3DY0A

Crystal structure of cleaved pci bound to heparin
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
327
structure length
327
Chain Sequence
RDFTFDLYRALASAAPSQNIFFSPVSISMSLAMLSLGAGSSTKMQILEGLGLNLQKSSEKELHRGFQQLLQELNQPRDGFQLSLGNALFTDLVVDLQDTFVSAMKTLYLADTFPTNFRDSAGAMKQINDYVAKQTKGKIVDLLKNLDSNAVVIMVNYIFFKAKWETSFNHKGTQEQDFYVTSETVVRVPMMSREDQYHYLLDRNLSCRVVGVPYQGNATALFILPSEGKMQQVENGLSEKTLRKWLKMFKKRQLELYLPKFSIEGSYQLEKVLPSLGISNVFTSHADLSGISNHSNIQVSEMVHKAVVEVDESGTRAAAATGTIFTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The heparin binding site of protein C inhibitor is protease-dependent.
pubmed doi rcsb
molecule keywords N-terminus Plasma serine protease inhibitor
molecule tags Blood clotting, hydrolase inhibitor
source organism Homo sapiens
total genus 101
structure length 327
sequence length 327
ec nomenclature
pdb deposition date 2008-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.39.10 Mainly Beta Roll Alpha-1-antitrypsin; domain 1 Alpha-1-antitrypsin, domain 1 3dy0A02
3.30.497.10 Alpha Beta 2-Layer Sandwich Antithrombin; Chain I, domain 2 Antithrombin, subunit I, domain 2 3dy0A01
2WXXA 1DZGI 3F02A 4Y3KA 1DB2A 2OL2A 3DRUA 7APIA 2H4PA 1SEKA 1ATUA 2B4XL 4DTEA 3NDDA 1OVAA 2ANTI 1DVMA 2XN3A 2DUTA 2HIJI 4X30A 1JJOC 3CVMA 1XQGA 4AQHA 4ROBA 3F1SA 2RIVA 3EVJI 4C49A 4IF8A 1B3KA 2H4QA 4EB1L 1UHGA 1DZHL 1JTIA 1E03I 2H4RA 1BY7A 1JVQI 3OZQA 4P0FA 1OVAB 1JMOA 1C8OA 2VDYA 5CDZA 4P0OA 1OPHA 1OYHL 2RIWA 5IO1A 2WXYC 5INWA 2HI9A 2WXWA 4Y40A 1OO8A 2ARRA 3DLWA 3DY0A 2WY0C 3FGQA 1HLEA 1QLPA 2BEHL 3KCGI 8APIA 2WXZC 3VVJA 4DY7C 1LQ8A 2XN5A 5CE0A 4AJTA 1KCTA 3CAAA 3LE2A 9PAIA 1XU8A 3T1PA 4DY0A 4YIAA 1IZ2A 2D26A 1EZXA 1A7CA 1QMNA 1XQJA 4RSQA 1YXAA 1HP7A 2WXZA 1WZ9A 2VH4A 4AJUA 2B4XI 2XN6A 3ZHAA 1BR8I 4BB2A 1SR5A 1SNGA 3R4LA 1JMJA 4R9IA 1T1FA 4C41A 4PYWA 2VDXA 4ZK3A 1OC0A 1TB6I 4G8RA 1ANTI 1DZGL 4EB1I 1DZHI 1ATTA 1M93B 3STOA 3NDAA 4AFXA 1D5SA 4KDSA 3UT3A 1NQ9I 1LK6I 1F0CA 3CWLA 3NE4A 4IC0A 2OAYA 2HIJL 4AU3A 2ACHA 2R9YA 1OYHI 2WY1A 3H5CA 4G8OA 2PEEA 3CWMA 2B5TI 1R1LI 2ARQA 2CEOA 3DRMA 5HGCA 4CAAA 1PSIA 1QMBA 2BEHI 1E05I 3B9FI 1ATHA 1C5GA 1E04I 5CDXA 4GA7A 3PB1I 1DVNA 4ZK0A 2PEFA 3Q02A 1JRRA 3Q03A 3EOXA 4AU3B 2ZV6A 4ROAA 5EI0A 4RO9A 1LJ5A 5C98A 1AZXI 2QUGA 4AU4A 1K9OI 3LW2A 2V95A 1IMVA 1OVAC 3PZFA 1MTPA 4AU2A 1AS4A 2XN7A 5BRRI 2GD4C 2ZNHA 3F5NA 9APIA 3NDFA
