1M93B

1.65 a structure of cleaved viral serpin crma
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
245
structure length
245
Chain Sequence
DISFKSMNKVYGRYSAVFKDSFLRKIGDNFQTVDFTDSRTVDAINKSVDIFTEGKINPLLDEPLSPDTSLLAISAVYFKAKWLMPFEKEFTSDYPFYVSPTEMVDVSMMSMYGEAFNHASVKESFGNFSIIELPYVGDTSMVVILPDNIDGLESIEQNLTDTNFKKWSDSMDAMFIDVHIPKFKVTGSYNLVDALVKLGLTEVFGSTGDYSNMSNSDVSVDAMIHKTYIDVNEEYTEAAAATSAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of viral serpin crmA provides insights into its mechanism of cysteine proteinase inhibition
pubmed rcsb
molecule keywords Serine proteinase inhibitor 2
molecule tags Viral protein
source organism Cowpox virus
total genus 58
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2002-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.39.10 Mainly Beta Roll Alpha-1-antitrypsin; domain 1 Alpha-1-antitrypsin, domain 1 1m93B02
3.30.497.10 Alpha Beta 2-Layer Sandwich Antithrombin; Chain I, domain 2 Antithrombin, subunit I, domain 2 1m93B01
1LJ5A 4ZK3A 2OL2A 4GA7A 1JTIA 3NE4A 3PZFA 1AZXI 2H4RA 1AS4A 4G8OA 2BEHL 4G8RA 1DB2A 1T1FA 1HP7A 5EI0A 3KCGI 1OPHA 2RIVA 3FGQA 3UT3A 1ATHA 1SR5A 4IC0A 2H4PA 3DY0A 3VVJA 8APIA 4C41A 1EZXA 2WXYC 2GD4C 2XN7A 2H4QA 4X30A 1MTPA 1YXAA 2PEFA 3CWMA 5BRRI 2RIWA 1E04I 2R9YA 1DZHI 3NDFA 5INWA 1B3KA 1BR8I 1OYHL 2V95A 2VDYA 3F5NA 2BEHI 2WXZC 1ATTA 1C8OA 2D26A 2ZV6A 5CDXA 2HIJI 4P0OA 4AJTA 1F0CA 1IZ2A 1OC0A 3EVJI 1QLPA 3CVMA 4ROAA 4BB2A 1E03I 1QMNA 5CDZA 3STOA 1DVMA 3R4LA 4IF8A 4DTEA 1R1LI 1TB6I 1SNGA 1JRRA 2B5TI 2XN6A 3DRUA 3F1SA 4EB1L 4AQHA 1HLEA 3B9FI 9APIA 2OAYA 1WZ9A 1M93B 3LW2A 1OYHI 1DZGL 1LK6I 1BY7A 1JMJA 1JVQI 4RSQA 4P0FA 3LE2A 1XQGA 3Q03A 4DY0A 1A7CA 1C5GA 1JMOA 3EOXA 1XU8A 4ROBA 2WXZA 1K9OI 3DLWA 1D5SA 1ATUA 3NDAA 1OO8A 4YIAA 4AJUA 2PEEA 2DUTA 1IMVA 1LQ8A 1ANTI 3H5CA 3F02A 3Q02A 4CAAA 1DVNA 4R9IA 1OVAC 2XN3A 2VDXA 2B4XL 1UHGA 1SEKA 2QUGA 4AU4A 2XN5A 4DY7C 1E05I 2HI9A 3ZHAA 7APIA 3NDDA 4PYWA 5IO1A 4AU3B 4EB1I 4ZK0A 5HGCA 1DZGI 2WXWA 2ARRA 4RO9A 1PSIA 3DRMA 9PAIA 3OZQA 2HIJL 1QMBA 3CWLA 2CEOA 2WXXA 3PB1I 4AFXA 4C49A 4AU3A 2WY0C 2ZNHA 1OVAB 2ACHA 3CAAA 5CE0A 4AU2A 4Y3KA 4Y40A 1NQ9I 1KCTA 3T1PA 2ANTI 2WY1A 1XQJA 5C98A 1DZHL 4KDSA 2B4XI 2VH4A 1JJOC 2ARQA 1OVAA
