2D26A

Active site distortion is sufficient for proteinase inhibit second crystal structure of covalent serpin-proteinase complex
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
336
structure length
336
Chain Sequence
FNKITPNLAEFAFSLYRQLAHQSNSTNILFSPVSIAAAFAMLSLGAKGDTHDEILEGLNFNLTEIPEAQIHEGFQELLHTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHSKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active Site Distortion Is Sufficient for Proteinase Inhibition by Serpins: Structure of the covalent complex of alpha 1-proteinase inhibitor with porcine pancreatic elastase
pubmed doi rcsb
molecule keywords Alpha-1-antitrypsin
molecule tags Hydrolase/hydrolase inhibitor
source organism Homo sapiens
total genus 58
structure length 336
sequence length 336
ec nomenclature
pdb deposition date 2005-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.39.10 Mainly Beta Roll Alpha-1-antitrypsin; domain 1 Alpha-1-antitrypsin, domain 1 2d26A02
3.30.497.10 Alpha Beta 2-Layer Sandwich Antithrombin; Chain I, domain 2 Antithrombin, subunit I, domain 2 2d26A01
2B5TI 4DY7C 1HP7A 4IC0A 1C5GA 1D5SA 1DZGI 1SEKA 1UHGA 4G8RA 1BY7A 1LJ5A 2B4XL 1YXAA 1B3KA 1LK6I 1WZ9A 2ZNHA 3STOA 4AU3B 3CAAA 3DRUA 3LW2A 8APIA 3UT3A 2VDXA 4ROBA 3NE4A 1IMVA 4RO9A 2BEHI 1A7CA 2ZV6A 1OO8A 4AU3A 2XN3A 3DLWA 4Y3KA 3CWMA 2XN5A 2WY0C 1OYHL 3CWLA 1XQJA 3KCGI 5CE0A 2GD4C 3H5CA 4EB1L 3NDDA 2QUGA 1F0CA 4X30A 3VVJA 5INWA 4ZK0A 1JVQI 1XQGA 1JMJA 3PZFA 3EVJI 1NQ9I 4R9IA 4Y40A 1MTPA 1R1LI 4AFXA 4ZK3A 4ROAA 1TB6I 1ATTA 4P0FA 1JJOC 1KCTA 1SNGA 3ZHAA 4C41A 3F1SA 2RIWA 1DZGL 1ATUA 3DRMA 4P0OA 1JTIA 2ARRA 4RSQA 1OC0A 3NDFA 1EZXA 1DZHI 7APIA 1OPHA 3NDAA 1E05I 5CDXA 3B9FI 3R4LA 9APIA 2HI9A 2R9YA 4AU2A 1LQ8A 1DVNA 5C98A 2HIJI 4BB2A 1AS4A 2V95A 3FGQA 4DTEA 2RIVA 1OVAA 2BEHL 4AQHA 4YIAA 2XN6A 1E03I 1JMOA 1DVMA 2WXZA 1PSIA 2CEOA 3EOXA 2H4PA 1AZXI 5BRRI 3PB1I 5EI0A 2OAYA 4AJUA 1DZHL 3F02A 3F5NA 2B4XI 1ANTI 1M93B 3DY0A 1ATHA 4DY0A 4PYWA 2ARQA 2ANTI 2OL2A 1IZ2A 1JRRA 1DB2A 2WXZC 4C49A 9PAIA 2PEFA 5IO1A 3OZQA 1OVAB 1BR8I 2WXYC 5HGCA 3T1PA 3Q02A 4G8OA 2D26A 2DUTA 2ACHA 1XU8A 1QMBA 2H4QA 1OYHI 2XN7A 2VH4A 2WXXA 1K9OI 1QLPA 1HLEA 4EB1I 4IF8A 2WXWA 1C8OA 4AU4A 3LE2A 2VDYA 2H4RA 1E04I 4KDSA 1T1FA 2WY1A 5CDZA 3Q03A 4AJTA 2PEEA 3CVMA 1SR5A 4CAAA 4GA7A 2HIJL 1OVAC 1QMNA
