9APIA

The s variant of human alpha1-antitrypsin, structure and implications for function and metabolism
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
339
structure length
339
Chain Sequence
HPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The S variant of human alpha 1-antitrypsin, structure and implications for function and metabolism.
pubmed doi rcsb
molecule keywords ALPHA 1-ANTITRYPSIN
molecule tags Proteinase inhibitor
total genus 88
structure length 339
sequence length 339
ec nomenclature
pdb deposition date 1988-09-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.39.10 Mainly Beta Roll Alpha-1-antitrypsin; domain 1 Alpha-1-antitrypsin, domain 1 9apiA01
3.30.497.10 Alpha Beta 2-Layer Sandwich Antithrombin; Chain I, domain 2 Antithrombin, subunit I, domain 2 9apiA02
1NQ9I 2OL2A 4KDSA 2ZNHA 4AJUA 4RO9A 2XN7A 1OYHI 4GA7A 4R9IA 2XN5A 3ZHAA 1HLEA 3R4LA 2ANTI 2H4PA 3H5CA 4G8OA 4Y40A 9APIA 3NDAA 4P0FA 3CVMA 2HI9A 3F5NA 4DTEA 3T1PA 1DVNA 4AU3B 4AU4A 1OVAA 1IZ2A 1XQGA 3DRMA 1DVMA 1TB6I 4AQHA 1ATUA 3KCGI 4DY7C 2ARQA 3Q02A 1QLPA 2RIWA 1E03I 2H4QA 2HIJI 1OPHA 3DRUA 3EOXA 3F1SA 2B5TI 3CWLA 2QUGA 3STOA 2B4XI 3LE2A 3LW2A 5IO1A 2WXZC 1C5GA 3PB1I 1AS4A 4IF8A 2PEEA 4PYWA 3OZQA 2WY1A 2VDYA 1HP7A 1YXAA 3PZFA 1SNGA 5HGCA 5CDXA 2V95A 3CWMA 2WXXA 2PEFA 1ATTA 2HIJL 2H4RA 3NDDA 2VH4A 5BRRI 2B4XL 1JRRA 2XN6A 3NE4A 9PAIA 3DY0A 1LK6I 2BEHL 1EZXA 1JMJA 4AU2A 5INWA 4YIAA 1JMOA 1OVAC 2CEOA 4P0OA 4G8RA 4C49A 1XU8A 1D5SA 3DLWA 2OAYA 3F02A 1BR8I 2BEHI 4IC0A 3VVJA 1B3KA 1DB2A 1PSIA 1E04I 8APIA 1F0CA 4Y3KA 4AFXA 1WZ9A 4ZK0A 5EI0A 5CE0A 4BB2A 3CAAA 2WXWA 1BY7A 1ANTI 1OVAB 1IMVA 2ACHA 2VDXA 3UT3A 2XN3A 4RSQA 4AU3A 4ZK3A 1DZGI 1JTIA 3NDFA 1SR5A 4X30A 5C98A 1JJOC 2ARRA 5CDZA 2WY0C 1LQ8A 1OC0A 4AJTA 1ATHA 1LJ5A 1UHGA 3Q03A 4EB1L 2ZV6A 1M93B 1KCTA 1T1FA 7APIA 2WXYC 1QMBA 1DZHL 2DUTA 4DY0A 3FGQA 1C8OA 1K9OI 1DZGL 4EB1I 1A7CA 1SEKA 1XQJA 1DZHI 1E05I 1MTPA 1OO8A 4C41A 1QMNA 2R9YA 1OYHL 2WXZA 3EVJI 4ROBA 1R1LI 2RIVA 1JVQI 4CAAA 2D26A 1AZXI 3B9FI 2GD4C 4ROAA
