4AFXA

Crystal structure of the reactive loop cleaved zpi in i2 space group
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
347
structure length
347
Chain Sequence
SEEEKAWLMASRQQLAKETSNFGFSLLRKISMRHDGNMVFSPFGMSLAMTGLMLGATGPTETQIKRGLHLQALKPTKPGLLPSLFKGLRETLSRNLELGLTQGSFAFIHKDFDVKETFFNLSKRYFDTECVPMNFRNASQAKRLMNHYINKETRGKIPKLFDEINPETKLILVDYILFKGKWLTPFDPVFTEVDTFHLDKYKTIKVPMMYGAGKFASTFDKNFRCHVLKLPYQGNATMLVVLMEKMGDHLALEDYLTTDLVETWLRNMKTRNMEVFFPKFKLDQKYEMHELLRQMGIRRIFSPFADLSELSATGRNLQVSRVLQRTVIEVDERGTEAVAGILSEITA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Catalytic Activation of Protein Z-Dependent Protease Inhibitor (Zpi) by Protein Z.
pubmed doi rcsb
molecule keywords PROTEIN Z DEPENDENT PROTEASE INHIBITOR
molecule tags Hydrolase inhibitor
source organism Homo sapiens
total genus 93
structure length 347
sequence length 347
ec nomenclature
pdb deposition date 2012-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.39.10 Mainly Beta Roll Alpha-1-antitrypsin; domain 1 Alpha-1-antitrypsin, domain 1 4afxA02
3.30.497.10 Alpha Beta 2-Layer Sandwich Antithrombin; Chain I, domain 2 Antithrombin, subunit I, domain 2 4afxA01
1A7CA 2PEFA 9PAIA 1OYHI 2WY0C 2ANTI 1OYHL 2HIJI 2B4XL 5INWA 4AU3B 4RSQA 1DZGL 3F5NA 3ZHAA 1JMJA 1IZ2A 1DB2A 2QUGA 4PYWA 1OVAB 1SEKA 4C49A 1ATHA 4AJTA 1ANTI 2R9YA 1QLPA 1JRRA 2BEHI 2WY1A 3Q03A 2BEHL 2XN7A 4AQHA 2H4PA 3UT3A 2GD4C 4CAAA 1C5GA 1E03I 1E04I 4Y3KA 1SR5A 1QMBA 1EZXA 1AS4A 5CE0A 1MTPA 4X30A 4DY7C 3OZQA 3FGQA 2VH4A 1E05I 2DUTA 2WXXA 2HIJL 3KCGI 4IC0A 2ZV6A 4R9IA 5C98A 5HGCA 1HP7A 4G8OA 3PB1I 1AZXI 1DZHI 4AU4A 3EVJI 1DZHL 1JVQI 4GA7A 3DLWA 2XN5A 1BY7A 1JMOA 1BR8I 1OVAC 2XN6A 3Q02A 4ROBA 3DRUA 4AU2A 1T1FA 3PZFA 1IMVA 2VDXA 1OPHA 1NQ9I 2XN3A 1LQ8A 1XQJA 2D26A 2ZNHA 3T1PA 3H5CA 3NDFA 9APIA 1DVMA 1D5SA 2OL2A 2ARRA 4P0OA 2WXWA 2H4RA 2V95A 3VVJA 1DVNA 1YXAA 1B3KA 1JJOC 1OC0A 4G8RA 1TB6I 3EOXA 2ACHA 5EI0A 2VDYA 4Y40A 1XQGA 1JTIA 1HLEA 1SNGA 4EB1I 3STOA 4EB1L 1PSIA 4AU3A 1M93B 3NDDA 5CDZA 4C41A 1C8OA 8APIA 3B9FI 4ZK3A 1OVAA 5CDXA 1DZGI 4DTEA 3CAAA 1ATTA 3F1SA 1R1LI 2OAYA 5IO1A 3DRMA 4KDSA 4AJUA 1XU8A 2H4QA 2CEOA 3NE4A 3LE2A 1OO8A 1F0CA 3LW2A 4YIAA 2PEEA 2WXYC 4ZK0A 3CVMA 2WXZC 2RIWA 3DY0A 3NDAA 2ARQA 1WZ9A 1UHGA 1ATUA 2RIVA 4IF8A 5BRRI 4BB2A 3F02A 4P0FA 4AFXA 2WXZA 4DY0A 3R4LA 1LK6I 7APIA 1LJ5A 1KCTA 2B4XI 2HI9A 3CWLA 2B5TI 3CWMA 1QMNA 4ROAA 4RO9A 1K9OI
