7APIA

The s variant of human alpha1-antitrypsin, structure and implications for function and metabolism
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
339
structure length
339
Chain Sequence
HPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The S variant of human alpha 1-antitrypsin, structure and implications for function and metabolism.
pubmed doi rcsb
molecule keywords ALPHA 1-ANTITRYPSIN
molecule tags Proteinase inhibitor
source organism Homo sapiens
total genus 89
structure length 339
sequence length 339
ec nomenclature
pdb deposition date 1988-09-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.39.10 Mainly Beta Roll Alpha-1-antitrypsin; domain 1 Alpha-1-antitrypsin, domain 1 7apiA01
3.30.497.10 Alpha Beta 2-Layer Sandwich Antithrombin; Chain I, domain 2 Antithrombin, subunit I, domain 2 7apiA02
3Q02A 9PAIA 2XN6A 3DRUA 1LQ8A 9APIA 1OYHI 1IZ2A 3LW2A 4ZK3A 1EZXA 7APIA 1KCTA 4PYWA 4AU3A 2HI9A 2V95A 3DY0A 1SR5A 2ARRA 2OAYA 2VH4A 1LJ5A 1B3KA 2XN3A 4C49A 5CE0A 1BR8I 1QLPA 4X30A 1E03I 3CWLA 1E04I 2HIJI 1YXAA 2XN5A 3NDDA 2WXZC 4AU4A 2VDYA 3R4LA 1XQGA 2WY0C 1DZHI 2BEHI 4RO9A 2ARQA 1JMJA 4ROBA 1DVMA 4P0FA 8APIA 2CEOA 4AFXA 1ATTA 3DLWA 4C41A 1XU8A 1JTIA 4DY0A 1K9OI 4BB2A 2WXXA 4YIAA 2WXWA 4DY7C 1HLEA 4P0OA 3CWMA 1OVAB 3ZHAA 1IMVA 3DRMA 3NDAA 1JVQI 1OYHL 4RSQA 1BY7A 1XQJA 2XN7A 3STOA 4KDSA 4AQHA 1SEKA 5HGCA 2GD4C 2PEEA 4GA7A 1T1FA 4R9IA 4CAAA 1OVAA 1QMBA 3EVJI 3F1SA 2WXYC 4ROAA 1QMNA 2HIJL 1ATUA 3LE2A 4G8RA 2VDXA 1DB2A 3KCGI 1LK6I 3F5NA 1WZ9A 1DZHL 2BEHL 5IO1A 4Y3KA 3F02A 1SNGA 4EB1I 3PB1I 1DVNA 2B4XI 1ANTI 2H4PA 4AU2A 1AS4A 2ACHA 2QUGA 1UHGA 5C98A 3Q03A 1DZGI 2RIWA 3UT3A 3VVJA 1ATHA 4G8OA 1A7CA 5CDZA 1E05I 4AJTA 4ZK0A 2H4QA 1R1LI 3PZFA 4DTEA 4AJUA 1DZGL 3T1PA 1PSIA 1JMOA 4Y40A 5CDXA 1AZXI 2WXZA 3NDFA 3CVMA 2RIVA 2ZNHA 1C5GA 1OVAC 2B5TI 1JJOC 1JRRA 5EI0A 1HP7A 1NQ9I 1OPHA 2ANTI 1F0CA 2R9YA 2WY1A 1M93B 3FGQA 1TB6I 2H4RA 4IF8A 5BRRI 4EB1L 2OL2A 3OZQA 3B9FI 4AU3B 2DUTA 1OC0A 3NE4A 4IC0A 5INWA 1MTPA 1C8OA 2B4XL 2D26A 3CAAA 2PEFA 1OO8A 2ZV6A 3H5CA 1D5SA 3EOXA
