1QLPA

2.0 angstrom structure of intact alpha-1-antitrypsin: a canonical template for active serpins
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
372
structure length
372
Chain Sequence
FNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Topography of a 2.0 A Structure of Alpha1-Antitrypsin Reveals Targets for Rational Drug Design to Prevent Conformational Disease.
pubmed rcsb
molecule keywords ALPHA-1-ANTITRYPSIN
molecule tags Serine protease inhibitor
source organism Homo sapiens
total genus 109
structure length 372
sequence length 372
ec nomenclature
pdb deposition date 1999-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00079 Serpin Serpin (serine protease inhibitor)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.39.10 Mainly Beta Roll Alpha-1-antitrypsin; domain 1 Alpha-1-antitrypsin, domain 1 1qlpA01
3.30.497.10 Alpha Beta 2-Layer Sandwich Antithrombin; Chain I, domain 2 Antithrombin, subunit I, domain 2 1qlpA02
2B5TI 2H4PA 4RSQA 4AJTA 4AQHA 2B4XL 3LW2A 2PEFA 3CWMA 1NQ9I 2VH4A 2XN3A 2HI9A 1OYHI 1JMJA 5EI0A 3EOXA 2CEOA 2ZV6A 1OVAC 4ROAA 1LK6I 3DRMA 5C98A 1LQ8A 4R9IA 1QMNA 4KDSA 1OVAB 1DZGL 2ANTI 3DLWA 1B3KA 4G8OA 3H5CA 4DTEA 1E03I 1XU8A 1YXAA 1D5SA 2XN7A 4ROBA 2WXZA 1LJ5A 2GD4C 2R9YA 1ATHA 1SNGA 1HP7A 1ATUA 2RIVA 3CVMA 3UT3A 2VDXA 1AZXI 2OL2A 1E05I 4RO9A 1IMVA 3NDDA 1A7CA 2H4QA 4X30A 1OYHL 3Q02A 4YIAA 1PSIA 1BR8I 1ATTA 2WY1A 3PZFA 1IZ2A 2WXYC 4AU2A 4AU3A 2RIWA 3LE2A 4AU3B 1JRRA 1QMBA 2QUGA 5BRRI 4IC0A 1OPHA 3CAAA 4AJUA 3B9FI 2WXXA 3KCGI 1DZHI 1OVAA 3R4LA 3DY0A 2ARRA 2XN5A 2PEEA 1DVNA 1SEKA 8APIA 3NDAA 2V95A 2OAYA 1JJOC 2ARQA 3NE4A 4PYWA 3F1SA 3T1PA 4DY7C 1QLPA 3F02A 4Y40A 1EZXA 5IO1A 3DRUA 1MTPA 1C5GA 3F5NA 1UHGA 4P0FA 4EB1I 4CAAA 3NDFA 4P0OA 1HLEA 1SR5A 4C41A 1XQJA 1K9OI 2H4RA 5CDXA 1DZHL 2DUTA 1E04I 1JMOA 9APIA 2XN6A 2HIJI 1M93B 4ZK0A 1T1FA 5INWA 1DB2A 1XQGA 2BEHI 4AU4A 3VVJA 1JVQI 3CWLA 4G8RA 1KCTA 5CDZA 2B4XI 4GA7A 2D26A 4EB1L 4ZK3A 4AFXA 2ZNHA 4Y3KA 1OC0A 1R1LI 1C8OA 3PB1I 4DY0A 3ZHAA 7APIA 2WXWA 5CE0A 5HGCA 1WZ9A 9PAIA 1AS4A 2VDYA 2WY0C 1DVMA 3STOA 1OO8A 1ANTI 2WXZC 1TB6I 4IF8A 1BY7A 2ACHA 3FGQA 2HIJL 1JTIA 2BEHL 1DZGI 3EVJI 4C49A 3Q03A 3OZQA 4BB2A 1F0CA