chains in the Genus database with same CATH superfamily
1A7CA 2PEFA 9PAIA 1OYHI 2WY0C 2ANTI 1OYHL 2HIJI 2B4XL 5INWA 4AU3B 4RSQA 1DZGL 3F5NA 3ZHAA 1JMJA 1IZ2A 1DB2A 2QUGA 4PYWA 1OVAB 1SEKA 4C49A 1ATHA 4AJTA 1ANTI 2R9YA 1QLPA 1JRRA 2BEHI 2WY1A 3Q03A 2BEHL 2XN7A 4AQHA 2H4PA 3UT3A 2GD4C 4CAAA 1C5GA 1E03I 1E04I 4Y3KA 1SR5A 1QMBA 1EZXA 1AS4A 5CE0A 1MTPA 4X30A 4DY7C 3OZQA 3FGQA 2VH4A 1E05I 2DUTA 2WXXA 2HIJL 3KCGI 4IC0A 2ZV6A 4R9IA 5C98A 5HGCA 1HP7A 4G8OA 3PB1I 1AZXI 1DZHI 4AU4A 3EVJI 1DZHL 1JVQI 4GA7A 3DLWA 2XN5A 1BY7A 1JMOA 1BR8I 1OVAC 2XN6A 3Q02A 4ROBA 3DRUA 4AU2A 1T1FA 3PZFA 1IMVA 2VDXA 1OPHA 1NQ9I 2XN3A 1LQ8A 1XQJA 2D26A 2ZNHA 3T1PA 3H5CA 3NDFA 9APIA 1DVMA 1D5SA 2OL2A 2ARRA 4P0OA 2WXWA 2H4RA 2V95A 3VVJA 1DVNA 1YXAA 1B3KA 1JJOC 1OC0A 4G8RA 1TB6I 3EOXA 2ACHA 5EI0A 2VDYA 4Y40A 1XQGA 1JTIA 1HLEA 1SNGA 4EB1I 3STOA 4EB1L 1PSIA 4AU3A 1M93B 3NDDA 5CDZA 4C41A 1C8OA 8APIA 3B9FI 4ZK3A 1OVAA 5CDXA 1DZGI 4DTEA 3CAAA 1ATTA 3F1SA 1R1LI 2OAYA 5IO1A 3DRMA 4KDSA 4AJUA 1XU8A 2H4QA 2CEOA 3NE4A 3LE2A 1OO8A 1F0CA 3LW2A 4YIAA 2PEEA 2WXYC 4ZK0A 3CVMA 2WXZC 2RIWA 3DY0A 3NDAA 2ARQA 1WZ9A 1UHGA 1ATUA 2RIVA 4IF8A 5BRRI 4BB2A 3F02A 4P0FA 4AFXA 2WXZA 4DY0A 3R4LA 1LK6I 7APIA 1LJ5A 1KCTA 2B4XI 2HI9A 3CWLA 2B5TI 3CWMA 1QMNA 4ROAA 4RO9A 1K9OI
chains in the Genus database with same CATH topology
1A7CA 2PEFA 9PAIA 1OYHI 2WY0C 2ANTI 1OYHL 2HIJI 2B4XL 5INWA 4AU3B 4RSQA 1DZGL 3F5NA 3ZHAA 1JMJA 1IZ2A 1DB2A 2QUGA 4PYWA 1OVAB 1SEKA 4C49A 1ATHA 4AJTA 1ANTI 2R9YA 1QLPA 1JRRA 2BEHI 2WY1A 3Q03A 2BEHL 2XN7A 4AQHA 2H4PA 3UT3A 2GD4C 4CAAA 1C5GA 1E03I 1E04I 4Y3KA 1SR5A 1QMBA 1EZXA 1AS4A 5CE0A 1MTPA 4X30A 4DY7C 3OZQA 3FGQA 2VH4A 1E05I 2DUTA 2WXXA 2HIJL 3KCGI 4IC0A 2ZV6A 4R9IA 5C98A 5HGCA 1HP7A 4G8OA 3PB1I 1AZXI 1DZHI 4AU4A 3EVJI 1DZHL 1JVQI 4GA7A 3DLWA 2XN5A 1BY7A 1JMOA 1BR8I 1OVAC 2XN6A 3Q02A 4ROBA 3DRUA 