4Y40A

Structure of vaspin mutant d305c v383c
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
379
structure length
366
Chain Sequence
VQGWKQRMAAKELARQNMDLGFKLLKKLAFYNPGRNIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLHEGFHYIIHELTQKTQDLKLSIGNTLFIDQRLQPQRKFLEDAKNFYSAETILTNFQNLEMAQKQINDFISQKTHGKINNLIENIDPGTVMLLANYIFFRARWKHEFDPNVTKEEDFFLEKNSSVKVPMMFRSGIYQVGYDDKLSCTILEIPYQKNITAIFILPDEGKLKHLEKGLQVDTFSRWKTLLSRRVVCVSVPRLHMTGTFDLKKTLSYIGVSKIFEEHGDLTKIAPHRSLKVGEAVHKAELKMDERGTETPLCVKIDKPYLLLIYSEKIPSVLFLGKIVNPIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A unique serpin P1' glutamate and a conserved beta-sheet C arginine are key residues for activity, protease recognition and stability of serpinA12 (vaspin).
pubmed doi rcsb
molecule keywords Serpin A12
molecule tags Hydrloase inhibitor
source organism Homo sapiens
total genus 121
structure length 366
sequence length 379
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00079 Serpin Serpin (serine protease inhibitor)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.39.10 Mainly Beta Roll Alpha-1-antitrypsin; domain 1 Alpha-1-antitrypsin, domain 1 4y40A02
3.30.497.10 Alpha Beta 2-Layer Sandwich Antithrombin; Chain I, domain 2 Antithrombin, subunit I, domain 2 4y40A01
3FGQA 1OPHA 3F02A 4GA7A 3UT3A 4AFXA 1TB6I 1A7CA 2ARRA 2BEHL 2WXWA 3DRUA 4G8OA 2OAYA 1QMBA 3EOXA 1DZGL 1LJ5A 1WZ9A 4AJTA 4C41A 3CWMA 2WY0C 3NDAA 2HIJL 1DVMA 5INWA 4ZK0A 4AU3A 1E05I 3NE4A 4ROBA 2DUTA 4BB2A 3KCGI 1JTIA 4R9IA 1MTPA 1F0CA 3Q02A 1AS4A 2D26A 2WY1A 3LW2A 3H5CA 4YIAA 2HI9A 4IC0A 4CAAA 2VH4A 4AU3B 1IMVA 2BEHI 2H4QA 3Q03A 1JRRA 5CE0A 1HP7A 1JJOC 4ROAA 3DY0A 1E03I 3F1SA 1OO8A 1ATHA 1HLEA 1JMJA 1SR5A 4DY0A 1DZGI 1BY7A 8APIA 3PB1I 2CEOA 4AJUA 1ANTI 1BR8I 2PEFA 1DZHL 1XQJA 1B3KA 1OC0A 2HIJI 4KDSA 2VDYA 3F5NA 2WXXA 2ACHA 2V95A 3CVMA 4P0FA 1UHGA 1JVQI 1KCTA 2H4RA 5EI0A 1QMNA 1C8OA 1SNGA 3NDDA 1R1LI 1T1FA 2ZNHA 3CWLA 1OVAA 2R9YA 4RSQA 2WXZA 2GD4C 1OVAC 1XU8A 3VVJA 2QUGA 2WXZC 7APIA 5IO1A 3LE2A 2B4XL 2XN6A 2XN3A 2ARQA 4X30A 1OYHL 4PYWA 4Y3KA 4DY7C 4EB1I 2RIVA 4AU2A 1EZXA 1OVAB 3CAAA 2VDXA 3PZFA 4IF8A 5HGCA 