chains in the Genus database with same CATH superfamily
2B5TI 4DY7C 1HP7A 4IC0A 1C5GA 1D5SA 1DZGI 1SEKA 1UHGA 4G8RA 1BY7A 1LJ5A 2B4XL 1YXAA 1B3KA 1LK6I 1WZ9A 2ZNHA 3STOA 4AU3B 3CAAA 3DRUA 3LW2A 8APIA 3UT3A 2VDXA 4ROBA 3NE4A 1IMVA 4RO9A 2BEHI 1A7CA 2ZV6A 1OO8A 4AU3A 2XN3A 3DLWA 4Y3KA 3CWMA 2XN5A 2WY0C 1OYHL 3CWLA 1XQJA 3KCGI 5CE0A 2GD4C 3H5CA 4EB1L 3NDDA 2QUGA 1F0CA 4X30A 3VVJA 5INWA 4ZK0A 1JVQI 1XQGA 1JMJA 3PZFA 3EVJI 1NQ9I 4R9IA 4Y40A 1MTPA 1R1LI 4AFXA 4ZK3A 4ROAA 1TB6I 1ATTA 4P0FA 1JJOC 1KCTA 1SNGA 3ZHAA 4C41A 3F1SA 2RIWA 1DZGL 1ATUA 3DRMA 4P0OA 1JTIA 2ARRA 4RSQA 1OC0A 3NDFA 1EZXA 1DZHI 7APIA 1OPHA 3NDAA 1E05I 5CDXA 3B9FI 3R4LA 9APIA 2HI9A 2R9YA 4AU2A 1LQ8A 1DVNA 5C98A 2HIJI 4BB2A 1AS4A 2V95A 3FGQA 4DTEA 2RIVA 1OVAA 2BEHL 4AQHA 4YIAA 2XN6A 1E03I 1JMOA 1DVMA 2WXZA 1PSIA 2CEOA 3EOXA 2H4PA 1AZXI 5BRRI 3PB1I 5EI0A 2OAYA 4AJUA 1DZHL 3F02A 3F5NA 2B4XI 1ANTI 1M93B 3DY0A 1ATHA 4DY0A 4PYWA 2ARQA 2ANTI 2OL2A 1IZ2A 1JRRA 1DB2A 2WXZC 4C49A 9PAIA 2PEFA 5IO1A 3OZQA 1OVAB 1BR8I 2WXYC 5HGCA 3T1PA 3Q02A 4G8OA 2D26A 2DUTA 2ACHA 1XU8A 1QMBA 2H4QA 1OYHI 2XN7A 2VH4A 2WXXA 1K9OI 1QLPA 1HLEA 4EB1I 4IF8A 2WXWA 1C8OA 4AU4A 3LE2A 2VDYA 2H4RA 1E04I 4KDSA 1T1FA 2WY1A 5CDZA 3Q03A 4AJTA 2PEEA 3CVMA 1SR5A 4CAAA 4GA7A 2HIJL 1OVAC 1QMNA
chains in the Genus database with same CATH topology
2B5TI 4DY7C 1HP7A 4IC0A 1C5GA 1D5SA 1DZGI 1SEKA 1UHGA 4G8RA 1BY7A 1LJ5A 2B4XL 1YXAA 1B3KA 1LK6I 1WZ9A 2ZNHA 3STOA 4AU3B 3CAAA 3DRUA 3LW2A 8APIA 3UT3A 2VDXA 4ROBA 3NE4A 1IMVA 4RO9A 2BEHI 1A7CA 2ZV6A 1OO8A 4AU3A 2XN3A 3DLWA 4Y3KA 3CWMA 2XN5A 2WY0C 1OYHL 3CWLA 1XQJA 3KCGI 5CE0A 2GD4C 3H5CA 4EB1L 3NDDA 2QUGA 1F0CA 4X30A 3VVJA 5INWA 4ZK0A 1JVQI 1XQGA 1JMJA 3PZFA 3EVJI 1NQ9I 4R9IA 4Y40A 1MTPA 1R1LI 4AFXA 4ZK3A 4ROAA 1TB6I 1ATTA 4P0FA 1JJOC 1KCTA 1SNGA 3ZHAA 4C41A 3F1SA 2RIWA 1DZGL 1ATUA 3DRMA 4P0OA 1JTIA 2ARRA 4RSQA 1OC0A 3NDFA 1EZXA 1DZHI 7APIA 