chains in the Genus database with same CATH superfamily
2B5TI 2H4PA 4RSQA 4AJTA 4AQHA 2B4XL 3LW2A 2PEFA 3CWMA 1NQ9I 2VH4A 2XN3A 2HI9A 1OYHI 1JMJA 5EI0A 3EOXA 2CEOA 2ZV6A 1OVAC 4ROAA 1LK6I 3DRMA 5C98A 1LQ8A 4R9IA 1QMNA 4KDSA 1OVAB 1DZGL 2ANTI 3DLWA 1B3KA 4G8OA 3H5CA 4DTEA 1E03I 1XU8A 1YXAA 1D5SA 2XN7A 4ROBA 2WXZA 1LJ5A 2GD4C 2R9YA 1ATHA 1SNGA 1HP7A 1ATUA 2RIVA 3CVMA 3UT3A 2VDXA 1AZXI 2OL2A 1E05I 4RO9A 1IMVA 3NDDA 1A7CA 2H4QA 4X30A 1OYHL 3Q02A 4YIAA 1PSIA 1BR8I 1ATTA 2WY1A 3PZFA 1IZ2A 2WXYC 4AU2A 4AU3A 2RIWA 3LE2A 4AU3B 1JRRA 1QMBA 2QUGA 5BRRI 4IC0A 1OPHA 3CAAA 4AJUA 3B9FI 2WXXA 3KCGI 1DZHI 1OVAA 3R4LA 3DY0A 2ARRA 2XN5A 2PEEA 1DVNA 1SEKA 8APIA 3NDAA 2V95A 2OAYA 1JJOC 2ARQA 3NE4A 4PYWA 3F1SA 3T1PA 4DY7C 1QLPA 3F02A 4Y40A 1EZXA 5IO1A 3DRUA 1MTPA 1C5GA 3F5NA 1UHGA 4P0FA 4EB1I 4CAAA 3NDFA 4P0OA 1HLEA 1SR5A 4C41A 1XQJA 1K9OI 2H4RA 5CDXA 1DZHL 2DUTA 1E04I 1JMOA 9APIA 2XN6A 2HIJI 1M93B 4ZK0A 1T1FA 5INWA 1DB2A 1XQGA 2BEHI 4AU4A 3VVJA 1JVQI 3CWLA 4G8RA 1KCTA 5CDZA 2B4XI 4GA7A 2D26A 4EB1L 4ZK3A 4AFXA 2ZNHA 4Y3KA 1OC0A 1R1LI 1C8OA 3PB1I 4DY0A 3ZHAA 7APIA 2WXWA 5CE0A 5HGCA 1WZ9A 9PAIA 1AS4A 2VDYA 2WY0C 1DVMA 3STOA 1OO8A 1ANTI 2WXZC 1TB6I 4IF8A 1BY7A 2ACHA 3FGQA 2HIJL 1JTIA 2BEHL 1DZGI 3EVJI 4C49A 3Q03A 3OZQA 4BB2A 1F0CA
chains in the Genus database with same CATH topology
2B5TI 2H4PA 4RSQA 4AJTA 4AQHA 2B4XL 3LW2A 2PEFA 3CWMA 1NQ9I 2VH4A 2XN3A 2HI9A 1OYHI 1JMJA 5EI0A 3EOXA 2CEOA 2ZV6A 1OVAC 4ROAA 1LK6I 3DRMA 5C98A 1LQ8A 4R9IA 1QMNA 4KDSA 1OVAB 1DZGL 2ANTI 3DLWA 1B3KA 4G8OA 3H5CA 4DTEA 1E03I 1XU8A 1YXAA 1D5SA 2XN7A 4ROBA 2WXZA 1LJ5A 2GD4C 2R9YA 1ATHA 1SNGA 1HP7A 1ATUA 2RIVA 3CVMA 3UT3A 2VDXA 1AZXI 2OL2A 1E05I 4RO9A 1IMVA 3NDDA 1A7CA 2H4QA 4X30A 1OYHL 3Q02A 4YIAA 1PSIA 1BR8I 1ATTA 2WY1A 3PZFA 1IZ2A 2WXYC 4AU2A 4AU3A 2RIWA 3LE2A 4AU3B 1JRRA 1QMBA 2QUGA 5BRRI 4IC0A 1OPHA 3CAAA 4AJUA 3B9FI 2WXXA 3KCGI 1DZHI 1OVAA 3R4LA 3DY0A 2ARRA 2XN5A 2PEEA 1DVNA 1SEKA 8APIA 3NDAA 2V95A 2OAYA 