chains in the Genus database with same CATH superfamily
2WXXA 1DZGI 3F02A 4Y3KA 1DB2A 2OL2A 3DRUA 7APIA 2H4PA 1SEKA 1ATUA 2B4XL 4DTEA 3NDDA 1OVAA 2ANTI 1DVMA 2XN3A 2DUTA 2HIJI 4X30A 1JJOC 3CVMA 1XQGA 4AQHA 4ROBA 3F1SA 2RIVA 3EVJI 4C49A 4IF8A 1B3KA 2H4QA 4EB1L 1UHGA 1DZHL 1JTIA 1E03I 2H4RA 1BY7A 1JVQI 3OZQA 4P0FA 1OVAB 1JMOA 1C8OA 2VDYA 5CDZA 4P0OA 1OPHA 1OYHL 2RIWA 5IO1A 2WXYC 5INWA 2HI9A 2WXWA 4Y40A 1OO8A 2ARRA 3DLWA 3DY0A 2WY0C 3FGQA 1HLEA 1QLPA 2BEHL 3KCGI 8APIA 2WXZC 3VVJA 4DY7C 1LQ8A 2XN5A 5CE0A 4AJTA 1KCTA 3CAAA 3LE2A 9PAIA 1XU8A 3T1PA 4DY0A 4YIAA 1IZ2A 2D26A 1EZXA 1A7CA 1QMNA 1XQJA 4RSQA 1YXAA 1HP7A 2WXZA 1WZ9A 2VH4A 4AJUA 2B4XI 2XN6A 3ZHAA 1BR8I 4BB2A 1SR5A 1SNGA 3R4LA 1JMJA 4R9IA 1T1FA 4C41A 4PYWA 2VDXA 4ZK3A 1OC0A 1TB6I 4G8RA 1ANTI 1DZGL 4EB1I 1DZHI 1ATTA 1M93B 3STOA 3NDAA 4AFXA 1D5SA 4KDSA 3UT3A 1NQ9I 1LK6I 1F0CA 3CWLA 3NE4A 4IC0A 2OAYA 2HIJL 4AU3A 2ACHA 2R9YA 1OYHI 2WY1A 3H5CA 4G8OA 2PEEA 3CWMA 2B5TI 1R1LI 2ARQA 2CEOA 3DRMA 5HGCA 4CAAA 1PSIA 1QMBA 2BEHI 1E05I 3B9FI 1ATHA 1C5GA 1E04I 5CDXA 4GA7A 3PB1I 1DVNA 4ZK0A 2PEFA 3Q02A 1JRRA 3Q03A 3EOXA 4AU3B 2ZV6A 4ROAA 5EI0A 4RO9A 1LJ5A 5C98A 1AZXI 2QUGA 4AU4A 1K9OI 3LW2A 2V95A 1IMVA 1OVAC 3PZFA 1MTPA 4AU2A 1AS4A 2XN7A 5BRRI 2GD4C 2ZNHA 3F5NA 9APIA 3NDFA
chains in the Genus database with same CATH topology
2WXXA 1DZGI 3F02A 4Y3KA 1DB2A 2OL2A 3DRUA 7APIA 2H4PA 1SEKA 1ATUA 2B4XL 4DTEA 3NDDA 1OVAA 2ANTI 1DVMA 2XN3A 2DUTA 2HIJI 4X30A 1JJOC 3CVMA 1XQGA 4AQHA 4ROBA 3F1SA 2RIVA 3EVJI 4C49A 4IF8A 1B3KA 2H4QA 4EB1L 1UHGA 1DZHL 1JTIA 1E03I 2H4RA 1BY7A 1JVQI 3OZQA 4P0FA 1OVAB 1JMOA 1C8OA 2VDYA 5CDZA 4P0OA 1OPHA 1OYHL 2RIWA 5IO1A 2WXYC 5INWA 2HI9A 2WXWA 4Y40A 1OO8A 2ARRA 3DLWA 3DY0A 2WY0C 3FGQA 1HLEA 1QLPA 2BEHL 3KCGI 8APIA 2WXZC 3VVJA 4DY7C 1LQ8A 2XN5A 5CE0A 4AJTA 1KCTA 3CAAA 3LE2A 9PAIA 1XU8A 3T1PA 4DY0A 4YIAA 1IZ2A 2D26A 1EZXA 