chains in the Genus database with same CATH superfamily
3Q02A 9PAIA 2XN6A 3DRUA 1LQ8A 9APIA 1OYHI 1IZ2A 3LW2A 4ZK3A 1EZXA 7APIA 1KCTA 4PYWA 4AU3A 2HI9A 2V95A 3DY0A 1SR5A 2ARRA 2OAYA 2VH4A 1LJ5A 1B3KA 2XN3A 4C49A 5CE0A 1BR8I 1QLPA 4X30A 1E03I 3CWLA 1E04I 2HIJI 1YXAA 2XN5A 3NDDA 2WXZC 4AU4A 2VDYA 3R4LA 1XQGA 2WY0C 1DZHI 2BEHI 4RO9A 2ARQA 1JMJA 4ROBA 1DVMA 4P0FA 8APIA 2CEOA 4AFXA 1ATTA 3DLWA 4C41A 1XU8A 1JTIA 4DY0A 1K9OI 4BB2A 2WXXA 4YIAA 2WXWA 4DY7C 1HLEA 4P0OA 3CWMA 1OVAB 3ZHAA 1IMVA 3DRMA 3NDAA 1JVQI 1OYHL 4RSQA 1BY7A 1XQJA 2XN7A 3STOA 4KDSA 4AQHA 1SEKA 5HGCA 2GD4C 2PEEA 4GA7A 1T1FA 4R9IA 4CAAA 1OVAA 1QMBA 3EVJI 3F1SA 2WXYC 4ROAA 1QMNA 2HIJL 1ATUA 3LE2A 4G8RA 2VDXA 1DB2A 3KCGI 1LK6I 3F5NA 1WZ9A 1DZHL 2BEHL 5IO1A 4Y3KA 3F02A 1SNGA 4EB1I 3PB1I 1DVNA 2B4XI 1ANTI 2H4PA 4AU2A 1AS4A 2ACHA 2QUGA 1UHGA 5C98A 3Q03A 1DZGI 2RIWA 3UT3A 3VVJA 1ATHA 4G8OA 1A7CA 5CDZA 1E05I 4AJTA 4ZK0A 2H4QA 1R1LI 3PZFA 4DTEA 4AJUA 1DZGL 3T1PA 1PSIA 1JMOA 4Y40A 5CDXA 1AZXI 2WXZA 3NDFA 3CVMA 2RIVA 2ZNHA 1C5GA 1OVAC 2B5TI 1JJOC 1JRRA 5EI0A 1HP7A 1NQ9I 1OPHA 2ANTI 1F0CA 2R9YA 2WY1A 1M93B 3FGQA 1TB6I 2H4RA 4IF8A 5BRRI 4EB1L 2OL2A 3OZQA 3B9FI 4AU3B 2DUTA 1OC0A 3NE4A 4IC0A 5INWA 1MTPA 1C8OA 2B4XL 2D26A 3CAAA 2PEFA 1OO8A 2ZV6A 3H5CA 1D5SA 3EOXA
chains in the Genus database with same CATH topology
3Q02A 9PAIA 2XN6A 3DRUA 1LQ8A 9APIA 1OYHI 1IZ2A 3LW2A 4ZK3A 1EZXA 7APIA 1KCTA 4PYWA 4AU3A 2HI9A 2V95A 3DY0A 1SR5A 2ARRA 2OAYA 2VH4A 1LJ5A 1B3KA 2XN3A 4C49A 5CE0A 1BR8I 1QLPA 4X30A 1E03I 3CWLA 1E04I 2HIJI 1YXAA 2XN5A 3NDDA 2WXZC 4AU4A 2VDYA 3R4LA 1XQGA 2WY0C 1DZHI 2BEHI 4RO9A 2ARQA 1JMJA 4ROBA 1DVMA 4P0FA 8APIA 2CEOA 4AFXA 1ATTA 3DLWA 4C41A 1XU8A 1JTIA 4DY0A 1K9OI 4BB2A 2WXXA 4YIAA 2WXWA 4DY7C 1HLEA 4P0OA 3CWMA 1OVAB 3ZHAA 1IMVA 3DRMA 3NDAA 1JVQI 1OYHL 4RSQA 1BY7A 1XQJA 2XN7A 3STOA 4KDSA 4AQHA 1SEKA 5HGCA 2GD4C 2PEEA 4GA7A 1T1FA 4R9IA 4CAAA 1OVAA 1QMBA 3EVJI 3F1SA 2WXYC 4ROAA 1QMNA 2HIJL 1ATUA 3LE2A 4G8RA 2VDXA 1DB2A 3KCGI 1LK6I 3F5NA 1WZ9A 1DZHL 2BEHL 5IO1A 4Y3KA 3F02A 1SNGA 4EB1I 