1XQGA 4G8RA 1K9OI 4AQHA 1ATTA 2WXYC 3NDFA 9APIA 1LQ8A 3DLWA 3ZHAA 4EB1L 4ZK3A 9PAIA 1YXAA 2ANTI 1LK6I 4RO9A 2ZV6A 2PEEA 1DVNA 3EVJI 5C98A 1AZXI 4DTEA 4C49A 1ATUA 2XN5A 4AU4A 2RIWA 5CDZA 3R4LA 3STOA 1JMOA 3DRMA 1IZ2A 1D5SA 2B5TI 5BRRI 2B4XI 3B9FI 1C5GA 1OYHI 2H4PA 3OZQA 1SEKA 2XN7A 1M93B 4P0OA 3T1PA 1PSIA 1NQ9I 4Y40A 1DZHI 5CDXA 1E04I 1DB2A 1QLPA 2OL2A
chains in the Genus database with same CATH superfamily
3FGQA 1OPHA 3F02A 4GA7A 3UT3A 4AFXA 1TB6I 1A7CA 2ARRA 2BEHL 2WXWA 3DRUA 4G8OA 2OAYA 1QMBA 3EOXA 1DZGL 1LJ5A 1WZ9A 4AJTA 4C41A 3CWMA 2WY0C 3NDAA 2HIJL 1DVMA 5INWA 4ZK0A 4AU3A 1E05I 3NE4A 4ROBA 2DUTA 4BB2A 3KCGI 1JTIA 4R9IA 1MTPA 1F0CA 3Q02A 1AS4A 2D26A 2WY1A 3LW2A 3H5CA 4YIAA 2HI9A 4IC0A 4CAAA 2VH4A 4AU3B 1IMVA 2BEHI 2H4QA 3Q03A 1JRRA 5CE0A 1HP7A 1JJOC 4ROAA 3DY0A 1E03I 3F1SA 1OO8A 1ATHA 1HLEA 1JMJA 1SR5A 4DY0A 1DZGI 1BY7A 8APIA 3PB1I 2CEOA 4AJUA 1ANTI 1BR8I 2PEFA 1DZHL 1XQJA 1B3KA 1OC0A 2HIJI 4KDSA 2VDYA 3F5NA 2WXXA 2ACHA 2V95A 3CVMA 4P0FA 1UHGA 1JVQI 1KCTA 2H4RA 5EI0A 1QMNA 1C8OA 1SNGA 3NDDA 1R1LI 1T1FA 2ZNHA 3CWLA 1OVAA 2R9YA 4RSQA 2WXZA 2GD4C 1OVAC 1XU8A 3VVJA 2QUGA 2WXZC 7APIA 5IO1A 3LE2A 2B4XL 2XN6A 2XN3A 2ARQA 4X30A 1OYHL 4PYWA 4Y3KA 4DY7C 4EB1I 2RIVA 4AU2A 1EZXA 1OVAB 3CAAA 2VDXA 3PZFA 4IF8A 5HGCA 1XQGA 4G8RA 1K9OI 4AQHA 1ATTA 2WXYC 3NDFA 9APIA 1LQ8A 3DLWA 3ZHAA 4EB1L 4ZK3A 9PAIA 1YXAA 2ANTI 1LK6I 4RO9A 2ZV6A 2PEEA 1DVNA 3EVJI 5C98A 1AZXI 4DTEA 4C49A 1ATUA 2XN5A 4AU4A 2RIWA 5CDZA 3R4LA 3STOA 1JMOA 3DRMA 1IZ2A 1D5SA 2B5TI 5BRRI 2B4XI 3B9FI 1C5GA 1OYHI 2H4PA 3OZQA 1SEKA 2XN7A 1M93B 4P0OA 3T1PA 1PSIA 1NQ9I 4Y40A 1DZHI 5CDXA 1E04I 1DB2A 1QLPA 2OL2A
chains in the Genus database with same CATH topology
3FGQA 1OPHA 3F02A 4GA7A 3UT3A 4AFXA 1TB6I 1A7CA 2ARRA 2BEHL 2WXWA 3DRUA 4G8OA 2OAYA 1QMBA 3EOXA 1DZGL 1LJ5A 1WZ9A 4AJTA 4C41A 3CWMA 2WY0C 3NDAA 2HIJL 1DVMA 5INWA 4ZK0A 4AU3A 1E05I 3NE4A 4ROBA 2DUTA 4BB2A 3KCGI 1JTIA 4R9IA 1MTPA 1F0CA 3Q02A 1AS4A 2D26A 2WY1A 3LW2A 3H5CA 4YIAA 2HI9A 4IC0A 4CAAA 2VH4A 4AU3B 1IMVA 2BEHI 2H4QA 3Q03A 1JRRA 5CE0A 1HP7A 1JJOC 4ROAA 3DY0A 1E03I 3F1SA 1OO8A 1ATHA 1HLEA 1JMJA 1SR5A 4DY0A 1DZGI 1BY7A 8APIA 3PB1I 