1OPHA 3NDAA 1E05I 5CDXA 3B9FI 3R4LA 9APIA 2HI9A 2R9YA 4AU2A 1LQ8A 1DVNA 5C98A 2HIJI 4BB2A 1AS4A 2V95A 3FGQA 4DTEA 2RIVA 1OVAA 2BEHL 4AQHA 4YIAA 2XN6A 1E03I 1JMOA 1DVMA 2WXZA 1PSIA 2CEOA 3EOXA 2H4PA 1AZXI 5BRRI 3PB1I 5EI0A 2OAYA 4AJUA 1DZHL 3F02A 3F5NA 2B4XI 1ANTI 1M93B 3DY0A 1ATHA 4DY0A 4PYWA 2ARQA 2ANTI 2OL2A 1IZ2A 1JRRA 1DB2A 2WXZC 4C49A 9PAIA 2PEFA 5IO1A 3OZQA 1OVAB 1BR8I 2WXYC 5HGCA 3T1PA 3Q02A 4G8OA 2D26A 2DUTA 2ACHA 1XU8A 1QMBA 2H4QA 1OYHI 2XN7A 2VH4A 2WXXA 1K9OI 1QLPA 1HLEA 4EB1I 4IF8A 2WXWA 1C8OA 4AU4A 3LE2A 2VDYA 2H4RA 1E04I 4KDSA 1T1FA 2WY1A 5CDZA 3Q03A 4AJTA 2PEEA 3CVMA 1SR5A 4CAAA 4GA7A 2HIJL 1OVAC 1QMNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B5T I;  4DY7 C;  1HP7 A;  4IC0 A;  1C5G A;  1D5S A;  1DZG I;  1SEK A;  1UHG A;  4G8R A;  1BY7 A;  1LJ5 A;  2B4X L;  1YXA A;  1B3K A;  1LK6 I;  1WZ9 A;  2ZNH A;  3STO A;  4AU3 B;  3CAA A;  3DRU A;  3LW2 A;  8API A;  3UT3 A;  2VDX A;  4ROB A;  3NE4 A;  1IMV A;  4RO9 A;  2BEH I;  1A7C A;  2ZV6 A;  1OO8 A;  4AU3 A;  2XN3 A;  3DLW A;  4Y3K A;  3CWM A;  2XN5 A;  2WY0 C;  1OYH L;  3CWL A;  1XQJ A;  3KCG I;  5CE0 A;  2GD4 C;  3H5C A;  4EB1 L;  3NDD A;  2QUG A;  1F0C A;  4X30 A;  3VVJ A;  5INW A;  4ZK0 A;  1JVQ I;  1XQG A;  1JMJ A;  3PZF A;  3EVJ I;  1NQ9 I;  4R9I A;  4Y40 A;  1MTP A;  1R1L I;  4AFX A;  4ZK3 A;  4ROA A;  1TB6 I;  1ATT A;  4P0F A;  1JJO C;  1KCT A;  1SNG A;  3ZHA A;  4C41 A;  3F1S A;  2RIW A;  1DZG L;  1ATU A;  3DRM A;  4P0O A;  1JTI A;  2ARR A;  4RSQ A;  1OC0 A;  3NDF A;  1EZX A;  1DZH I;  7API A;  1OPH A;  3NDA A;  1E05 I;  5CDX A;  3B9F I;  3R4L A;  9API A;  2HI9 A;  2R9Y A;  4AU2 A;  1LQ8 A;  1DVN A;  5C98 A;  2HIJ I;  4BB2 A;  1AS4 A;  2V95 A;  3FGQ A;  4DTE A;  2RIV A;  1OVA A;  2BEH L;  4AQH A;  4YIA A;  2XN6 A;  1E03 I;  1JMO A;  1DVM A;  2WXZ A;  1PSI A;  2CEO A;  3EOX A;  2H4P A;  1AZX I;  5BRR I;  3PB1 I;  5EI0 A;  2OAY A;  4AJU A;  1DZH L;  3F02 A;  3F5N A;  2B4X I;  1ANT I;  1M93 B;  3DY0 A;  1ATH A;  4DY0 A;  4PYW A;  2ARQ A;  2ANT I;  2OL2 A;  1IZ2 A;  1JRR A;  1DB2 A;  2WXZ C;  4C49 A;  9PAI A;  2PEF A;  5IO1 A;  