chains in the Genus database with same CATH superfamily
1NQ9I 2OL2A 4KDSA 2ZNHA 4AJUA 4RO9A 2XN7A 1OYHI 4GA7A 4R9IA 2XN5A 3ZHAA 1HLEA 3R4LA 2ANTI 2H4PA 3H5CA 4G8OA 4Y40A 9APIA 3NDAA 4P0FA 3CVMA 2HI9A 3F5NA 4DTEA 3T1PA 1DVNA 4AU3B 4AU4A 1OVAA 1IZ2A 1XQGA 3DRMA 1DVMA 1TB6I 4AQHA 1ATUA 3KCGI 4DY7C 2ARQA 3Q02A 1QLPA 2RIWA 1E03I 2H4QA 2HIJI 1OPHA 3DRUA 3EOXA 3F1SA 2B5TI 3CWLA 2QUGA 3STOA 2B4XI 3LE2A 3LW2A 5IO1A 2WXZC 1C5GA 3PB1I 1AS4A 4IF8A 2PEEA 4PYWA 3OZQA 2WY1A 2VDYA 1HP7A 1YXAA 3PZFA 1SNGA 5HGCA 5CDXA 2V95A 3CWMA 2WXXA 2PEFA 1ATTA 2HIJL 2H4RA 3NDDA 2VH4A 5BRRI 2B4XL 1JRRA 2XN6A 3NE4A 9PAIA 3DY0A 1LK6I 2BEHL 1EZXA 1JMJA 4AU2A 5INWA 4YIAA 1JMOA 1OVAC 2CEOA 4P0OA 4G8RA 4C49A 1XU8A 1D5SA 3DLWA 2OAYA 3F02A 1BR8I 2BEHI 4IC0A 3VVJA 1B3KA 1DB2A 1PSIA 1E04I 8APIA 1F0CA 4Y3KA 4AFXA 1WZ9A 4ZK0A 5EI0A 5CE0A 4BB2A 3CAAA 2WXWA 1BY7A 1ANTI 1OVAB 1IMVA 2ACHA 2VDXA 3UT3A 2XN3A 4RSQA 4AU3A 4ZK3A 1DZGI 1JTIA 3NDFA 1SR5A 4X30A 5C98A 1JJOC 2ARRA 5CDZA 2WY0C 1LQ8A 1OC0A 4AJTA 1ATHA 1LJ5A 1UHGA 3Q03A 4EB1L 2ZV6A 1M93B 1KCTA 1T1FA 7APIA 2WXYC 1QMBA 1DZHL 2DUTA 4DY0A 3FGQA 1C8OA 1K9OI 1DZGL 4EB1I 1A7CA 1SEKA 1XQJA 1DZHI 1E05I 1MTPA 1OO8A 4C41A 1QMNA 2R9YA 1OYHL 2WXZA 3EVJI 4ROBA 1R1LI 2RIVA 1JVQI 4CAAA 2D26A 1AZXI 3B9FI 2GD4C 4ROAA
chains in the Genus database with same CATH topology
1NQ9I 2OL2A 4KDSA 2ZNHA 4AJUA 4RO9A 2XN7A 1OYHI 4GA7A 4R9IA 2XN5A 3ZHAA 1HLEA 3R4LA 2ANTI 2H4PA 3H5CA 4G8OA 4Y40A 9APIA 3NDAA 4P0FA 3CVMA 2HI9A 3F5NA 4DTEA 3T1PA 1DVNA 4AU3B 4AU4A 1OVAA 1IZ2A 1XQGA 3DRMA 1DVMA 1TB6I 4AQHA 1ATUA 3KCGI 4DY7C 2ARQA 3Q02A 1QLPA 2RIWA 1E03I 2H4QA 2HIJI 1OPHA 3DRUA 3EOXA 3F1SA 2B5TI 3CWLA 2QUGA 3STOA 2B4XI 3LE2A 3LW2A 5IO1A 2WXZC 1C5GA 3PB1I 1AS4A 4IF8A 2PEEA 4PYWA 3OZQA 2WY1A 2VDYA 1HP7A 1YXAA 3PZFA 1SNGA 5HGCA 5CDXA 2V95A 3CWMA 2WXXA 2PEFA 1ATTA 2HIJL 2H4RA 3NDDA 2VH4A 5BRRI 2B4XL 1JRRA 2XN6A 3NE4A 9PAIA 3DY0A 1LK6I 2BEHL 1EZXA 1JMJA 4AU2A 5INWA 4YIAA 1JMOA 1OVAC 2CEOA 4P0OA 4G8RA 4C49A 1XU8A 1D5SA 3DLWA 2OAYA 3F02A 1BR8I 2BEHI 4IC0A 3VVJA 1B3KA 1DB2A 1PSIA 1E04I 8APIA 