4IF8A

Structure of vaspin
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
378
structure length
367
Chain Sequence
QGWKQRMAAKELARQNMDLGFKLLKKLAFYNPGRNIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLHEGFHYIIHELTQKTQDLKLSIGNTLFIDQRLQPQRKFLEDAKNFYSAETILTNFQNLEMAQKQINDFISQKTHGKINNLIENIDPGTVMLLANYIFFRARWKHEFDPNVTKEEDFFLEKNSSVKVPMMFRSGIYQVGYDDKLSCTILEIPYQKNITAIFILPDEGKLKHLEKGLQVDTFSRWKTLLSRRVVDVSVPRLHMTGTFDLKKTLSYIGVSKIFEEHGDLTKIAPHRSLKVGEAVHKAELKMDERGTEMETPLVVKIDKPYLLLIYSEKIPSVLFLGKIVNPIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Vaspin inhibits kallikrein 7 by serpin mechanism
pubmed doi rcsb
molecule keywords Serpin A12
molecule tags Hydrolase inhibitor
source organism Homo sapiens
total genus 121
structure length 367
sequence length 378
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00079 Serpin Serpin (serine protease inhibitor)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.39.10 Mainly Beta Roll Alpha-1-antitrypsin; domain 1 Alpha-1-antitrypsin, domain 1 4if8A02
3.30.497.10 Alpha Beta 2-Layer Sandwich Antithrombin; Chain I, domain 2 Antithrombin, subunit I, domain 2 4if8A01
1JRRA 1F0CA 1JMJA 3NDAA 1IZ2A 1T1FA 4C41A 3NDFA 2B4XL 1IMVA 2H4PA 1C8OA 3KCGI 1JVQI 3DRUA 3F02A 4P0OA 2WXYC 3ZHAA 2WY0C 1OVAB 1DZHL 2ACHA 2D26A 4ROAA 4G8RA 1ATTA 1LJ5A 2ZV6A 3NDDA 1YXAA 1R1LI 2H4QA 2R9YA 4AU3A 3EVJI 3PB1I 4Y40A 5CDZA 9APIA 7APIA 2OAYA 1QMNA 1KCTA 2B5TI 1D5SA 1ANTI 5CDXA 2B4XI 3FGQA 2ARRA 1HLEA 4KDSA 2CEOA 1QMBA 1SR5A 3CAAA 1OVAC 4R9IA 4CAAA 1DZGI 2WY1A 1C5GA 4IF8A 1DZHI 1SNGA 4DY7C 1OC0A 1OYHL 1HP7A 4RO9A 3STOA 1K9OI 1MTPA 1BR8I 1WZ9A 3VVJA 3CVMA 3OZQA 3LE2A 3DRMA 4IC0A 1SEKA 1AS4A 4AQHA 4ZK3A 3CWLA 2VDXA 1OVAA 2VDYA 1DB2A 1OPHA 4EB1L 1A7CA 2XN5A 2RIVA 3B9FI 4DY0A 1B3KA 2WXZC 4GA7A 1LK6I 3DY0A 1JJOC 2RIWA 1NQ9I 3EOXA 4AU2A 1OO8A 3F5NA 2GD4C 1OYHI 1E04I 5EI0A 4AU4A 1EZXA 5BRRI 1UHGA 2PEFA 1XU8A 5HGCA 4AJTA 1ATUA 1DVMA 1DVNA 1PSIA 3NE4A 2BEHL 2HIJL 3Q02A 4EB1I 2WXZA 1QLPA 5C98A 4YIAA 1LQ8A 5CE0A 4AFXA 4BB2A 2ANTI 3R4LA 4G8OA 4ROBA 1JTIA 2PEEA 2OL2A 3LW2A 3PZFA 2WXXA 1ATHA 1JMOA 2XN3A 9PAIA 1TB6I 3T1PA 1E03I 2WXWA 2VH4A 2XN6A 1AZXI 3Q03A 2V95A 2QUGA 4ZK0A 2DUTA 4Y3KA 4C49A 4AU3B 1DZGL 4X30A 1XQJA 3H5CA 8APIA 1BY7A 4P0FA 2BEHI 2HIJI 2XN7A 5IO1A 1M93B 4RSQA 3F1SA 1E05I 2ZNHA 3CWMA 2ARQA 5INWA 1XQGA 4PYWA 3UT3A 3DLWA 4DTEA 4AJUA 2HI9A 2H4RA