4AU2A 1T1FA 3PZFA 1IMVA 2VDXA 1OPHA 1NQ9I 2XN3A 1LQ8A 1XQJA 2D26A 2ZNHA 3T1PA 3H5CA 3NDFA 9APIA 1DVMA 1D5SA 2OL2A 2ARRA 4P0OA 2WXWA 2H4RA 2V95A 3VVJA 1DVNA 1YXAA 1B3KA 1JJOC 1OC0A 4G8RA 1TB6I 3EOXA 2ACHA 5EI0A 2VDYA 4Y40A 1XQGA 1JTIA 1HLEA 1SNGA 4EB1I 3STOA 4EB1L 1PSIA 4AU3A 1M93B 3NDDA 5CDZA 4C41A 1C8OA 8APIA 3B9FI 4ZK3A 1OVAA 5CDXA 1DZGI 4DTEA 3CAAA 1ATTA 3F1SA 1R1LI 2OAYA 5IO1A 3DRMA 4KDSA 4AJUA 1XU8A 2H4QA 2CEOA 3NE4A 3LE2A 1OO8A 1F0CA 3LW2A 4YIAA 2PEEA 2WXYC 4ZK0A 3CVMA 2WXZC 2RIWA 3DY0A 3NDAA 2ARQA 1WZ9A 1UHGA 1ATUA 2RIVA 4IF8A 5BRRI 4BB2A 3F02A 4P0FA 4AFXA 2WXZA 4DY0A 3R4LA 1LK6I 7APIA 1LJ5A 1KCTA 2B4XI 2HI9A 3CWLA 2B5TI 3CWMA 1QMNA 4ROAA 4RO9A 1K9OI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A7C A;  2PEF A;  9PAI A;  1OYH I;  2WY0 C;  2ANT I;  1OYH L;  2HIJ I;  2B4X L;  5INW A;  4AU3 B;  4RSQ A;  1DZG L;  3F5N A;  3ZHA A;  1JMJ A;  1IZ2 A;  1DB2 A;  2QUG A;  4PYW A;  1OVA B;  1SEK A;  4C49 A;  1ATH A;  4AJT A;  1ANT I;  2R9Y A;  1QLP A;  1JRR A;  2BEH I;  2WY1 A;  3Q03 A;  2BEH L;  2XN7 A;  4AQH A;  2H4P A;  3UT3 A;  2GD4 C;  4CAA A;  1C5G A;  1E03 I;  1E04 I;  4Y3K A;  1SR5 A;  1QMB A;  1EZX A;  1AS4 A;  5CE0 A;  1MTP A;  4X30 A;  4DY7 C;  3OZQ A;  3FGQ A;  2VH4 A;  1E05 I;  2DUT A;  2WXX A;  2HIJ L;  3KCG I;  4IC0 A;  2ZV6 A;  4R9I A;  5C98 A;  5HGC A;  1HP7 A;  4G8O A;  3PB1 I;  1AZX I;  1DZH I;  4AU4 A;  3EVJ I;  1DZH L;  1JVQ I;  4GA7 A;  3DLW A;  2XN5 A;  1BY7 A;  1JMO A;  1BR8 I;  1OVA C;  2XN6 A;  3Q02 A;  4ROB A;  3DRU A;  4AU2 A;  1T1F A;  3PZF A;  1IMV A;  2VDX A;  1OPH A;  1NQ9 I;  2XN3 A;  1LQ8 A;  1XQJ A;  2D26 A;  2ZNH A;  3T1P A;  3H5C A;  3NDF A;  9API A;  1DVM A;  1D5S A;  2OL2 A;  2ARR A;  4P0O A;  2WXW A;  2H4R A;  2V95 A;  3VVJ A;  1DVN A;  1YXA A;  1B3K A;  1JJO C;  1OC0 A;  4G8R A;  1TB6 I;  3EOX A;  2ACH A;  5EI0 A;  2VDY A;  4Y40 A;  1XQG A;  1JTI A;  1HLE A;  1SNG A;  4EB1 I;  3STO A;  4EB1 L;  1PSI A;  4AU3 A;  1M93 B;  3NDD A;  5CDZ A;  4C41 A;  1C8O A;  8API A;  3B9F I;  4ZK3 A;  1OVA A;  5CDX A;  1DZG I;  4DTE A;  3CAA A;  1ATT A;  3F1S A;  1R1L I;  2OAY A;  5IO1 A;  