1F0CA 4Y3KA 4AFXA 1WZ9A 4ZK0A 5EI0A 5CE0A 4BB2A 3CAAA 2WXWA 1BY7A 1ANTI 1OVAB 1IMVA 2ACHA 2VDXA 3UT3A 2XN3A 4RSQA 4AU3A 4ZK3A 1DZGI 1JTIA 3NDFA 1SR5A 4X30A 5C98A 1JJOC 2ARRA 5CDZA 2WY0C 1LQ8A 1OC0A 4AJTA 1ATHA 1LJ5A 1UHGA 3Q03A 4EB1L 2ZV6A 1M93B 1KCTA 1T1FA 7APIA 2WXYC 1QMBA 1DZHL 2DUTA 4DY0A 3FGQA 1C8OA 1K9OI 1DZGL 4EB1I 1A7CA 1SEKA 1XQJA 1DZHI 1E05I 1MTPA 1OO8A 4C41A 1QMNA 2R9YA 1OYHL 2WXZA 3EVJI 4ROBA 1R1LI 2RIVA 1JVQI 4CAAA 2D26A 1AZXI 3B9FI 2GD4C 4ROAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NQ9 I;  2OL2 A;  4KDS A;  2ZNH A;  4AJU A;  4RO9 A;  2XN7 A;  1OYH I;  4GA7 A;  4R9I A;  2XN5 A;  3ZHA A;  1HLE A;  3R4L A;  2ANT I;  2H4P A;  3H5C A;  4G8O A;  4Y40 A;  9API A;  3NDA A;  4P0F A;  3CVM A;  2HI9 A;  3F5N A;  4DTE A;  3T1P A;  1DVN A;  4AU3 B;  4AU4 A;  1OVA A;  1IZ2 A;  1XQG A;  3DRM A;  1DVM A;  1TB6 I;  4AQH A;  1ATU A;  3KCG I;  4DY7 C;  2ARQ A;  3Q02 A;  1QLP A;  2RIW A;  1E03 I;  2H4Q A;  2HIJ I;  1OPH A;  3DRU A;  3EOX A;  3F1S A;  2B5T I;  3CWL A;  2QUG A;  3STO A;  2B4X I;  3LE2 A;  3LW2 A;  5IO1 A;  2WXZ C;  1C5G A;  3PB1 I;  1AS4 A;  4IF8 A;  2PEE A;  4PYW A;  3OZQ A;  2WY1 A;  2VDY A;  1HP7 A;  1YXA A;  3PZF A;  1SNG A;  5HGC A;  5CDX A;  2V95 A;  3CWM A;  2WXX A;  2PEF A;  1ATT A;  2HIJ L;  2H4R A;  3NDD A;  2VH4 A;  5BRR I;  2B4X L;  1JRR A;  2XN6 A;  3NE4 A;  9PAI A;  3DY0 A;  1LK6 I;  2BEH L;  1EZX A;  1JMJ A;  4AU2 A;  5INW A;  4YIA A;  1JMO A;  1OVA C;  2CEO A;  4P0O A;  4G8R A;  4C49 A;  1XU8 A;  1D5S A;  3DLW A;  2OAY A;  3F02 A;  1BR8 I;  2BEH I;  4IC0 A;  3VVJ A;  1B3K A;  1DB2 A;  1PSI A;  1E04 I;  8API A;  1F0C A;  4Y3K A;  4AFX A;  1WZ9 A;  4ZK0 A;  5EI0 A;  5CE0 A;  4BB2 A;  3CAA A;  2WXW A;  1BY7 A;  1ANT I;  1OVA B;  1IMV A;  2ACH A;  2VDX A;  3UT3 A;  2XN3 A;  4RSQ A;  4AU3 A;  4ZK3 A;  1DZG I;  1JTI A;  3NDF A;  1SR5 A;  4X30 A;  5C98 A;  1JJO C;  2ARR A;  5CDZ A;  2WY0 C;  1LQ8 A;  1OC0 A;  4AJT A;  1ATH A;  1LJ5 A;  1UHG A;  3Q03 A;  4EB1 L;  2ZV6 A;  1M93 B;  1KCT A;  1T1F A;  7API A;  2WXY C;  1QMB A;  1DZH L;  2DUT A;  4DY0 A;  3FGQ A;  1C8O A;  1K9O I;  1DZG L;  4EB1 I;  1A7C A;  1SEK A;  1XQJ A;  1DZH I;  1E05 I;  1MTP A;  1OO8 A;  4C41 A;  1QMN A;  2R9Y A;  1OYH L;  2WXZ A;  3EVJ I;  4ROB A;  1R1L I;  2RIV A;  1JVQ I;  4CAA A;  2D26 A;  1AZX I;  3B9F I;  2GD4 C;  4ROA A; 