2CEOA 4AJUA 1ANTI 1BR8I 2PEFA 1DZHL 1XQJA 1B3KA 1OC0A 2HIJI 4KDSA 2VDYA 3F5NA 2WXXA 2ACHA 2V95A 3CVMA 4P0FA 1UHGA 1JVQI 1KCTA 2H4RA 5EI0A 1QMNA 1C8OA 1SNGA 3NDDA 1R1LI 1T1FA 2ZNHA 3CWLA 1OVAA 2R9YA 4RSQA 2WXZA 2GD4C 1OVAC 1XU8A 3VVJA 2QUGA 2WXZC 7APIA 5IO1A 3LE2A 2B4XL 2XN6A 2XN3A 2ARQA 4X30A 1OYHL 4PYWA 4Y3KA 4DY7C 4EB1I 2RIVA 4AU2A 1EZXA 1OVAB 3CAAA 2VDXA 3PZFA 4IF8A 5HGCA 1XQGA 4G8RA 1K9OI 4AQHA 1ATTA 2WXYC 3NDFA 9APIA 1LQ8A 3DLWA 3ZHAA 4EB1L 4ZK3A 9PAIA 1YXAA 2ANTI 1LK6I 4RO9A 2ZV6A 2PEEA 1DVNA 3EVJI 5C98A 1AZXI 4DTEA 4C49A 1ATUA 2XN5A 4AU4A 2RIWA 5CDZA 3R4LA 3STOA 1JMOA 3DRMA 1IZ2A 1D5SA 2B5TI 5BRRI 2B4XI 3B9FI 1C5GA 1OYHI 2H4PA 3OZQA 1SEKA 2XN7A 1M93B 4P0OA 3T1PA 1PSIA 1NQ9I 4Y40A 1DZHI 5CDXA 1E04I 1DB2A 1QLPA 2OL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FGQ A;  1OPH A;  3F02 A;  4GA7 A;  3UT3 A;  4AFX A;  1TB6 I;  1A7C A;  2ARR A;  2BEH L;  2WXW A;  3DRU A;  4G8O A;  2OAY A;  1QMB A;  3EOX A;  1DZG L;  1LJ5 A;  1WZ9 A;  4AJT A;  4C41 A;  3CWM A;  2WY0 C;  3NDA A;  2HIJ L;  1DVM A;  5INW A;  4ZK0 A;  4AU3 A;  1E05 I;  3NE4 A;  4ROB A;  2DUT A;  4BB2 A;  3KCG I;  1JTI A;  4R9I A;  1MTP A;  1F0C A;  3Q02 A;  1AS4 A;  2D26 A;  2WY1 A;  3LW2 A;  3H5C A;  4YIA A;  2HI9 A;  4IC0 A;  4CAA A;  2VH4 A;  4AU3 B;  1IMV A;  2BEH I;  2H4Q A;  3Q03 A;  1JRR A;  5CE0 A;  1HP7 A;  1JJO C;  4ROA A;  3DY0 A;  1E03 I;  3F1S A;  1OO8 A;  1ATH A;  1HLE A;  1JMJ A;  1SR5 A;  4DY0 A;  1DZG I;  1BY7 A;  8API A;  3PB1 I;  2CEO A;  4AJU A;  1ANT I;  1BR8 I;  2PEF A;  1DZH L;  1XQJ A;  1B3K A;  1OC0 A;  2HIJ I;  4KDS A;  2VDY A;  3F5N A;  2WXX A;  2ACH A;  2V95 A;  3CVM A;  4P0F A;  1UHG A;  1JVQ I;  1KCT A;  2H4R A;  5EI0 A;  1QMN A;  1C8O A;  1SNG A;  3NDD A;  1R1L I;  1T1F A;  2ZNH A;  3CWL A;  1OVA A;  2R9Y A;  4RSQ A;  2WXZ A;  2GD4 C;  1OVA C;  1XU8 A;  3VVJ A;  2QUG A;  2WXZ C;  7API A;  5IO1 A;  3LE2 A;  2B4X L;  2XN6 A;  2XN3 A;  2ARQ A;  4X30 A;  1OYH L;  4PYW A;  4Y3K A;  4DY7 C;  4EB1 I;  2RIV A;  4AU2 A;  1EZX A;  1OVA B;  3CAA A;  2VDX A;  3PZF A;  4IF8 A;  5HGC A;  1XQG A;  4G8R A;  1K9O I;  4AQH A;  1ATT A;  2WXY C;  3NDF A;  