chains in the Genus database with same CATH superfamily
1JRRA 1F0CA 1JMJA 3NDAA 1IZ2A 1T1FA 4C41A 3NDFA 2B4XL 1IMVA 2H4PA 1C8OA 3KCGI 1JVQI 3DRUA 3F02A 4P0OA 2WXYC 3ZHAA 2WY0C 1OVAB 1DZHL 2ACHA 2D26A 4ROAA 4G8RA 1ATTA 1LJ5A 2ZV6A 3NDDA 1YXAA 1R1LI 2H4QA 2R9YA 4AU3A 3EVJI 3PB1I 4Y40A 5CDZA 9APIA 7APIA 2OAYA 1QMNA 1KCTA 2B5TI 1D5SA 1ANTI 5CDXA 2B4XI 3FGQA 2ARRA 1HLEA 4KDSA 2CEOA 1QMBA 1SR5A 3CAAA 1OVAC 4R9IA 4CAAA 1DZGI 2WY1A 1C5GA 4IF8A 1DZHI 1SNGA 4DY7C 1OC0A 1OYHL 1HP7A 4RO9A 3STOA 1K9OI 1MTPA 1BR8I 1WZ9A 3VVJA 3CVMA 3OZQA 3LE2A 3DRMA 4IC0A 1SEKA 1AS4A 4AQHA 4ZK3A 3CWLA 2VDXA 1OVAA 2VDYA 1DB2A 1OPHA 4EB1L 1A7CA 2XN5A 2RIVA 3B9FI 4DY0A 1B3KA 2WXZC 4GA7A 1LK6I 3DY0A 1JJOC 2RIWA 1NQ9I 3EOXA 4AU2A 1OO8A 3F5NA 2GD4C 1OYHI 1E04I 5EI0A 4AU4A 1EZXA 5BRRI 1UHGA 2PEFA 1XU8A 5HGCA 4AJTA 1ATUA 1DVMA 1DVNA 1PSIA 3NE4A 2BEHL 2HIJL 3Q02A 4EB1I 2WXZA 1QLPA 5C98A 4YIAA 1LQ8A 5CE0A 4AFXA 4BB2A 2ANTI 3R4LA 4G8OA 4ROBA 1JTIA 2PEEA 2OL2A 3LW2A 3PZFA 2WXXA 1ATHA 1JMOA 2XN3A 9PAIA 1TB6I 3T1PA 1E03I 2WXWA 2VH4A 2XN6A 1AZXI 3Q03A 2V95A 2QUGA 4ZK0A 2DUTA 4Y3KA 4C49A 4AU3B 1DZGL 4X30A 1XQJA 3H5CA 8APIA 1BY7A 4P0FA 2BEHI 2HIJI 2XN7A 5IO1A 1M93B 4RSQA 3F1SA 1E05I 2ZNHA 3CWMA 2ARQA 5INWA 1XQGA 4PYWA 3UT3A 3DLWA 4DTEA 4AJUA 2HI9A 2H4RA
chains in the Genus database with same CATH topology
1JRRA 1F0CA 1JMJA 3NDAA 1IZ2A 1T1FA 4C41A 3NDFA 2B4XL 1IMVA 2H4PA 1C8OA 3KCGI 1JVQI 3DRUA 3F02A 4P0OA 2WXYC 3ZHAA 2WY0C 1OVAB 1DZHL 2ACHA 2D26A 4ROAA 4G8RA 1ATTA 1LJ5A 2ZV6A 3NDDA 1YXAA 1R1LI 2H4QA 2R9YA 4AU3A 3EVJI 3PB1I 4Y40A 5CDZA 9APIA 7APIA 2OAYA 1QMNA 1KCTA 2B5TI 1D5SA 1ANTI 5CDXA 2B4XI 3FGQA 2ARRA 1HLEA 4KDSA 2CEOA 1QMBA 1SR5A 3CAAA 1OVAC 4R9IA 4CAAA 1DZGI 2WY1A 1C5GA 4IF8A 1DZHI 1SNGA 4DY7C 1OC0A 1OYHL 1HP7A 4RO9A 3STOA 1K9OI 1MTPA 1BR8I 1WZ9A 3VVJA 3CVMA 3OZQA 3LE2A 3DRMA 4IC0A 1SEKA 1AS4A 4AQHA 