#chains in the Genus database with same CATH topology
 1NQ9 I;  2OL2 A;  4KDS A;  2ZNH A;  4AJU A;  4RO9 A;  2XN7 A;  1OYH I;  4GA7 A;  4R9I A;  2XN5 A;  3ZHA A;  1HLE A;  3R4L A;  2ANT I;  2H4P A;  3H5C A;  4G8O A;  4Y40 A;  9API A;  3NDA A;  4P0F A;  3CVM A;  2HI9 A;  3F5N A;  4DTE A;  3T1P A;  1DVN A;  4AU3 B;  4AU4 A;  1OVA A;  1IZ2 A;  1XQG A;  3DRM A;  1DVM A;  1TB6 I;  4AQH A;  1ATU A;  3KCG I;  4DY7 C;  2ARQ A;  3Q02 A;  1QLP A;  2RIW A;  1E03 I;  2H4Q A;  2HIJ I;  1OPH A;  3DRU A;  3EOX A;  3F1S A;  2B5T I;  3CWL A;  2QUG A;  3STO A;  2B4X I;  3LE2 A;  3LW2 A;  5IO1 A;  2WXZ C;  1C5G A;  3PB1 I;  1AS4 A;  4IF8 A;  2PEE A;  4PYW A;  3OZQ A;  2WY1 A;  2VDY A;  1HP7 A;  1YXA A;  3PZF A;  1SNG A;  5HGC A;  5CDX A;  2V95 A;  3CWM A;  2WXX A;  2PEF A;  1ATT A;  2HIJ L;  2H4R A;  3NDD A;  2VH4 A;  5BRR I;  2B4X L;  1JRR A;  2XN6 A;  3NE4 A;  9PAI A;  3DY0 A;  1LK6 I;  2BEH L;  1EZX A;  1JMJ A;  4AU2 A;  5INW A;  4YIA A;  1JMO A;  1OVA C;  2CEO A;  4P0O A;  4G8R A;  4C49 A;  1XU8 A;  1D5S A;  3DLW A;  2OAY A;  3F02 A;  1BR8 I;  2BEH I;  4IC0 A;  3VVJ A;  1B3K A;  1DB2 A;  1PSI A;  1E04 I;  8API A;  1F0C A;  4Y3K A;  4AFX A;  1WZ9 A;  4ZK0 A;  5EI0 A;  5CE0 A;  4BB2 A;  3CAA A;  2WXW A;  1BY7 A;  1ANT I;  1OVA B;  1IMV A;  2ACH A;  2VDX A;  3UT3 A;  2XN3 A;  4RSQ A;  4AU3 A;  4ZK3 A;  1DZG I;  1JTI A;  3NDF A;  1SR5 A;  4X30 A;  5C98 A;  1JJO C;  2ARR A;  5CDZ A;  2WY0 C;  1LQ8 A;  1OC0 A;  4AJT A;  1ATH A;  1LJ5 A;  1UHG A;  3Q03 A;  4EB1 L;  2ZV6 A;  1M93 B;  1KCT A;  1T1F A;  7API A;  2WXY C;  1QMB A;  1DZH L;  2DUT A;  4DY0 A;  3FGQ A;  1C8O A;  1K9O I;  1DZG L;  4EB1 I;  1A7C A;  1SEK A;  1XQJ A;  1DZH I;  1E05 I;  1MTP A;  1OO8 A;  4C41 A;  1QMN A;  2R9Y A;  1OYH L;  2WXZ A;  3EVJ I;  4ROB A;  1R1L I;  2RIV A;  1JVQ I;  4CAA A;  2D26 A;  1AZX I;  3B9F I;  2GD4 C;  4ROA A; 