1JJOC 2ARQA 3NE4A 4PYWA 3F1SA 3T1PA 4DY7C 1QLPA 3F02A 4Y40A 1EZXA 5IO1A 3DRUA 1MTPA 1C5GA 3F5NA 1UHGA 4P0FA 4EB1I 4CAAA 3NDFA 4P0OA 1HLEA 1SR5A 4C41A 1XQJA 1K9OI 2H4RA 5CDXA 1DZHL 2DUTA 1E04I 1JMOA 9APIA 2XN6A 2HIJI 1M93B 4ZK0A 1T1FA 5INWA 1DB2A 1XQGA 2BEHI 4AU4A 3VVJA 1JVQI 3CWLA 4G8RA 1KCTA 5CDZA 2B4XI 4GA7A 2D26A 4EB1L 4ZK3A 4AFXA 2ZNHA 4Y3KA 1OC0A 1R1LI 1C8OA 3PB1I 4DY0A 3ZHAA 7APIA 2WXWA 5CE0A 5HGCA 1WZ9A 9PAIA 1AS4A 2VDYA 2WY0C 1DVMA 3STOA 1OO8A 1ANTI 2WXZC 1TB6I 4IF8A 1BY7A 2ACHA 3FGQA 2HIJL 1JTIA 2BEHL 1DZGI 3EVJI 4C49A 3Q03A 3OZQA 4BB2A 1F0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B5T I;  2H4P A;  4RSQ A;  4AJT A;  4AQH A;  2B4X L;  3LW2 A;  2PEF A;  3CWM A;  1NQ9 I;  2VH4 A;  2XN3 A;  2HI9 A;  1OYH I;  1JMJ A;  5EI0 A;  3EOX A;  2CEO A;  2ZV6 A;  1OVA C;  4ROA A;  1LK6 I;  3DRM A;  5C98 A;  1LQ8 A;  4R9I A;  1QMN A;  4KDS A;  1OVA B;  1DZG L;  2ANT I;  3DLW A;  1B3K A;  4G8O A;  3H5C A;  4DTE A;  1E03 I;  1XU8 A;  1YXA A;  1D5S A;  2XN7 A;  4ROB A;  2WXZ A;  1LJ5 A;  2GD4 C;  2R9Y A;  1ATH A;  1SNG A;  1HP7 A;  1ATU A;  2RIV A;  3CVM A;  3UT3 A;  2VDX A;  1AZX I;  2OL2 A;  1E05 I;  4RO9 A;  1IMV A;  3NDD A;  1A7C A;  2H4Q A;  4X30 A;  1OYH L;  3Q02 A;  4YIA A;  1PSI A;  1BR8 I;  1ATT A;  2WY1 A;  3PZF A;  1IZ2 A;  2WXY C;  4AU2 A;  4AU3 A;  2RIW A;  3LE2 A;  4AU3 B;  1JRR A;  1QMB A;  2QUG A;  5BRR I;  4IC0 A;  1OPH A;  3CAA A;  4AJU A;  3B9F I;  2WXX A;  3KCG I;  1DZH I;  1OVA A;  3R4L A;  3DY0 A;  2ARR A;  2XN5 A;  2PEE A;  1DVN A;  1SEK A;  8API A;  3NDA A;  2V95 A;  2OAY A;  1JJO C;  2ARQ A;  3NE4 A;  4PYW A;  3F1S A;  3T1P A;  4DY7 C;  1QLP A;  3F02 A;  4Y40 A;  1EZX A;  5IO1 A;  3DRU A;  1MTP A;  1C5G A;  3F5N A;  1UHG A;  4P0F A;  4EB1 I;  4CAA A;  3NDF A;  4P0O A;  1HLE A;  1SR5 A;  4C41 A;  1XQJ A;  1K9O I;  2H4R A;  5CDX A;  1DZH L;  2DUT A;  1E04 I;  1JMO A;  9API A;  2XN6 A;  2HIJ I;  1M93 B;  4ZK0 A;  1T1F A;  5INW A;  1DB2 A;  1XQG A;  2BEH I;  4AU4 A;  3VVJ A;  1JVQ I;  3CWL A;  4G8R A;  1KCT A;  5CDZ A;  2B4X I;  4GA7 A;  2D26 A;  4EB1 L;  