4ZK3A 3CWLA 2VDXA 1OVAA 2VDYA 1DB2A 1OPHA 4EB1L 1A7CA 2XN5A 2RIVA 3B9FI 4DY0A 1B3KA 2WXZC 4GA7A 1LK6I 3DY0A 1JJOC 2RIWA 1NQ9I 3EOXA 4AU2A 1OO8A 3F5NA 2GD4C 1OYHI 1E04I 5EI0A 4AU4A 1EZXA 5BRRI 1UHGA 2PEFA 1XU8A 5HGCA 4AJTA 1ATUA 1DVMA 1DVNA 1PSIA 3NE4A 2BEHL 2HIJL 3Q02A 4EB1I 2WXZA 1QLPA 5C98A 4YIAA 1LQ8A 5CE0A 4AFXA 4BB2A 2ANTI 3R4LA 4G8OA 4ROBA 1JTIA 2PEEA 2OL2A 3LW2A 3PZFA 2WXXA 1ATHA 1JMOA 2XN3A 9PAIA 1TB6I 3T1PA 1E03I 2WXWA 2VH4A 2XN6A 1AZXI 3Q03A 2V95A 2QUGA 4ZK0A 2DUTA 4Y3KA 4C49A 4AU3B 1DZGL 4X30A 1XQJA 3H5CA 8APIA 1BY7A 4P0FA 2BEHI 2HIJI 2XN7A 5IO1A 1M93B 4RSQA 3F1SA 1E05I 2ZNHA 3CWMA 2ARQA 5INWA 1XQGA 4PYWA 3UT3A 3DLWA 4DTEA 4AJUA 2HI9A 2H4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JRR A;  1F0C A;  1JMJ A;  3NDA A;  1IZ2 A;  1T1F A;  4C41 A;  3NDF A;  2B4X L;  1IMV A;  2H4P A;  1C8O A;  3KCG I;  1JVQ I;  3DRU A;  3F02 A;  4P0O A;  2WXY C;  3ZHA A;  2WY0 C;  1OVA B;  1DZH L;  2ACH A;  2D26 A;  4ROA A;  4G8R A;  1ATT A;  1LJ5 A;  2ZV6 A;  3NDD A;  1YXA A;  1R1L I;  2H4Q A;  2R9Y A;  4AU3 A;  3EVJ I;  3PB1 I;  4Y40 A;  5CDZ A;  9API A;  7API A;  2OAY A;  1QMN A;  1KCT A;  2B5T I;  1D5S A;  1ANT I;  5CDX A;  2B4X I;  3FGQ A;  2ARR A;  1HLE A;  4KDS A;  2CEO A;  1QMB A;  1SR5 A;  3CAA A;  1OVA C;  4R9I A;  4CAA A;  1DZG I;  2WY1 A;  1C5G A;  4IF8 A;  1DZH I;  1SNG A;  4DY7 C;  1OC0 A;  1OYH L;  1HP7 A;  4RO9 A;  3STO A;  1K9O I;  1MTP A;  1BR8 I;  1WZ9 A;  3VVJ A;  3CVM A;  3OZQ A;  3LE2 A;  3DRM A;  4IC0 A;  1SEK A;  1AS4 A;  4AQH A;  4ZK3 A;  3CWL A;  2VDX A;  1OVA A;  2VDY A;  1DB2 A;  1OPH A;  4EB1 L;  1A7C A;  2XN5 A;  2RIV A;  3B9F I;  4DY0 A;  1B3K A;  2WXZ C;  4GA7 A;  1LK6 I;  3DY0 A;  1JJO C;  2RIW A;  1NQ9 I;  3EOX A;  4AU2 A;  1OO8 A;  3F5N A;  2GD4 C;  1OYH I;  1E04 I;  5EI0 A;  4AU4 A;  1EZX A;  5BRR I;  1UHG A;  2PEF A;  1XU8 A;  5HGC A;  4AJT A;  1ATU A;  1DVM A;  1DVN A;  1PSI A;  3NE4 A;  2BEH L;  2HIJ L;  3Q02 A;  4EB1 I;  2WXZ A;  1QLP A;  5C98 A;  4YIA A;  1LQ8 A;  5CE0 A;  4AFX A;  4BB2 A;  2ANT I;  3R4L A;  4G8O A;  4ROB A;  1JTI A;  2PEE A;  2OL2 A;  3LW2 A;  3PZF A;  2WXX