1A7CA 1QMNA 1XQJA 4RSQA 1YXAA 1HP7A 2WXZA 1WZ9A 2VH4A 4AJUA 2B4XI 2XN6A 3ZHAA 1BR8I 4BB2A 1SR5A 1SNGA 3R4LA 1JMJA 4R9IA 1T1FA 4C41A 4PYWA 2VDXA 4ZK3A 1OC0A 1TB6I 4G8RA 1ANTI 1DZGL 4EB1I 1DZHI 1ATTA 1M93B 3STOA 3NDAA 4AFXA 1D5SA 4KDSA 3UT3A 1NQ9I 1LK6I 1F0CA 3CWLA 3NE4A 4IC0A 2OAYA 2HIJL 4AU3A 2ACHA 2R9YA 1OYHI 2WY1A 3H5CA 4G8OA 2PEEA 3CWMA 2B5TI 1R1LI 2ARQA 2CEOA 3DRMA 5HGCA 4CAAA 1PSIA 1QMBA 2BEHI 1E05I 3B9FI 1ATHA 1C5GA 1E04I 5CDXA 4GA7A 3PB1I 1DVNA 4ZK0A 2PEFA 3Q02A 1JRRA 3Q03A 3EOXA 4AU3B 2ZV6A 4ROAA 5EI0A 4RO9A 1LJ5A 5C98A 1AZXI 2QUGA 4AU4A 1K9OI 3LW2A 2V95A 1IMVA 1OVAC 3PZFA 1MTPA 4AU2A 1AS4A 2XN7A 5BRRI 2GD4C 2ZNHA 3F5NA 9APIA 3NDFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WXX A;  1DZG I;  3F02 A;  4Y3K A;  1DB2 A;  2OL2 A;  3DRU A;  7API A;  2H4P A;  1SEK A;  1ATU A;  2B4X L;  4DTE A;  3NDD A;  1OVA A;  2ANT I;  1DVM A;  2XN3 A;  2DUT A;  2HIJ I;  4X30 A;  1JJO C;  3CVM A;  1XQG A;  4AQH A;  4ROB A;  3F1S A;  2RIV A;  3EVJ I;  4C49 A;  4IF8 A;  1B3K A;  2H4Q A;  4EB1 L;  1UHG A;  1DZH L;  1JTI A;  1E03 I;  2H4R A;  1BY7 A;  1JVQ I;  3OZQ A;  4P0F A;  1OVA B;  1JMO A;  1C8O A;  2VDY A;  5CDZ A;  4P0O A;  1OPH A;  1OYH L;  2RIW A;  5IO1 A;  2WXY C;  5INW A;  2HI9 A;  2WXW A;  4Y40 A;  1OO8 A;  2ARR A;  3DLW A;  3DY0 A;  2WY0 C;  3FGQ A;  1HLE A;  1QLP A;  2BEH L;  3KCG I;  8API A;  2WXZ C;  3VVJ A;  4DY7 C;  1LQ8 A;  2XN5 A;  5CE0 A;  4AJT A;  1KCT A;  3CAA A;  3LE2 A;  9PAI A;  1XU8 A;  3T1P A;  4DY0 A;  4YIA A;  1IZ2 A;  2D26 A;  1EZX A;  1A7C A;  1QMN A;  1XQJ A;  4RSQ A;  1YXA A;  1HP7 A;  2WXZ A;  1WZ9 A;  2VH4 A;  4AJU A;  2B4X I;  2XN6 A;  3ZHA A;  1BR8 I;  4BB2 A;  1SR5 A;  1SNG A;  3R4L A;  1JMJ A;  4R9I A;  1T1F A;  4C41 A;  4PYW A;  2VDX A;  4ZK3 A;  1OC0 A;  1TB6 I;  4G8R A;  1ANT I;  1DZG L;  4EB1 I;  1DZH I;  1ATT A;  1M93 B;  3STO A;  3NDA A;  4AFX A;  1D5S A;  4KDS A;  3UT3 A;  1NQ9 I;  1LK6 I;  1F0C A;  3CWL A;  3NE4 A;  4IC0 A;  2OAY A;  2HIJ L;  4AU3 A;  2ACH A;  2R9Y A;  1OYH I;  2WY1 A;  3H5C A;  4G8O A;  2PEE A;  3CWM A;  2B5T I;  1R1L I;  2ARQ A;  2CEO A;  3DRM A;  