3PB1I 1DVNA 2B4XI 1ANTI 2H4PA 4AU2A 1AS4A 2ACHA 2QUGA 1UHGA 5C98A 3Q03A 1DZGI 2RIWA 3UT3A 3VVJA 1ATHA 4G8OA 1A7CA 5CDZA 1E05I 4AJTA 4ZK0A 2H4QA 1R1LI 3PZFA 4DTEA 4AJUA 1DZGL 3T1PA 1PSIA 1JMOA 4Y40A 5CDXA 1AZXI 2WXZA 3NDFA 3CVMA 2RIVA 2ZNHA 1C5GA 1OVAC 2B5TI 1JJOC 1JRRA 5EI0A 1HP7A 1NQ9I 1OPHA 2ANTI 1F0CA 2R9YA 2WY1A 1M93B 3FGQA 1TB6I 2H4RA 4IF8A 5BRRI 4EB1L 2OL2A 3OZQA 3B9FI 4AU3B 2DUTA 1OC0A 3NE4A 4IC0A 5INWA 1MTPA 1C8OA 2B4XL 2D26A 3CAAA 2PEFA 1OO8A 2ZV6A 3H5CA 1D5SA 3EOXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q02 A;  9PAI A;  2XN6 A;  3DRU A;  1LQ8 A;  9API A;  1OYH I;  1IZ2 A;  3LW2 A;  4ZK3 A;  1EZX A;  7API A;  1KCT A;  4PYW A;  4AU3 A;  2HI9 A;  2V95 A;  3DY0 A;  1SR5 A;  2ARR A;  2OAY A;  2VH4 A;  1LJ5 A;  1B3K A;  2XN3 A;  4C49 A;  5CE0 A;  1BR8 I;  1QLP A;  4X30 A;  1E03 I;  3CWL A;  1E04 I;  2HIJ I;  1YXA A;  2XN5 A;  3NDD A;  2WXZ C;  4AU4 A;  2VDY A;  3R4L A;  1XQG A;  2WY0 C;  1DZH I;  2BEH I;  4RO9 A;  2ARQ A;  1JMJ A;  4ROB A;  1DVM A;  4P0F A;  8API A;  2CEO A;  4AFX A;  1ATT A;  3DLW A;  4C41 A;  1XU8 A;  1JTI A;  4DY0 A;  1K9O I;  4BB2 A;  2WXX A;  4YIA A;  2WXW A;  4DY7 C;  1HLE A;  4P0O A;  3CWM A;  1OVA B;  3ZHA A;  1IMV A;  3DRM A;  3NDA A;  1JVQ I;  1OYH L;  4RSQ A;  1BY7 A;  1XQJ A;  2XN7 A;  3STO A;  4KDS A;  4AQH A;  1SEK A;  5HGC A;  2GD4 C;  2PEE A;  4GA7 A;  1T1F A;  4R9I A;  4CAA A;  1OVA A;  1QMB A;  3EVJ I;  3F1S A;  2WXY C;  4ROA A;  1QMN A;  2HIJ L;  1ATU A;  3LE2 A;  4G8R A;  2VDX A;  1DB2 A;  3KCG I;  1LK6 I;  3F5N A;  1WZ9 A;  1DZH L;  2BEH L;  5IO1 A;  4Y3K A;  3F02 A;  1SNG A;  4EB1 I;  3PB1 I;  1DVN A;  2B4X I;  1ANT I;  2H4P A;  4AU2 A;  1AS4 A;  2ACH A;  2QUG A;  1UHG A;  5C98 A;  3Q03 A;  1DZG I;  2RIW A;  3UT3 A;  3VVJ A;  1ATH A;  4G8O A;  1A7C A;  5CDZ A;  1E05 I;  4AJT A;  4ZK0 A;  2H4Q A;  1R1L I;  3PZF A;  4DTE A;  4AJU A;  1DZG L;  3T1P A;  1PSI A;  1JMO A;  4Y40 A;  5CDX A;  1AZX I;  2WXZ A;  3NDF A;  3CVM A;  2RIV A;  2ZNH A;  1C5G A;  1OVA C;  2B5T I;  1JJO C;  1JRR A;  5EI0 A;  1HP7 