3DRM A;  4KDS A;  4AJU A;  1XU8 A;  2H4Q A;  2CEO A;  3NE4 A;  3LE2 A;  1OO8 A;  1F0C A;  3LW2 A;  4YIA A;  2PEE A;  2WXY C;  4ZK0 A;  3CVM A;  2WXZ C;  2RIW A;  3DY0 A;  3NDA A;  2ARQ A;  1WZ9 A;  1UHG A;  1ATU A;  2RIV A;  4IF8 A;  5BRR I;  4BB2 A;  3F02 A;  4P0F A;  4AFX A;  2WXZ A;  4DY0 A;  3R4L A;  1LK6 I;  7API A;  1LJ5 A;  1KCT A;  2B4X I;  2HI9 A;  3CWL A;  2B5T I;  3CWM A;  1QMN A;  4ROA A;  4RO9 A;  1K9O I; 
#chains in the Genus database with same CATH topology
 1A7C A;  2PEF A;  9PAI A;  1OYH I;  2WY0 C;  2ANT I;  1OYH L;  2HIJ I;  2B4X L;  5INW A;  4AU3 B;  4RSQ A;  1DZG L;  3F5N A;  3ZHA A;  1JMJ A;  1IZ2 A;  1DB2 A;  2QUG A;  4PYW A;  1OVA B;  1SEK A;  4C49 A;  1ATH A;  4AJT A;  1ANT I;  2R9Y A;  1QLP A;  1JRR A;  2BEH I;  2WY1 A;  3Q03 A;  2BEH L;  2XN7 A;  4AQH A;  2H4P A;  3UT3 A;  2GD4 C;  4CAA A;  1C5G A;  1E03 I;  1E04 I;  4Y3K A;  1SR5 A;  1QMB A;  1EZX A;  1AS4 A;  5CE0 A;  1MTP A;  4X30 A;  4DY7 C;  3OZQ A;  3FGQ A;  2VH4 A;  1E05 I;  2DUT A;  2WXX A;  2HIJ L;  3KCG I;  4IC0 A;  2ZV6 A;  4R9I A;  5C98 A;  5HGC A;  1HP7 A;  4G8O A;  3PB1 I;  1AZX I;  1DZH I;  4AU4 A;  3EVJ I;  1DZH L;  1JVQ I;  4GA7 A;  3DLW A;  2XN5 A;  1BY7 A;  1JMO A;  1BR8 I;  1OVA C;  2XN6 A;  3Q02 A;  4ROB A;  3DRU A;  4AU2 A;  1T1F A;  3PZF A;  1IMV A;  2VDX A;  1OPH A;  1NQ9 I;  2XN3 A;  1LQ8 A;  1XQJ A;  2D26 A;  2ZNH A;  3T1P A;  3H5C A;  3NDF A;  9API A;  1DVM A;  1D5S A;  2OL2 A;  2ARR A;  4P0O A;  2WXW A;  2H4R A;  2V95 A;  3VVJ A;  1DVN A;  1YXA A;  1B3K A;  1JJO C;  1OC0 A;  4G8R A;  1TB6 I;  3EOX A;  2ACH A;  5EI0 A;  2VDY A;  4Y40 A;  1XQG A;  1JTI A;  1HLE A;  1SNG A;  4EB1 I;  3STO A;  4EB1 L;  1PSI A;  4AU3 A;  1M93 B;  3NDD A;  5CDZ A;  4C41 A;  1C8O A;  8API A;  3B9F I;  4ZK3 A;  1OVA A;  5CDX A;  1DZG I;  4DTE A;  3CAA A;  1ATT A;  3F1S A;  1R1L I;  2OAY A;  5IO1 A;  3DRM A;  4KDS A;  4AJU A;  1XU8 A;  2H4Q A;  2CEO A;  3NE4 A;  3LE2 A;  1OO8 A;  1F0C A;  3LW2 A;  4YIA A;  2PEE A;  2WXY C;  4ZK0 A;  3CVM A;  2WXZ C;  2RIW A;  3DY0 A;  3NDA A;  2ARQ A;  1WZ9 A;  1UHG A;  1ATU A;  2RIV A;  4IF8 A;  5BRR I;  4BB2 A;  3F02 A;  4P0F A;  4AFX A;  2WXZ A;  4DY0 A;  3R4L A;  1LK6 I;  7API A;  1LJ5 A;  1KCT A;  2B4X I;  2HI9 A;  3CWL A;  2B5T I;  3CWM A;  1QMN A;  4ROA A;  4RO9 A;  1K9O I; 