chains in the Genus database with same CATH superfamily
1LJ5A 4ZK3A 2OL2A 4GA7A 1JTIA 3NE4A 3PZFA 1AZXI 2H4RA 1AS4A 4G8OA 2BEHL 4G8RA 1DB2A 1T1FA 1HP7A 5EI0A 3KCGI 1OPHA 2RIVA 3FGQA 3UT3A 1ATHA 1SR5A 4IC0A 2H4PA 3DY0A 3VVJA 8APIA 4C41A 1EZXA 2WXYC 2GD4C 2XN7A 2H4QA 4X30A 1MTPA 1YXAA 2PEFA 3CWMA 5BRRI 2RIWA 1E04I 2R9YA 1DZHI 3NDFA 5INWA 1B3KA 1BR8I 1OYHL 2V95A 2VDYA 3F5NA 2BEHI 2WXZC 1ATTA 1C8OA 2D26A 2ZV6A 5CDXA 2HIJI 4P0OA 4AJTA 1F0CA 1IZ2A 1OC0A 3EVJI 1QLPA 3CVMA 4ROAA 4BB2A 1E03I 1QMNA 5CDZA 3STOA 1DVMA 3R4LA 4IF8A 4DTEA 1R1LI 1TB6I 1SNGA 1JRRA 2B5TI 2XN6A 3DRUA 3F1SA 4EB1L 4AQHA 1HLEA 3B9FI 9APIA 2OAYA 1WZ9A 1M93B 3LW2A 1OYHI 1DZGL 1LK6I 1BY7A 1JMJA 1JVQI 4RSQA 4P0FA 3LE2A 1XQGA 3Q03A 4DY0A 1A7CA 1C5GA 1JMOA 3EOXA 1XU8A 4ROBA 2WXZA 1K9OI 3DLWA 1D5SA 1ATUA 3NDAA 1OO8A 4YIAA 4AJUA 2PEEA 2DUTA 1IMVA 1LQ8A 1ANTI 3H5CA 3F02A 3Q02A 4CAAA 1DVNA 4R9IA 1OVAC 2XN3A 2VDXA 2B4XL 1UHGA 1SEKA 2QUGA 4AU4A 2XN5A 4DY7C 1E05I 2HI9A 3ZHAA 7APIA 3NDDA 4PYWA 5IO1A 4AU3B 4EB1I 4ZK0A 5HGCA 1DZGI 2WXWA 2ARRA 4RO9A 1PSIA 3DRMA 9PAIA 3OZQA 2HIJL 1QMBA 3CWLA 2CEOA 2WXXA 3PB1I 4AFXA 4C49A 4AU3A 2WY0C 2ZNHA 1OVAB 2ACHA 3CAAA 5CE0A 4AU2A 4Y3KA 4Y40A 1NQ9I 1KCTA 3T1PA 2ANTI 2WY1A 1XQJA 5C98A 1DZHL 4KDSA 2B4XI 2VH4A 1JJOC 2ARQA 1OVAA
chains in the Genus database with same CATH topology
1LJ5A 4ZK3A 2OL2A 4GA7A 1JTIA 3NE4A 3PZFA 1AZXI 2H4RA 1AS4A 4G8OA 2BEHL 4G8RA 1DB2A 1T1FA 1HP7A 5EI0A 3KCGI 1OPHA 2RIVA 3FGQA 3UT3A 1ATHA 1SR5A 4IC0A 2H4PA 3DY0A 3VVJA 8APIA 4C41A 1EZXA 2WXYC 2GD4C 2XN7A 2H4QA 4X30A 1MTPA 1YXAA 2PEFA 3CWMA 5BRRI 2RIWA 1E04I 2R9YA 1DZHI 3NDFA 5INWA 1B3KA 1BR8I 1OYHL 2V95A 2VDYA 3F5NA 2BEHI 2WXZC 1ATTA 1C8OA 2D26A 2ZV6A 5CDXA 2HIJI 4P0OA 4AJTA 1F0CA 1IZ2A 1OC0A 3EVJI 1QLPA 3CVMA 4ROAA 4BB2A 1E03I 1QMNA 5CDZA 3STOA 1DVMA 3R4LA 4IF8A 4DTEA 1R1LI 1TB6I 1SNGA 1JRRA 2B5TI 2XN6A 3DRUA 3F1SA 4EB1L 4AQHA 1HLEA 3B9FI 9APIA 2OAYA 1WZ9A 1M93B 3LW2A 1OYHI 1DZGL 1LK6I 1BY7A 