A;  1NQ9 I;  1OPH A;  2ANT I;  1F0C A;  2R9Y A;  2WY1 A;  1M93 B;  3FGQ A;  1TB6 I;  2H4R A;  4IF8 A;  5BRR I;  4EB1 L;  2OL2 A;  3OZQ A;  3B9F I;  4AU3 B;  2DUT A;  1OC0 A;  3NE4 A;  4IC0 A;  5INW A;  1MTP A;  1C8O A;  2B4X L;  2D26 A;  3CAA A;  2PEF A;  1OO8 A;  2ZV6 A;  3H5C A;  1D5S A;  3EOX A; 
#chains in the Genus database with same CATH topology
 3Q02 A;  9PAI A;  2XN6 A;  3DRU A;  1LQ8 A;  9API A;  1OYH I;  1IZ2 A;  3LW2 A;  4ZK3 A;  1EZX A;  7API A;  1KCT A;  4PYW A;  4AU3 A;  2HI9 A;  2V95 A;  3DY0 A;  1SR5 A;  2ARR A;  2OAY A;  2VH4 A;  1LJ5 A;  1B3K A;  2XN3 A;  4C49 A;  5CE0 A;  1BR8 I;  1QLP A;  4X30 A;  1E03 I;  3CWL A;  1E04 I;  2HIJ I;  1YXA A;  2XN5 A;  3NDD A;  2WXZ C;  4AU4 A;  2VDY A;  3R4L A;  1XQG A;  2WY0 C;  1DZH I;  2BEH I;  4RO9 A;  2ARQ A;  1JMJ A;  4ROB A;  1DVM A;  4P0F A;  8API A;  2CEO A;  4AFX A;  1ATT A;  3DLW A;  4C41 A;  1XU8 A;  1JTI A;  4DY0 A;  1K9O I;  4BB2 A;  2WXX A;  4YIA A;  2WXW A;  4DY7 C;  1HLE A;  4P0O A;  3CWM A;  1OVA B;  3ZHA A;  1IMV A;  3DRM A;  3NDA A;  1JVQ I;  1OYH L;  4RSQ A;  1BY7 A;  1XQJ A;  2XN7 A;  3STO A;  4KDS A;  4AQH A;  1SEK A;  5HGC A;  2GD4 C;  2PEE A;  4GA7 A;  1T1F A;  4R9I A;  4CAA A;  1OVA A;  1QMB A;  3EVJ I;  3F1S A;  2WXY C;  4ROA A;  1QMN A;  2HIJ L;  1ATU A;  3LE2 A;  4G8R A;  2VDX A;  1DB2 A;  3KCG I;  1LK6 I;  3F5N A;  1WZ9 A;  1DZH L;  2BEH L;  5IO1 A;  4Y3K A;  3F02 A;  1SNG A;  4EB1 I;  3PB1 I;  1DVN A;  2B4X I;  1ANT I;  2H4P A;  4AU2 A;  1AS4 A;  2ACH A;  2QUG A;  1UHG A;  5C98 A;  3Q03 A;  1DZG I;  2RIW A;  3UT3 A;  3VVJ A;  1ATH A;  4G8O A;  1A7C A;  5CDZ A;  1E05 I;  4AJT A;  4ZK0 A;  2H4Q A;  1R1L I;  3PZF A;  4DTE A;  4AJU A;  1DZG L;  3T1P A;  1PSI A;  1JMO A;  4Y40 A;  5CDX A;  1AZX I;  2WXZ A;  3NDF A;  3CVM A;  2RIV A;  2ZNH A;  1C5G A;  1OVA C;  2B5T I;  1JJO C;  1JRR A;  5EI0 A;  1HP7 A;  1NQ9 I;  1OPH A;  2ANT I;  1F0C A;  2R9Y A;  2WY1 A;  1M93 B;  3FGQ A;  1TB6 I;  2H4R A;  4IF8 A;  5BRR I;  4EB1 L;  2OL2 A;  3OZQ A;  3B9F I;  4AU3 B;  2DUT A;  1OC0 A;  3NE4 A;  4IC0 A;  5INW A;  1MTP A;  1C8O A;  2B4X L;  2D26 A;  3CAA A;  2PEF A;  1OO8 A;  2ZV6 A;  3H5C A;  1D5S A;  3EOX A; 