#chains in the Genus database with same CATH homology
 1A7C A;  2PEF A;  9PAI A;  1OYH I;  2WY0 C;  2ANT I;  1OYH L;  2HIJ I;  2B4X L;  5INW A;  4AU3 B;  4RSQ A;  1DZG L;  3F5N A;  3ZHA A;  1JMJ A;  1IZ2 A;  1DB2 A;  2QUG A;  4PYW A;  1OVA B;  1SEK A;  4C49 A;  1ATH A;  4AJT A;  1ANT I;  2R9Y A;  1QLP A;  1JRR A;  2BEH I;  2WY1 A;  3Q03 A;  2BEH L;  2XN7 A;  4AQH A;  2H4P A;  3UT3 A;  2GD4 C;  4CAA A;  1C5G A;  1E03 I;  1E04 I;  4Y3K A;  1SR5 A;  1QMB A;  1EZX A;  1AS4 A;  5CE0 A;  1MTP A;  4X30 A;  4DY7 C;  3OZQ A;  3FGQ A;  2VH4 A;  1E05 I;  2DUT A;  2WXX A;  2HIJ L;  3KCG I;  4IC0 A;  2ZV6 A;  4R9I A;  5C98 A;  5HGC A;  1HP7 A;  4G8O A;  3PB1 I;  1AZX I;  1DZH I;  4AU4 A;  3EVJ I;  1DZH L;  1JVQ I;  4GA7 A;  3DLW A;  2XN5 A;  1BY7 A;  1JMO A;  1BR8 I;  1OVA C;  2XN6 A;  3Q02 A;  4ROB A;  3DRU A;  4AU2 A;  1T1F A;  3PZF A;  1IMV A;  2VDX A;  1OPH A;  1NQ9 I;  2XN3 A;  1LQ8 A;  1XQJ A;  2D26 A;  2ZNH A;  3T1P A;  3H5C A;  3NDF A;  9API A;  1DVM A;  1D5S A;  2OL2 A;  2ARR A;  4P0O A;  2WXW A;  2H4R A;  2V95 A;  3VVJ A;  1DVN A;  1YXA A;  1B3K A;  1JJO C;  1OC0 A;  4G8R A;  1TB6 I;  3EOX A;  2ACH A;  5EI0 A;  2VDY A;  4Y40 A;  1XQG A;  1JTI A;  1HLE A;  1SNG A;  4EB1 I;  3STO A;  4EB1 L;  1PSI A;  4AU3 A;  1M93 B;  3NDD A;  5CDZ A;  4C41 A;  1C8O A;  8API A;  3B9F I;  4ZK3 A;  1OVA A;  5CDX A;  1DZG I;  4DTE A;  3CAA A;  1ATT A;  3F1S A;  1R1L I;  2OAY A;  5IO1 A;  3DRM A;  4KDS A;  4AJU A;  1XU8 A;  2H4Q A;  2CEO A;  3NE4 A;  3LE2 A;  1OO8 A;  1F0C A;  3LW2 A;  4YIA A;  2PEE A;  2WXY C;  4ZK0 A;  3CVM A;  2WXZ C;  2RIW A;  3DY0 A;  3NDA A;  2ARQ A;  1WZ9 A;  1UHG A;  1ATU A;  2RIV A;  4IF8 A;  5BRR I;  4BB2 A;  3F02 A;  4P0F A;  4AFX A;  2WXZ A;  4DY0 A;  3R4L A;  1LK6 I;  7API A;  1LJ5 A;  1KCT A;  2B4X I;  2HI9 A;  3CWL A;  2B5T I;  3CWM A;  1QMN A;  4ROA A;  4RO9 A;  1K9O I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...