4ZK3 A;  4AFX A;  2ZNH A;  4Y3K A;  1OC0 A;  1R1L I;  1C8O A;  3PB1 I;  4DY0 A;  3ZHA A;  7API A;  2WXW A;  5CE0 A;  5HGC A;  1WZ9 A;  9PAI A;  1AS4 A;  2VDY A;  2WY0 C;  1DVM A;  3STO A;  1OO8 A;  1ANT I;  2WXZ C;  1TB6 I;  4IF8 A;  1BY7 A;  2ACH A;  3FGQ A;  2HIJ L;  1JTI A;  2BEH L;  1DZG I;  3EVJ I;  4C49 A;  3Q03 A;  3OZQ A;  4BB2 A;  1F0C A; 
#chains in the Genus database with same CATH topology
 2B5T I;  2H4P A;  4RSQ A;  4AJT A;  4AQH A;  2B4X L;  3LW2 A;  2PEF A;  3CWM A;  1NQ9 I;  2VH4 A;  2XN3 A;  2HI9 A;  1OYH I;  1JMJ A;  5EI0 A;  3EOX A;  2CEO A;  2ZV6 A;  1OVA C;  4ROA A;  1LK6 I;  3DRM A;  5C98 A;  1LQ8 A;  4R9I A;  1QMN A;  4KDS A;  1OVA B;  1DZG L;  2ANT I;  3DLW A;  1B3K A;  4G8O A;  3H5C A;  4DTE A;  1E03 I;  1XU8 A;  1YXA A;  1D5S A;  2XN7 A;  4ROB A;  2WXZ A;  1LJ5 A;  2GD4 C;  2R9Y A;  1ATH A;  1SNG A;  1HP7 A;  1ATU A;  2RIV A;  3CVM A;  3UT3 A;  2VDX A;  1AZX I;  2OL2 A;  1E05 I;  4RO9 A;  1IMV A;  3NDD A;  1A7C A;  2H4Q A;  4X30 A;  1OYH L;  3Q02 A;  4YIA A;  1PSI A;  1BR8 I;  1ATT A;  2WY1 A;  3PZF A;  1IZ2 A;  2WXY C;  4AU2 A;  4AU3 A;  2RIW A;  3LE2 A;  4AU3 B;  1JRR A;  1QMB A;  2QUG A;  5BRR I;  4IC0 A;  1OPH A;  3CAA A;  4AJU A;  3B9F I;  2WXX A;  3KCG I;  1DZH I;  1OVA A;  3R4L A;  3DY0 A;  2ARR A;  2XN5 A;  2PEE A;  1DVN A;  1SEK A;  8API A;  3NDA A;  2V95 A;  2OAY A;  1JJO C;  2ARQ A;  3NE4 A;  4PYW A;  3F1S A;  3T1P A;  4DY7 C;  1QLP A;  3F02 A;  4Y40 A;  1EZX A;  5IO1 A;  3DRU A;  1MTP A;  1C5G A;  3F5N A;  1UHG A;  4P0F A;  4EB1 I;  4CAA A;  3NDF A;  4P0O A;  1HLE A;  1SR5 A;  4C41 A;  1XQJ A;  1K9O I;  2H4R A;  5CDX A;  1DZH L;  2DUT A;  1E04 I;  1JMO A;  9API A;  2XN6 A;  2HIJ I;  1M93 B;  4ZK0 A;  1T1F A;  5INW A;  1DB2 A;  1XQG A;  2BEH I;  4AU4 A;  3VVJ A;  1JVQ I;  3CWL A;  4G8R A;  1KCT A;  5CDZ A;  2B4X I;  4GA7 A;  2D26 A;  4EB1 L;  4ZK3 A;  4AFX A;  2ZNH A;  4Y3K A;  1OC0 A;  1R1L I;  1C8O A;  3PB1 I;  4DY0 A;  3ZHA A;  7API A;  2WXW A;  5CE0 A;  5HGC A;  1WZ9 A;  9PAI A;  1AS4 A;  2VDY A;  2WY0 C;  1DVM A;  3STO A;  1OO8 A;  1ANT I;  2WXZ C;  1TB6 I;  4IF8 A;  1BY7 A;  2ACH A;  3FGQ A;  2HIJ L;  1JTI A;  2BEH L;  1DZG I;  3EVJ I;  4C49 A;  3Q03 A;  3OZQ A;  4BB2 A;  1F0C A; 