9API A;  1LQ8 A;  3DLW A;  3ZHA A;  4EB1 L;  4ZK3 A;  9PAI A;  1YXA A;  2ANT I;  1LK6 I;  4RO9 A;  2ZV6 A;  2PEE A;  1DVN A;  3EVJ I;  5C98 A;  1AZX I;  4DTE A;  4C49 A;  1ATU A;  2XN5 A;  4AU4 A;  2RIW A;  5CDZ A;  3R4L A;  3STO A;  1JMO A;  3DRM A;  1IZ2 A;  1D5S A;  2B5T I;  5BRR I;  2B4X I;  3B9F I;  1C5G A;  1OYH I;  2H4P A;  3OZQ A;  1SEK A;  2XN7 A;  1M93 B;  4P0O A;  3T1P A;  1PSI A;  1NQ9 I;  4Y40 A;  1DZH I;  5CDX A;  1E04 I;  1DB2 A;  1QLP A;  2OL2 A; 
#chains in the Genus database with same CATH topology
 3FGQ A;  1OPH A;  3F02 A;  4GA7 A;  3UT3 A;  4AFX A;  1TB6 I;  1A7C A;  2ARR A;  2BEH L;  2WXW A;  3DRU A;  4G8O A;  2OAY A;  1QMB A;  3EOX A;  1DZG L;  1LJ5 A;  1WZ9 A;  4AJT A;  4C41 A;  3CWM A;  2WY0 C;  3NDA A;  2HIJ L;  1DVM A;  5INW A;  4ZK0 A;  4AU3 A;  1E05 I;  3NE4 A;  4ROB A;  2DUT A;  4BB2 A;  3KCG I;  1JTI A;  4R9I A;  1MTP A;  1F0C A;  3Q02 A;  1AS4 A;  2D26 A;  2WY1 A;  3LW2 A;  3H5C A;  4YIA A;  2HI9 A;  4IC0 A;  4CAA A;  2VH4 A;  4AU3 B;  1IMV A;  2BEH I;  2H4Q A;  3Q03 A;  1JRR A;  5CE0 A;  1HP7 A;  1JJO C;  4ROA A;  3DY0 A;  1E03 I;  3F1S A;  1OO8 A;  1ATH A;  1HLE A;  1JMJ A;  1SR5 A;  4DY0 A;  1DZG I;  1BY7 A;  8API A;  3PB1 I;  2CEO A;  4AJU A;  1ANT I;  1BR8 I;  2PEF A;  1DZH L;  1XQJ A;  1B3K A;  1OC0 A;  2HIJ I;  4KDS A;  2VDY A;  3F5N A;  2WXX A;  2ACH A;  2V95 A;  3CVM A;  4P0F A;  1UHG A;  1JVQ I;  1KCT A;  2H4R A;  5EI0 A;  1QMN A;  1C8O A;  1SNG A;  3NDD A;  1R1L I;  1T1F A;  2ZNH A;  3CWL A;  1OVA A;  2R9Y A;  4RSQ A;  2WXZ A;  2GD4 C;  1OVA C;  1XU8 A;  3VVJ A;  2QUG A;  2WXZ C;  7API A;  5IO1 A;  3LE2 A;  2B4X L;  2XN6 A;  2XN3 A;  2ARQ A;  4X30 A;  1OYH L;  4PYW A;  4Y3K A;  4DY7 C;  4EB1 I;  2RIV A;  4AU2 A;  1EZX A;  1OVA B;  3CAA A;  2VDX A;  3PZF A;  4IF8 A;  5HGC A;  1XQG A;  4G8R A;  1K9O I;  4AQH A;  1ATT A;  2WXY C;  3NDF A;  9API A;  1LQ8 A;  3DLW A;  3ZHA A;  4EB1 L;  4ZK3 A;  9PAI A;  1YXA A;  2ANT I;  1LK6 I;  4RO9 A;  2ZV6 A;  2PEE A;  1DVN A;  3EVJ I;  5C98 A;  1AZX I;  4DTE A;  4C49 A;  1ATU A;  2XN5 A;  4AU4 A;  2RIW A;  5CDZ A;  3R4L A;  3STO A;  1JMO A;  3DRM A;  1IZ2 A;  1D5S A;  2B5T I;  5BRR I;  2B4X I;  3B9F I;  1C5G A;  1OYH I;  2H4P A;  3OZQ A;  1SEK A;  2XN7 A;  1M93 B;  4P0O A;  3T1P A;  1PSI A;  1NQ9 I;  4Y40 A;  1DZH I;  5CDX A;  1E04 I;  1DB2 A;  1QLP A;  2OL2 A; 