A;  1ATH A;  1JMO A;  2XN3 A;  9PAI A;  1TB6 I;  3T1P A;  1E03 I;  2WXW A;  2VH4 A;  2XN6 A;  1AZX I;  3Q03 A;  2V95 A;  2QUG A;  4ZK0 A;  2DUT A;  4Y3K A;  4C49 A;  4AU3 B;  1DZG L;  4X30 A;  1XQJ A;  3H5C A;  8API A;  1BY7 A;  4P0F A;  2BEH I;  2HIJ I;  2XN7 A;  5IO1 A;  1M93 B;  4RSQ A;  3F1S A;  1E05 I;  2ZNH A;  3CWM A;  2ARQ A;  5INW A;  1XQG A;  4PYW A;  3UT3 A;  3DLW A;  4DTE A;  4AJU A;  2HI9 A;  2H4R A; 
#chains in the Genus database with same CATH topology
 1JRR A;  1F0C A;  1JMJ A;  3NDA A;  1IZ2 A;  1T1F A;  4C41 A;  3NDF A;  2B4X L;  1IMV A;  2H4P A;  1C8O A;  3KCG I;  1JVQ I;  3DRU A;  3F02 A;  4P0O A;  2WXY C;  3ZHA A;  2WY0 C;  1OVA B;  1DZH L;  2ACH A;  2D26 A;  4ROA A;  4G8R A;  1ATT A;  1LJ5 A;  2ZV6 A;  3NDD A;  1YXA A;  1R1L I;  2H4Q A;  2R9Y A;  4AU3 A;  3EVJ I;  3PB1 I;  4Y40 A;  5CDZ A;  9API A;  7API A;  2OAY A;  1QMN A;  1KCT A;  2B5T I;  1D5S A;  1ANT I;  5CDX A;  2B4X I;  3FGQ A;  2ARR A;  1HLE A;  4KDS A;  2CEO A;  1QMB A;  1SR5 A;  3CAA A;  1OVA C;  4R9I A;  4CAA A;  1DZG I;  2WY1 A;  1C5G A;  4IF8 A;  1DZH I;  1SNG A;  4DY7 C;  1OC0 A;  1OYH L;  1HP7 A;  4RO9 A;  3STO A;  1K9O I;  1MTP A;  1BR8 I;  1WZ9 A;  3VVJ A;  3CVM A;  3OZQ A;  3LE2 A;  3DRM A;  4IC0 A;  1SEK A;  1AS4 A;  4AQH A;  4ZK3 A;  3CWL A;  2VDX A;  1OVA A;  2VDY A;  1DB2 A;  1OPH A;  4EB1 L;  1A7C A;  2XN5 A;  2RIV A;  3B9F I;  4DY0 A;  1B3K A;  2WXZ C;  4GA7 A;  1LK6 I;  3DY0 A;  1JJO C;  2RIW A;  1NQ9 I;  3EOX A;  4AU2 A;  1OO8 A;  3F5N A;  2GD4 C;  1OYH I;  1E04 I;  5EI0 A;  4AU4 A;  1EZX A;  5BRR I;  1UHG A;  2PEF A;  1XU8 A;  5HGC A;  4AJT A;  1ATU A;  1DVM A;  1DVN A;  1PSI A;  3NE4 A;  2BEH L;  2HIJ L;  3Q02 A;  4EB1 I;  2WXZ A;  1QLP A;  5C98 A;  4YIA A;  1LQ8 A;  5CE0 A;  4AFX A;  4BB2 A;  2ANT I;  3R4L A;  4G8O A;  4ROB A;  1JTI A;  2PEE A;  2OL2 A;  3LW2 A;  3PZF A;  2WXX A;  1ATH A;  1JMO A;  2XN3 A;  9PAI A;  1TB6 I;  3T1P A;  1E03 I;  2WXW A;  2VH4 A;  2XN6 A;  1AZX I;  3Q03 A;  2V95 A;  2QUG A;  4ZK0 A;  2DUT A;  4Y3K A;  4C49 A;  4AU3 B;  1DZG L;  4X30 A;  1XQJ A;  3H5C A;  8API A;  1BY7 A;  4P0F A;  2BEH I;  2HIJ I;  2XN7 A;  5IO1 A;  1M93 B;  4RSQ A;  3F1S A;  1E05 I;  2ZNH A;  3CWM A;  2ARQ A;  5INW A;  1XQG A;  4PYW A;  3UT3 A;  3DLW A;  4DTE A;  4AJU A;  2HI9 A;  2H4R A; 