3OZQ A;  1OVA B;  1BR8 I;  2WXY C;  5HGC A;  3T1P A;  3Q02 A;  4G8O A;  2D26 A;  2DUT A;  2ACH A;  1XU8 A;  1QMB A;  2H4Q A;  1OYH I;  2XN7 A;  2VH4 A;  2WXX A;  1K9O I;  1QLP A;  1HLE A;  4EB1 I;  4IF8 A;  2WXW A;  1C8O A;  4AU4 A;  3LE2 A;  2VDY A;  2H4R A;  1E04 I;  4KDS A;  1T1F A;  2WY1 A;  5CDZ A;  3Q03 A;  4AJT A;  2PEE A;  3CVM A;  1SR5 A;  4CAA A;  4GA7 A;  2HIJ L;  1OVA C;  1QMN A; 
#chains in the Genus database with same CATH topology
 2B5T I;  4DY7 C;  1HP7 A;  4IC0 A;  1C5G A;  1D5S A;  1DZG I;  1SEK A;  1UHG A;  4G8R A;  1BY7 A;  1LJ5 A;  2B4X L;  1YXA A;  1B3K A;  1LK6 I;  1WZ9 A;  2ZNH A;  3STO A;  4AU3 B;  3CAA A;  3DRU A;  3LW2 A;  8API A;  3UT3 A;  2VDX A;  4ROB A;  3NE4 A;  1IMV A;  4RO9 A;  2BEH I;  1A7C A;  2ZV6 A;  1OO8 A;  4AU3 A;  2XN3 A;  3DLW A;  4Y3K A;  3CWM A;  2XN5 A;  2WY0 C;  1OYH L;  3CWL A;  1XQJ A;  3KCG I;  5CE0 A;  2GD4 C;  3H5C A;  4EB1 L;  3NDD A;  2QUG A;  1F0C A;  4X30 A;  3VVJ A;  5INW A;  4ZK0 A;  1JVQ I;  1XQG A;  1JMJ A;  3PZF A;  3EVJ I;  1NQ9 I;  4R9I A;  4Y40 A;  1MTP A;  1R1L I;  4AFX A;  4ZK3 A;  4ROA A;  1TB6 I;  1ATT A;  4P0F A;  1JJO C;  1KCT A;  1SNG A;  3ZHA A;  4C41 A;  3F1S A;  2RIW A;  1DZG L;  1ATU A;  3DRM A;  4P0O A;  1JTI A;  2ARR A;  4RSQ A;  1OC0 A;  3NDF A;  1EZX A;  1DZH I;  7API A;  1OPH A;  3NDA A;  1E05 I;  5CDX A;  3B9F I;  3R4L A;  9API A;  2HI9 A;  2R9Y A;  4AU2 A;  1LQ8 A;  1DVN A;  5C98 A;  2HIJ I;  4BB2 A;  1AS4 A;  2V95 A;  3FGQ A;  4DTE A;  2RIV A;  1OVA A;  2BEH L;  4AQH A;  4YIA A;  2XN6 A;  1E03 I;  1JMO A;  1DVM A;  2WXZ A;  1PSI A;  2CEO A;  3EOX A;  2H4P A;  1AZX I;  5BRR I;  3PB1 I;  5EI0 A;  2OAY A;  4AJU A;  1DZH L;  3F02 A;  3F5N A;  2B4X I;  1ANT I;  1M93 B;  3DY0 A;  1ATH A;  4DY0 A;  4PYW A;  2ARQ A;  2ANT I;  2OL2 A;  1IZ2 A;  1JRR A;  1DB2 A;  2WXZ C;  4C49 A;  9PAI A;  2PEF A;  5IO1 A;  3OZQ A;  1OVA B;  1BR8 I;  2WXY C;  5HGC A;  3T1P A;  3Q02 A;  4G8O A;  2D26 A;  2DUT A;  2ACH A;  1XU8 A;  1QMB A;  2H4Q A;  1OYH I;  2XN7 A;  2VH4 A;  2WXX A;  1K9O I;  1QLP A;  1HLE A;  4EB1 I;  4IF8 A;  2WXW A;  1C8O A;  4AU4 A;  3LE2 A;  2VDY A;  2H4R A;  1E04 I;  4KDS A;  1T1F A;  2WY1 A;  5CDZ A;  3Q03 A;  4AJT A;  2PEE A;  3CVM A;  1SR5 A;  4CAA A;  4GA7 A;  2HIJ L;  1OVA C;  1QMN A; 