#chains in the Genus database with same CATH homology
 2B5T I;  2H4P A;  4RSQ A;  4AJT A;  4AQH A;  2B4X L;  3LW2 A;  2PEF A;  3CWM A;  1NQ9 I;  2VH4 A;  2XN3 A;  2HI9 A;  1OYH I;  1JMJ A;  5EI0 A;  3EOX A;  2CEO A;  2ZV6 A;  1OVA C;  4ROA A;  1LK6 I;  3DRM A;  5C98 A;  1LQ8 A;  4R9I A;  1QMN A;  4KDS A;  1OVA B;  1DZG L;  2ANT I;  3DLW A;  1B3K A;  4G8O A;  3H5C A;  4DTE A;  1E03 I;  1XU8 A;  1YXA A;  1D5S A;  2XN7 A;  4ROB A;  2WXZ A;  1LJ5 A;  2GD4 C;  2R9Y A;  1ATH A;  1SNG A;  1HP7 A;  1ATU A;  2RIV A;  3CVM A;  3UT3 A;  2VDX A;  1AZX I;  2OL2 A;  1E05 I;  4RO9 A;  1IMV A;  3NDD A;  1A7C A;  2H4Q A;  4X30 A;  1OYH L;  3Q02 A;  4YIA A;  1PSI A;  1BR8 I;  1ATT A;  2WY1 A;  3PZF A;  1IZ2 A;  2WXY C;  4AU2 A;  4AU3 A;  2RIW A;  3LE2 A;  4AU3 B;  1JRR A;  1QMB A;  2QUG A;  5BRR I;  4IC0 A;  1OPH A;  3CAA A;  4AJU A;  3B9F I;  2WXX A;  3KCG I;  1DZH I;  1OVA A;  3R4L A;  3DY0 A;  2ARR A;  2XN5 A;  2PEE A;  1DVN A;  1SEK A;  8API A;  3NDA A;  2V95 A;  2OAY A;  1JJO C;  2ARQ A;  3NE4 A;  4PYW A;  3F1S A;  3T1P A;  4DY7 C;  1QLP A;  3F02 A;  4Y40 A;  1EZX A;  5IO1 A;  3DRU A;  1MTP A;  1C5G A;  3F5N A;  1UHG A;  4P0F A;  4EB1 I;  4CAA A;  3NDF A;  4P0O A;  1HLE A;  1SR5 A;  4C41 A;  1XQJ A;  1K9O I;  2H4R A;  5CDX A;  1DZH L;  2DUT A;  1E04 I;  1JMO A;  9API A;  2XN6 A;  2HIJ I;  1M93 B;  4ZK0 A;  1T1F A;  5INW A;  1DB2 A;  1XQG A;  2BEH I;  4AU4 A;  3VVJ A;  1JVQ I;  3CWL A;  4G8R A;  1KCT A;  5CDZ A;  2B4X I;  4GA7 A;  2D26 A;  4EB1 L;  4ZK3 A;  4AFX A;  2ZNH A;  4Y3K A;  1OC0 A;  1R1L I;  1C8O A;  3PB1 I;  4DY0 A;  3ZHA A;  7API A;  2WXW A;  5CE0 A;  5HGC A;  1WZ9 A;  9PAI A;  1AS4 A;  2VDY A;  2WY0 C;  1DVM A;  3STO A;  1OO8 A;  1ANT I;  2WXZ C;  1TB6 I;  4IF8 A;  1BY7 A;  2ACH A;  3FGQ A;  2HIJ L;  1JTI A;  2BEH L;  1DZG I;  3EVJ I;  4C49 A;  3Q03 A;  3OZQ A;  4BB2 A;  1F0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...