#chains in the Genus database with same CATH homology
 3Q02 A;  9PAI A;  2XN6 A;  3DRU A;  1LQ8 A;  9API A;  1OYH I;  1IZ2 A;  3LW2 A;  4ZK3 A;  1EZX A;  7API A;  1KCT A;  4PYW A;  4AU3 A;  2HI9 A;  2V95 A;  3DY0 A;  1SR5 A;  2ARR A;  2OAY A;  2VH4 A;  1LJ5 A;  1B3K A;  2XN3 A;  4C49 A;  5CE0 A;  1BR8 I;  1QLP A;  4X30 A;  1E03 I;  3CWL A;  1E04 I;  2HIJ I;  1YXA A;  2XN5 A;  3NDD A;  2WXZ C;  4AU4 A;  2VDY A;  3R4L A;  1XQG A;  2WY0 C;  1DZH I;  2BEH I;  4RO9 A;  2ARQ A;  1JMJ A;  4ROB A;  1DVM A;  4P0F A;  8API A;  2CEO A;  4AFX A;  1ATT A;  3DLW A;  4C41 A;  1XU8 A;  1JTI A;  4DY0 A;  1K9O I;  4BB2 A;  2WXX A;  4YIA A;  2WXW A;  4DY7 C;  1HLE A;  4P0O A;  3CWM A;  1OVA B;  3ZHA A;  1IMV A;  3DRM A;  3NDA A;  1JVQ I;  1OYH L;  4RSQ A;  1BY7 A;  1XQJ A;  2XN7 A;  3STO A;  4KDS A;  4AQH A;  1SEK A;  5HGC A;  2GD4 C;  2PEE A;  4GA7 A;  1T1F A;  4R9I A;  4CAA A;  1OVA A;  1QMB A;  3EVJ I;  3F1S A;  2WXY C;  4ROA A;  1QMN A;  2HIJ L;  1ATU A;  3LE2 A;  4G8R A;  2VDX A;  1DB2 A;  3KCG I;  1LK6 I;  3F5N A;  1WZ9 A;  1DZH L;  2BEH L;  5IO1 A;  4Y3K A;  3F02 A;  1SNG A;  4EB1 I;  3PB1 I;  1DVN A;  2B4X I;  1ANT I;  2H4P A;  4AU2 A;  1AS4 A;  2ACH A;  2QUG A;  1UHG A;  5C98 A;  3Q03 A;  1DZG I;  2RIW A;  3UT3 A;  3VVJ A;  1ATH A;  4G8O A;  1A7C A;  5CDZ A;  1E05 I;  4AJT A;  4ZK0 A;  2H4Q A;  1R1L I;  3PZF A;  4DTE A;  4AJU A;  1DZG L;  3T1P A;  1PSI A;  1JMO A;  4Y40 A;  5CDX A;  1AZX I;  2WXZ A;  3NDF A;  3CVM A;  2RIV A;  2ZNH A;  1C5G A;  1OVA C;  2B5T I;  1JJO C;  1JRR A;  5EI0 A;  1HP7 A;  1NQ9 I;  1OPH A;  2ANT I;  1F0C A;  2R9Y A;  2WY1 A;  1M93 B;  3FGQ A;  1TB6 I;  2H4R A;  4IF8 A;  5BRR I;  4EB1 L;  2OL2 A;  3OZQ A;  3B9F I;  4AU3 B;  2DUT A;  1OC0 A;  3NE4 A;  4IC0 A;  5INW A;  1MTP A;  1C8O A;  2B4X L;  2D26 A;  3CAA A;  2PEF A;  1OO8 A;  2ZV6 A;  3H5C A;  1D5S A;  3EOX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...