#chains in the Genus database with same CATH homology
 1JRR A;  1F0C A;  1JMJ A;  3NDA A;  1IZ2 A;  1T1F A;  4C41 A;  3NDF A;  2B4X L;  1IMV A;  2H4P A;  1C8O A;  3KCG I;  1JVQ I;  3DRU A;  3F02 A;  4P0O A;  2WXY C;  3ZHA A;  2WY0 C;  1OVA B;  1DZH L;  2ACH A;  2D26 A;  4ROA A;  4G8R A;  1ATT A;  1LJ5 A;  2ZV6 A;  3NDD A;  1YXA A;  1R1L I;  2H4Q A;  2R9Y A;  4AU3 A;  3EVJ I;  3PB1 I;  4Y40 A;  5CDZ A;  9API A;  7API A;  2OAY A;  1QMN A;  1KCT A;  2B5T I;  1D5S A;  1ANT I;  5CDX A;  2B4X I;  3FGQ A;  2ARR A;  1HLE A;  4KDS A;  2CEO A;  1QMB A;  1SR5 A;  3CAA A;  1OVA C;  4R9I A;  4CAA A;  1DZG I;  2WY1 A;  1C5G A;  4IF8 A;  1DZH I;  1SNG A;  4DY7 C;  1OC0 A;  1OYH L;  1HP7 A;  4RO9 A;  3STO A;  1K9O I;  1MTP A;  1BR8 I;  1WZ9 A;  3VVJ A;  3CVM A;  3OZQ A;  3LE2 A;  3DRM A;  4IC0 A;  1SEK A;  1AS4 A;  4AQH A;  4ZK3 A;  3CWL A;  2VDX A;  1OVA A;  2VDY A;  1DB2 A;  1OPH A;  4EB1 L;  1A7C A;  2XN5 A;  2RIV A;  3B9F I;  4DY0 A;  1B3K A;  2WXZ C;  4GA7 A;  1LK6 I;  3DY0 A;  1JJO C;  2RIW A;  1NQ9 I;  3EOX A;  4AU2 A;  1OO8 A;  3F5N A;  2GD4 C;  1OYH I;  1E04 I;  5EI0 A;  4AU4 A;  1EZX A;  5BRR I;  1UHG A;  2PEF A;  1XU8 A;  5HGC A;  4AJT A;  1ATU A;  1DVM A;  1DVN A;  1PSI A;  3NE4 A;  2BEH L;  2HIJ L;  3Q02 A;  4EB1 I;  2WXZ A;  1QLP A;  5C98 A;  4YIA A;  1LQ8 A;  5CE0 A;  4AFX A;  4BB2 A;  2ANT I;  3R4L A;  4G8O A;  4ROB A;  1JTI A;  2PEE A;  2OL2 A;  3LW2 A;  3PZF A;  2WXX A;  1ATH A;  1JMO A;  2XN3 A;  9PAI A;  1TB6 I;  3T1P A;  1E03 I;  2WXW A;  2VH4 A;  2XN6 A;  1AZX I;  3Q03 A;  2V95 A;  2QUG A;  4ZK0 A;  2DUT A;  4Y3K A;  4C49 A;  4AU3 B;  1DZG L;  4X30 A;  1XQJ A;  3H5C A;  8API A;  1BY7 A;  4P0F A;  2BEH I;  2HIJ I;  2XN7 A;  5IO1 A;  1M93 B;  4RSQ A;  3F1S A;  1E05 I;  2ZNH A;  3CWM A;  2ARQ A;  5INW A;  1XQG A;  4PYW A;  3UT3 A;  3DLW A;  4DTE A;  4AJU A;  2HI9 A;  2H4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...