5HGC A;  4CAA A;  1PSI A;  1QMB A;  2BEH I;  1E05 I;  3B9F I;  1ATH A;  1C5G A;  1E04 I;  5CDX A;  4GA7 A;  3PB1 I;  1DVN A;  4ZK0 A;  2PEF A;  3Q02 A;  1JRR A;  3Q03 A;  3EOX A;  4AU3 B;  2ZV6 A;  4ROA A;  5EI0 A;  4RO9 A;  1LJ5 A;  5C98 A;  1AZX I;  2QUG A;  4AU4 A;  1K9O I;  3LW2 A;  2V95 A;  1IMV A;  1OVA C;  3PZF A;  1MTP A;  4AU2 A;  1AS4 A;  2XN7 A;  5BRR I;  2GD4 C;  2ZNH A;  3F5N A;  9API A;  3NDF A; 
#chains in the Genus database with same CATH topology
 2WXX A;  1DZG I;  3F02 A;  4Y3K A;  1DB2 A;  2OL2 A;  3DRU A;  7API A;  2H4P A;  1SEK A;  1ATU A;  2B4X L;  4DTE A;  3NDD A;  1OVA A;  2ANT I;  1DVM A;  2XN3 A;  2DUT A;  2HIJ I;  4X30 A;  1JJO C;  3CVM A;  1XQG A;  4AQH A;  4ROB A;  3F1S A;  2RIV A;  3EVJ I;  4C49 A;  4IF8 A;  1B3K A;  2H4Q A;  4EB1 L;  1UHG A;  1DZH L;  1JTI A;  1E03 I;  2H4R A;  1BY7 A;  1JVQ I;  3OZQ A;  4P0F A;  1OVA B;  1JMO A;  1C8O A;  2VDY A;  5CDZ A;  4P0O A;  1OPH A;  1OYH L;  2RIW A;  5IO1 A;  2WXY C;  5INW A;  2HI9 A;  2WXW A;  4Y40 A;  1OO8 A;  2ARR A;  3DLW A;  3DY0 A;  2WY0 C;  3FGQ A;  1HLE A;  1QLP A;  2BEH L;  3KCG I;  8API A;  2WXZ C;  3VVJ A;  4DY7 C;  1LQ8 A;  2XN5 A;  5CE0 A;  4AJT A;  1KCT A;  3CAA A;  3LE2 A;  9PAI A;  1XU8 A;  3T1P A;  4DY0 A;  4YIA A;  1IZ2 A;  2D26 A;  1EZX A;  1A7C A;  1QMN A;  1XQJ A;  4RSQ A;  1YXA A;  1HP7 A;  2WXZ A;  1WZ9 A;  2VH4 A;  4AJU A;  2B4X I;  2XN6 A;  3ZHA A;  1BR8 I;  4BB2 A;  1SR5 A;  1SNG A;  3R4L A;  1JMJ A;  4R9I A;  1T1F A;  4C41 A;  4PYW A;  2VDX A;  4ZK3 A;  1OC0 A;  1TB6 I;  4G8R A;  1ANT I;  1DZG L;  4EB1 I;  1DZH I;  1ATT A;  1M93 B;  3STO A;  3NDA A;  4AFX A;  1D5S A;  4KDS A;  3UT3 A;  1NQ9 I;  1LK6 I;  1F0C A;  3CWL A;  3NE4 A;  4IC0 A;  2OAY A;  2HIJ L;  4AU3 A;  2ACH A;  2R9Y A;  1OYH I;  2WY1 A;  3H5C A;  4G8O A;  2PEE A;  3CWM A;  2B5T I;  1R1L I;  2ARQ A;  2CEO A;  3DRM A;  5HGC A;  4CAA A;  1PSI A;  1QMB A;  2BEH I;  1E05 I;  3B9F I;  1ATH A;  1C5G A;  1E04 I;  5CDX A;  4GA7 A;  3PB1 I;  1DVN A;  4ZK0 A;  2PEF A;  3Q02 A;  1JRR A;  3Q03 A;  3EOX A;  4AU3 B;  2ZV6 A;  4ROA A;  5EI0 A;  4RO9 A;  1LJ5 A;  5C98 A;  1AZX I;  2QUG A;  4AU4 A;  1K9O I;  3LW2 A;  2V95 A;  1IMV A;  1OVA C;  3PZF A;  1MTP A;  4AU2 A;  1AS4 A;  2XN7 A;  5BRR I;  2GD4 C;  2ZNH A;  3F5N A;  9API A;  3NDF A; 