#chains in the Genus database with same CATH homology
 3FGQ A;  1OPH A;  3F02 A;  4GA7 A;  3UT3 A;  4AFX A;  1TB6 I;  1A7C A;  2ARR A;  2BEH L;  2WXW A;  3DRU A;  4G8O A;  2OAY A;  1QMB A;  3EOX A;  1DZG L;  1LJ5 A;  1WZ9 A;  4AJT A;  4C41 A;  3CWM A;  2WY0 C;  3NDA A;  2HIJ L;  1DVM A;  5INW A;  4ZK0 A;  4AU3 A;  1E05 I;  3NE4 A;  4ROB A;  2DUT A;  4BB2 A;  3KCG I;  1JTI A;  4R9I A;  1MTP A;  1F0C A;  3Q02 A;  1AS4 A;  2D26 A;  2WY1 A;  3LW2 A;  3H5C A;  4YIA A;  2HI9 A;  4IC0 A;  4CAA A;  2VH4 A;  4AU3 B;  1IMV A;  2BEH I;  2H4Q A;  3Q03 A;  1JRR A;  5CE0 A;  1HP7 A;  1JJO C;  4ROA A;  3DY0 A;  1E03 I;  3F1S A;  1OO8 A;  1ATH A;  1HLE A;  1JMJ A;  1SR5 A;  4DY0 A;  1DZG I;  1BY7 A;  8API A;  3PB1 I;  2CEO A;  4AJU A;  1ANT I;  1BR8 I;  2PEF A;  1DZH L;  1XQJ A;  1B3K A;  1OC0 A;  2HIJ I;  4KDS A;  2VDY A;  3F5N A;  2WXX A;  2ACH A;  2V95 A;  3CVM A;  4P0F A;  1UHG A;  1JVQ I;  1KCT A;  2H4R A;  5EI0 A;  1QMN A;  1C8O A;  1SNG A;  3NDD A;  1R1L I;  1T1F A;  2ZNH A;  3CWL A;  1OVA A;  2R9Y A;  4RSQ A;  2WXZ A;  2GD4 C;  1OVA C;  1XU8 A;  3VVJ A;  2QUG A;  2WXZ C;  7API A;  5IO1 A;  3LE2 A;  2B4X L;  2XN6 A;  2XN3 A;  2ARQ A;  4X30 A;  1OYH L;  4PYW A;  4Y3K A;  4DY7 C;  4EB1 I;  2RIV A;  4AU2 A;  1EZX A;  1OVA B;  3CAA A;  2VDX A;  3PZF A;  4IF8 A;  5HGC A;  1XQG A;  4G8R A;  1K9O I;  4AQH A;  1ATT A;  2WXY C;  3NDF A;  9API A;  1LQ8 A;  3DLW A;  3ZHA A;  4EB1 L;  4ZK3 A;  9PAI A;  1YXA A;  2ANT I;  1LK6 I;  4RO9 A;  2ZV6 A;  2PEE A;  1DVN A;  3EVJ I;  5C98 A;  1AZX I;  4DTE A;  4C49 A;  1ATU A;  2XN5 A;  4AU4 A;  2RIW A;  5CDZ A;  3R4L A;  3STO A;  1JMO A;  3DRM A;  1IZ2 A;  1D5S A;  2B5T I;  5BRR I;  2B4X I;  3B9F I;  1C5G A;  1OYH I;  2H4P A;  3OZQ A;  1SEK A;  2XN7 A;  1M93 B;  4P0O A;  3T1P A;  1PSI A;  1NQ9 I;  4Y40 A;  1DZH I;  5CDX A;  1E04 I;  1DB2 A;  1QLP A;  2OL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...