#chains in the Genus database with same CATH homology
 1NQ9 I;  2OL2 A;  4KDS A;  2ZNH A;  4AJU A;  4RO9 A;  2XN7 A;  1OYH I;  4GA7 A;  4R9I A;  2XN5 A;  3ZHA A;  1HLE A;  3R4L A;  2ANT I;  2H4P A;  3H5C A;  4G8O A;  4Y40 A;  9API A;  3NDA A;  4P0F A;  3CVM A;  2HI9 A;  3F5N A;  4DTE A;  3T1P A;  1DVN A;  4AU3 B;  4AU4 A;  1OVA A;  1IZ2 A;  1XQG A;  3DRM A;  1DVM A;  1TB6 I;  4AQH A;  1ATU A;  3KCG I;  4DY7 C;  2ARQ A;  3Q02 A;  1QLP A;  2RIW A;  1E03 I;  2H4Q A;  2HIJ I;  1OPH A;  3DRU A;  3EOX A;  3F1S A;  2B5T I;  3CWL A;  2QUG A;  3STO A;  2B4X I;  3LE2 A;  3LW2 A;  5IO1 A;  2WXZ C;  1C5G A;  3PB1 I;  1AS4 A;  4IF8 A;  2PEE A;  4PYW A;  3OZQ A;  2WY1 A;  2VDY A;  1HP7 A;  1YXA A;  3PZF A;  1SNG A;  5HGC A;  5CDX A;  2V95 A;  3CWM A;  2WXX A;  2PEF A;  1ATT A;  2HIJ L;  2H4R A;  3NDD A;  2VH4 A;  5BRR I;  2B4X L;  1JRR A;  2XN6 A;  3NE4 A;  9PAI A;  3DY0 A;  1LK6 I;  2BEH L;  1EZX A;  1JMJ A;  4AU2 A;  5INW A;  4YIA A;  1JMO A;  1OVA C;  2CEO A;  4P0O A;  4G8R A;  4C49 A;  1XU8 A;  1D5S A;  3DLW A;  2OAY A;  3F02 A;  1BR8 I;  2BEH I;  4IC0 A;  3VVJ A;  1B3K A;  1DB2 A;  1PSI A;  1E04 I;  8API A;  1F0C A;  4Y3K A;  4AFX A;  1WZ9 A;  4ZK0 A;  5EI0 A;  5CE0 A;  4BB2 A;  3CAA A;  2WXW A;  1BY7 A;  1ANT I;  1OVA B;  1IMV A;  2ACH A;  2VDX A;  3UT3 A;  2XN3 A;  4RSQ A;  4AU3 A;  4ZK3 A;  1DZG I;  1JTI A;  3NDF A;  1SR5 A;  4X30 A;  5C98 A;  1JJO C;  2ARR A;  5CDZ A;  2WY0 C;  1LQ8 A;  1OC0 A;  4AJT A;  1ATH A;  1LJ5 A;  1UHG A;  3Q03 A;  4EB1 L;  2ZV6 A;  1M93 B;  1KCT A;  1T1F A;  7API A;  2WXY C;  1QMB A;  1DZH L;  2DUT A;  4DY0 A;  3FGQ A;  1C8O A;  1K9O I;  1DZG L;  4EB1 I;  1A7C A;  1SEK A;  1XQJ A;  1DZH I;  1E05 I;  1MTP A;  1OO8 A;  4C41 A;  1QMN A;  2R9Y A;  1OYH L;  2WXZ A;  3EVJ I;  4ROB A;  1R1L I;  2RIV A;  1JVQ I;  4CAA A;  2D26 A;  1AZX I;  3B9F I;  2GD4 C;  4ROA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...