#chains in the Genus database with same CATH homology
 2WXX A;  1DZG I;  3F02 A;  4Y3K A;  1DB2 A;  2OL2 A;  3DRU A;  7API A;  2H4P A;  1SEK A;  1ATU A;  2B4X L;  4DTE A;  3NDD A;  1OVA A;  2ANT I;  1DVM A;  2XN3 A;  2DUT A;  2HIJ I;  4X30 A;  1JJO C;  3CVM A;  1XQG A;  4AQH A;  4ROB A;  3F1S A;  2RIV A;  3EVJ I;  4C49 A;  4IF8 A;  1B3K A;  2H4Q A;  4EB1 L;  1UHG A;  1DZH L;  1JTI A;  1E03 I;  2H4R A;  1BY7 A;  1JVQ I;  3OZQ A;  4P0F A;  1OVA B;  1JMO A;  1C8O A;  2VDY A;  5CDZ A;  4P0O A;  1OPH A;  1OYH L;  2RIW A;  5IO1 A;  2WXY C;  5INW A;  2HI9 A;  2WXW A;  4Y40 A;  1OO8 A;  2ARR A;  3DLW A;  3DY0 A;  2WY0 C;  3FGQ A;  1HLE A;  1QLP A;  2BEH L;  3KCG I;  8API A;  2WXZ C;  3VVJ A;  4DY7 C;  1LQ8 A;  2XN5 A;  5CE0 A;  4AJT A;  1KCT A;  3CAA A;  3LE2 A;  9PAI A;  1XU8 A;  3T1P A;  4DY0 A;  4YIA A;  1IZ2 A;  2D26 A;  1EZX A;  1A7C A;  1QMN A;  1XQJ A;  4RSQ A;  1YXA A;  1HP7 A;  2WXZ A;  1WZ9 A;  2VH4 A;  4AJU A;  2B4X I;  2XN6 A;  3ZHA A;  1BR8 I;  4BB2 A;  1SR5 A;  1SNG A;  3R4L A;  1JMJ A;  4R9I A;  1T1F A;  4C41 A;  4PYW A;  2VDX A;  4ZK3 A;  1OC0 A;  1TB6 I;  4G8R A;  1ANT I;  1DZG L;  4EB1 I;  1DZH I;  1ATT A;  1M93 B;  3STO A;  3NDA A;  4AFX A;  1D5S A;  4KDS A;  3UT3 A;  1NQ9 I;  1LK6 I;  1F0C A;  3CWL A;  3NE4 A;  4IC0 A;  2OAY A;  2HIJ L;  4AU3 A;  2ACH A;  2R9Y A;  1OYH I;  2WY1 A;  3H5C A;  4G8O A;  2PEE A;  3CWM A;  2B5T I;  1R1L I;  2ARQ A;  2CEO A;  3DRM A;  5HGC A;  4CAA A;  1PSI A;  1QMB A;  2BEH I;  1E05 I;  3B9F I;  1ATH A;  1C5G A;  1E04 I;  5CDX A;  4GA7 A;  3PB1 I;  1DVN A;  4ZK0 A;  2PEF A;  3Q02 A;  1JRR A;  3Q03 A;  3EOX A;  4AU3 B;  2ZV6 A;  4ROA A;  5EI0 A;  4RO9 A;  1LJ5 A;  5C98 A;  1AZX I;  2QUG A;  4AU4 A;  1K9O I;  3LW2 A;  2V95 A;  1IMV A;  1OVA C;  3PZF A;  1MTP A;  4AU2 A;  1AS4 A;  2XN7 A;  5BRR I;  2GD4 C;  2ZNH A;  3F5N A;  9API A;  3NDF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...