1JMJA 1JVQI 4RSQA 4P0FA 3LE2A 1XQGA 3Q03A 4DY0A 1A7CA 1C5GA 1JMOA 3EOXA 1XU8A 4ROBA 2WXZA 1K9OI 3DLWA 1D5SA 1ATUA 3NDAA 1OO8A 4YIAA 4AJUA 2PEEA 2DUTA 1IMVA 1LQ8A 1ANTI 3H5CA 3F02A 3Q02A 4CAAA 1DVNA 4R9IA 1OVAC 2XN3A 2VDXA 2B4XL 1UHGA 1SEKA 2QUGA 4AU4A 2XN5A 4DY7C 1E05I 2HI9A 3ZHAA 7APIA 3NDDA 4PYWA 5IO1A 4AU3B 4EB1I 4ZK0A 5HGCA 1DZGI 2WXWA 2ARRA 4RO9A 1PSIA 3DRMA 9PAIA 3OZQA 2HIJL 1QMBA 3CWLA 2CEOA 2WXXA 3PB1I 4AFXA 4C49A 4AU3A 2WY0C 2ZNHA 1OVAB 2ACHA 3CAAA 5CE0A 4AU2A 4Y3KA 4Y40A 1NQ9I 1KCTA 3T1PA 2ANTI 2WY1A 1XQJA 5C98A 1DZHL 4KDSA 2B4XI 2VH4A 1JJOC 2ARQA 1OVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LJ5 A;  4ZK3 A;  2OL2 A;  4GA7 A;  1JTI A;  3NE4 A;  3PZF A;  1AZX I;  2H4R A;  1AS4 A;  4G8O A;  2BEH L;  4G8R A;  1DB2 A;  1T1F A;  1HP7 A;  5EI0 A;  3KCG I;  1OPH A;  2RIV A;  3FGQ A;  3UT3 A;  1ATH A;  1SR5 A;  4IC0 A;  2H4P A;  3DY0 A;  3VVJ A;  8API A;  4C41 A;  1EZX A;  2WXY C;  2GD4 C;  2XN7 A;  2H4Q A;  4X30 A;  1MTP A;  1YXA A;  2PEF A;  3CWM A;  5BRR I;  2RIW A;  1E04 I;  2R9Y A;  1DZH I;  3NDF A;  5INW A;  1B3K A;  1BR8 I;  1OYH L;  2V95 A;  2VDY A;  3F5N A;  2BEH I;  2WXZ C;  1ATT A;  1C8O A;  2D26 A;  2ZV6 A;  5CDX A;  2HIJ I;  4P0O A;  4AJT A;  1F0C A;  1IZ2 A;  1OC0 A;  3EVJ I;  1QLP A;  3CVM A;  4ROA A;  4BB2 A;  1E03 I;  1QMN A;  5CDZ A;  3STO A;  1DVM A;  3R4L A;  4IF8 A;  4DTE A;  1R1L I;  1TB6 I;  1SNG A;  1JRR A;  2B5T I;  2XN6 A;  3DRU A;  3F1S A;  4EB1 L;  4AQH A;  1HLE A;  3B9F I;  9API A;  2OAY A;  1WZ9 A;  1M93 B;  3LW2 A;  1OYH I;  1DZG L;  1LK6 I;  1BY7 A;  1JMJ A;  1JVQ I;  4RSQ A;  4P0F A;  3LE2 A;  1XQG A;  3Q03 A;  4DY0 A;  1A7C A;  1C5G A;  1JMO A;  3EOX A;  1XU8 A;  4ROB A;  2WXZ A;  1K9O I;  3DLW A;  1D5S A;  1ATU A;  3NDA A;  1OO8 A;  4YIA A;  4AJU A;  2PEE A;  2DUT A;  1IMV A;  1LQ8 A;  1ANT I;  3H5C A;  3F02 A;  3Q02 A;  4CAA A;  1DVN A;  4R9I A;  1OVA C;  2XN3 A;  2VDX A;  2B4X L;  1UHG A;  1SEK A;  2QUG A;  4AU4 A;  2XN5 A;  4DY7 C;  1E05 I;  2HI9 A;  3ZHA A;  7API A;  3NDD A;  4PYW A;  5IO1 A;  4AU3 B;  4EB1 I;  4ZK0 A;  5HGC A;  