L1T A; 4MTK A; 3K88 A; 3AMF A; 3FKH A; 2X1J A; 2HTD A; 3R5W A; 5CHO A; 4Z85 A; 2VPA A; 5CHE C; 1I0R A; 3EAA A; 3ZOG A; 3GAS A; 1XXO A; 1FLM A; 2FG9 A; 3HE1 A; 1WV4 A; 2Q9K A; 5JAB A; 3U5W A; 2D37 A; 1G76 A; 2ARZ A; 3R5P A; 2D36 A; 2FHQ A; 2GJG A; 4UHV A; 2P5Z X; 2R0X A; 3E4V A; 2PTF A; 4N7R C; 2GUJ A; 2QEA A; 2X1K A; 4HMS A; 3ZOH A; 5BNC A; 1TY9 A; 4L82 A; 2QCK A; 2RE7 A; 2A2J A; 3KYF A; 1VL7 A; 3EC6 A; 1NRG A; 3PFT A; 3FGE A; 4HMU A; 3VY5 A; 4YBN A; 1W3R A; 2D5M A; 4XJ2 A; 3A6Q A; 1RFE A; 3A6R A; 4HMX A; 1WLI A; 4HKH A; 3K86 A; 1EJE A; 2FUR A; 3KYG A; 3ZOD A; 3NFW A; 1XHN A; 1RZ0 A; 2ECU A; 2ED4 A; 4R82 A; 2ECR A; 1DNL A; 3RH7 A; 3HY8 A; 2HHZ A; 4HMT A; 2ASF A; 3U34 A; 2K4Q A; 3ZOF A; 3BPK A; 1USC A; 2OU5 A; 3H96 A; 3HMZ A; 1T9M A; 3B5M A; 4F07 A; 2RDE A; 4QVB A; 1G79 A; 1Y12 A; 1JNW A; 1I0S A; 2I51 A; 3DNH A; 2HQ9 A; 4ZKY A; 1W9A A; 1YOA A; #chains in the Genus database with same CATH homology 3EAA A; 4TV4 A; 1Y12 A; 4HKH A; 4W64 A; 3V4H A; 3HE1 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...