#chains in the Genus database with same CATH homology
 2B5T I;  4DY7 C;  1HP7 A;  4IC0 A;  1C5G A;  1D5S A;  1DZG I;  1SEK A;  1UHG A;  4G8R A;  1BY7 A;  1LJ5 A;  2B4X L;  1YXA A;  1B3K A;  1LK6 I;  1WZ9 A;  2ZNH A;  3STO A;  4AU3 B;  3CAA A;  3DRU A;  3LW2 A;  8API A;  3UT3 A;  2VDX A;  4ROB A;  3NE4 A;  1IMV A;  4RO9 A;  2BEH I;  1A7C A;  2ZV6 A;  1OO8 A;  4AU3 A;  2XN3 A;  3DLW A;  4Y3K A;  3CWM A;  2XN5 A;  2WY0 C;  1OYH L;  3CWL A;  1XQJ A;  3KCG I;  5CE0 A;  2GD4 C;  3H5C A;  4EB1 L;  3NDD A;  2QUG A;  1F0C A;  4X30 A;  3VVJ A;  5INW A;  4ZK0 A;  1JVQ I;  1XQG A;  1JMJ A;  3PZF A;  3EVJ I;  1NQ9 I;  4R9I A;  4Y40 A;  1MTP A;  1R1L I;  4AFX A;  4ZK3 A;  4ROA A;  1TB6 I;  1ATT A;  4P0F A;  1JJO C;  1KCT A;  1SNG A;  3ZHA A;  4C41 A;  3F1S A;  2RIW A;  1DZG L;  1ATU A;  3DRM A;  4P0O A;  1JTI A;  2ARR A;  4RSQ A;  1OC0 A;  3NDF A;  1EZX A;  1DZH I;  7API A;  1OPH A;  3NDA A;  1E05 I;  5CDX A;  3B9F I;  3R4L A;  9API A;  2HI9 A;  2R9Y A;  4AU2 A;  1LQ8 A;  1DVN A;  5C98 A;  2HIJ I;  4BB2 A;  1AS4 A;  2V95 A;  3FGQ A;  4DTE A;  2RIV A;  1OVA A;  2BEH L;  4AQH A;  4YIA A;  2XN6 A;  1E03 I;  1JMO A;  1DVM A;  2WXZ A;  1PSI A;  2CEO A;  3EOX A;  2H4P A;  1AZX I;  5BRR I;  3PB1 I;  5EI0 A;  2OAY A;  4AJU A;  1DZH L;  3F02 A;  3F5N A;  2B4X I;  1ANT I;  1M93 B;  3DY0 A;  1ATH A;  4DY0 A;  4PYW A;  2ARQ A;  2ANT I;  2OL2 A;  1IZ2 A;  1JRR A;  1DB2 A;  2WXZ C;  4C49 A;  9PAI A;  2PEF A;  5IO1 A;  3OZQ A;  1OVA B;  1BR8 I;  2WXY C;  5HGC A;  3T1P A;  3Q02 A;  4G8O A;  2D26 A;  2DUT A;  2ACH A;  1XU8 A;  1QMB A;  2H4Q A;  1OYH I;  2XN7 A;  2VH4 A;  2WXX A;  1K9O I;  1QLP A;  1HLE A;  4EB1 I;  4IF8 A;  2WXW A;  1C8O A;  4AU4 A;  3LE2 A;  2VDY A;  2H4R A;  1E04 I;  4KDS A;  1T1F A;  2WY1 A;  5CDZ A;  3Q03 A;  4AJT A;  2PEE A;  3CVM A;  1SR5 A;  4CAA A;  4GA7 A;  2HIJ L;  1OVA C;  1QMN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...