1DZG I;  2WXW A;  2ARR A;  4RO9 A;  1PSI A;  3DRM A;  9PAI A;  3OZQ A;  2HIJ L;  1QMB A;  3CWL A;  2CEO A;  2WXX A;  3PB1 I;  4AFX A;  4C49 A;  4AU3 A;  2WY0 C;  2ZNH A;  1OVA B;  2ACH A;  3CAA A;  5CE0 A;  4AU2 A;  4Y3K A;  4Y40 A;  1NQ9 I;  1KCT A;  3T1P A;  2ANT I;  2WY1 A;  1XQJ A;  5C98 A;  1DZH L;  4KDS A;  2B4X I;  2VH4 A;  1JJO C;  2ARQ A;  1OVA A; 
#chains in the Genus database with same CATH topology
 1LJ5 A;  4ZK3 A;  2OL2 A;  4GA7 A;  1JTI A;  3NE4 A;  3PZF A;  1AZX I;  2H4R A;  1AS4 A;  4G8O A;  2BEH L;  4G8R A;  1DB2 A;  1T1F A;  1HP7 A;  5EI0 A;  3KCG I;  1OPH A;  2RIV A;  3FGQ A;  3UT3 A;  1ATH A;  1SR5 A;  4IC0 A;  2H4P A;  3DY0 A;  3VVJ A;  8API A;  4C41 A;  1EZX A;  2WXY C;  2GD4 C;  2XN7 A;  2H4Q A;  4X30 A;  1MTP A;  1YXA A;  2PEF A;  3CWM A;  5BRR I;  2RIW A;  1E04 I;  2R9Y A;  1DZH I;  3NDF A;  5INW A;  1B3K A;  1BR8 I;  1OYH L;  2V95 A;  2VDY A;  3F5N A;  2BEH I;  2WXZ C;  1ATT A;  1C8O A;  2D26 A;  2ZV6 A;  5CDX A;  2HIJ I;  4P0O A;  4AJT A;  1F0C A;  1IZ2 A;  1OC0 A;  3EVJ I;  1QLP A;  3CVM A;  4ROA A;  4BB2 A;  1E03 I;  1QMN A;  5CDZ A;  3STO A;  1DVM A;  3R4L A;  4IF8 A;  4DTE A;  1R1L I;  1TB6 I;  1SNG A;  1JRR A;  2B5T I;  2XN6 A;  3DRU A;  3F1S A;  4EB1 L;  4AQH A;  1HLE A;  3B9F I;  9API A;  2OAY A;  1WZ9 A;  1M93 B;  3LW2 A;  1OYH I;  1DZG L;  1LK6 I;  1BY7 A;  1JMJ A;  1JVQ I;  4RSQ A;  4P0F A;  3LE2 A;  1XQG A;  3Q03 A;  4DY0 A;  1A7C A;  1C5G A;  1JMO A;  3EOX A;  1XU8 A;  4ROB A;  2WXZ A;  1K9O I;  3DLW A;  1D5S A;  1ATU A;  3NDA A;  1OO8 A;  4YIA A;  4AJU A;  2PEE A;  2DUT A;  1IMV A;  1LQ8 A;  1ANT I;  3H5C A;  3F02 A;  3Q02 A;  4CAA A;  1DVN A;  4R9I A;  1OVA C;  2XN3 A;  2VDX A;  2B4X L;  1UHG A;  1SEK A;  2QUG A;  4AU4 A;  2XN5 A;  4DY7 C;  1E05 I;  2HI9 A;  3ZHA A;  7API A;  3NDD A;  4PYW A;  5IO1 A;  4AU3 B;  4EB1 I;  4ZK0 A;  5HGC A;  1DZG I;  2WXW A;  2ARR A;  4RO9 A;  1PSI A;  3DRM A;  9PAI A;  3OZQ A;  2HIJ L;  1QMB A;  3CWL A;  2CEO A;  2WXX A;  3PB1 I;  4AFX A;  4C49 A;  4AU3 A;  2WY0 C;  2ZNH A;  1OVA B;  2ACH A;  3CAA A;  5CE0 A;  4AU2 A;  4Y3K A;  4Y40 A;  1NQ9 I;  1KCT A;  3T1P A;  2ANT I;  2WY1 A;  1XQJ A;  5C98 A;  1DZH L;  4KDS A;  2B4X I;  2VH4 A;  1JJO C;  2ARQ A;  1OVA A; 
#chains in the Genus database with same CATH homology
 1LJ5 A;  4ZK3 A;  2OL2 A;  4GA7 A;  1JTI A;  3NE4 A;  3PZF A;  1AZX I;  2H4R A;  1AS4 A;  4G8O A;  2BEH L;  4G8R A;  1DB2 A;  1T1F A;  1HP7 A;  5EI0 A;  3KCG I;  1OPH A;  2RIV A;  3FGQ A;  3UT3 A;  1ATH A;  1SR5 A;  4IC0 A;  2H4P A;  3DY0 A;  3VVJ A;  8API A;  4C41 A;  1EZX A;  2WXY C;  2GD4 C;  2XN7 A;  2H4Q A;  4X30 A;  1MTP A;  1YXA A;  2PEF A;  3CWM A;  5BRR I;  2RIW A;  1E04 I;  2R9Y A;  1DZH I;  3NDF A;  5INW A;  1B3K A;  1BR8 I;  1OYH L;  2V95 A;  2VDY A;  3F5N A;  2BEH I;  2WXZ C;  1ATT A;  1C8O A;  2D26 A;  2ZV6 A;  5CDX A;  2HIJ I;  4P0O A;  4AJT A;  1F0C A;  1IZ2 A;  1OC0 A;  3EVJ I;  1QLP A;  3CVM A;  4ROA A;  4BB2 A;  1E03 I;  1QMN A;  5CDZ A;  3STO A;  1DVM A;  3R4L A;  4IF8 A;  4DTE A;  1R1L I;  1TB6 I;  1SNG A;  1JRR A;  2B5T I;  2XN6 A;  3DRU A;  3F1S A;  4EB1 L;  4AQH A;  1HLE A;  3B9F I;  9API A;  2OAY A;  1WZ9 A;  1M93 B;  3LW2 A;  1OYH I;  1DZG L;  1LK6 I;  1BY7 A;  1JMJ A;  1JVQ I;  4RSQ A;  4P0F A;  3LE2 A;  1XQG A;  3Q03 A;  4DY0 A;  1A7C A;  1C5G A;  1JMO A;  3EOX A;  1XU8 A;  4ROB A;  2WXZ A;  1K9O I;  3DLW A;  1D5S A;  1ATU A;  3NDA A;  1OO8 A;  4YIA A;  4AJU A;  2PEE A;  2DUT A;  1IMV A;  1LQ8 A;  1ANT I;  3H5C A;  3F02 A;  3Q02 A;  4CAA A;  1DVN A;  4R9I A;  1OVA C;  2XN3 A;  2VDX A;  2B4X L;  1UHG A;  1SEK A;  2QUG A;  4AU4 A;  2XN5 A;  4DY7 C;  1E05 I;  2HI9 A;  3ZHA A;  7API A;  3NDD A;  4PYW A;  5IO1 A;  4AU3 B;  4EB1 I;  4ZK0 A;  5HGC A;  1DZG I;  2WXW A;  2ARR A;  4RO9 A;  1PSI A;  3DRM A;  9PAI A;  3OZQ A;  2HIJ L;  1QMB A;  3CWL A;  2CEO A;  2WXX A;  3PB1 I;  4AFX A;  4C49 A;  4AU3 A;  2WY0 C;  2ZNH A;  1OVA B;  2ACH A;  3CAA A;  5CE0 A;  4AU2 A;  4Y3K A;  4Y40 A;  1NQ9 I;  1KCT A;  3T1P A;  2ANT I;  2WY1 A;  1XQJ A;  5C98 A;  1DZH L;  4KDS A;  2B4X I;  2VH4 A;  1JJO C;  2ARQ A;  1OVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...