4ZK3A

Psoriasis pathogenesis - pso p27 constitute a compact structure forming large aggregates. low ph structure
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
388
structure length
366
Chain Sequence
SLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Psoriasis pathogenesis - Pso p27 constitutes a compact structure forming large aggregates.
pubmed doi rcsb
molecule keywords Serpin B3
molecule tags Immune system
source organism Homo sapiens
total genus 112
structure length 366
sequence length 388
ec nomenclature
pdb deposition date 2015-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00079 Serpin Serpin (serine protease inhibitor)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.39.10 Mainly Beta Roll Alpha-1-antitrypsin; domain 1 Alpha-1-antitrypsin, domain 1 4zk3A02
3.30.497.10 Alpha Beta 2-Layer Sandwich Antithrombin; Chain I, domain 2 Antithrombin, subunit I, domain 2 4zk3A01
1AS4A 1ATHA 1QMNA 4C41A 5IO1A 1E03I 2XN5A 3DLWA 3CWLA 3DY0A 4ROAA 1SNGA 2GD4C 1XQGA 3PZFA 4ROBA 1OC0A 5C98A 1XQJA 7APIA 2WXWA 4AFXA 2H4PA 2WXZA 4ZK3A 3DRUA 2R9YA 1HLEA 5INWA 3F02A 1E04I 5BRRI 1BY7A 1YXAA 1JRRA 5CDXA 3R4LA 1SEKA 2VH4A 3ZHAA 1OYHI 1SR5A 2BEHL 3NDDA 2B5TI 3Q03A 5CE0A 1LK6I 4DY0A 3OZQA 2HIJL 2HI9A 4RSQA 1DVMA 2ANTI 1WZ9A 1AZXI 2CEOA 4IF8A 3NDAA 2DUTA 4AQHA 3FGQA 1IMVA 2WY1A 1HP7A 4AU2A 3F1SA 1ANTI 2ZV6A 3NDFA 1UHGA 4BB2A 2ZNHA 1QLPA 2ACHA 1DZGI 1NQ9I 3KCGI 3NE4A 2OL2A 4EB1I 1OYHL 1JMJA 3H5CA 4G8RA 1D5SA 1OPHA 4IC0A 4P0FA 4AJUA 1DVNA 2B4XL 1DZHI 3CVMA 2XN3A 2ARQA 2PEFA 4Y40A 3VVJA 5CDZA 3T1PA 3F5NA 4ZK0A 4DTEA 2XN6A 1B3KA 4P0OA 2VDYA 1R1LI 3PB1I 1ATTA 1A7CA 1QMBA 4GA7A 1DB2A 1OO8A 2RIWA 2WY0C 4PYWA 2RIVA 4AU4A 1BR8I 1OVAC 2H4RA 4YIAA 4DY7C 3CWMA 2QUGA 1C5GA 4KDSA 1JVQI 1TB6I 4X30A 9APIA 5HGCA 1OVAA 3LE2A 3UT3A 4AJTA 1DZHL 3Q02A 4G8OA 3EVJI 3B9FI 1EZXA 4AU3A 1PSIA 2ARRA 1XU8A 1JMOA 1JJOC 1C8OA 1KCTA 2HIJI 2WXZC 3LW2A 1IZ2A 4Y3KA 4R9IA 1K9OI 4RO9A 3EOXA 1LQ8A 2WXXA 1E05I 2D26A 3DRMA 1OVAB 1ATUA 9PAIA 1T1FA 5EI0A 1F0CA 1DZGL 1MTPA 4EB1L 4CAAA 2OAYA 4AU3B 2H4QA 1M93B 2B4XI 1JTIA 2PEEA 3STOA 8APIA 1LJ5A 2BEHI 2VDXA 2WXYC 3CAAA 2V95A 2XN7A 4C49A
chains in the Genus database with same CATH superfamily
1AS4A 1ATHA 1QMNA 4C41A 5IO1A 1E03I 2XN5A 3DLWA 3CWLA 3DY0A 4ROAA 1SNGA 2GD4C 1XQGA 3PZFA 4ROBA 1OC0A 5C98A 1XQJA 7APIA 2WXWA 4AFXA 2H4PA 2WXZA 4ZK3A 3DRUA 2R9YA 1HLEA 5INWA 3F02A 1E04I 5BRRI 1BY7A 1YXAA 1JRRA 5CDXA 3R4LA 1SEKA 2VH4A 3ZHAA 1OYHI 1SR5A 2BEHL 3NDDA 2B5TI 3Q03A 5CE0A 1LK6I 4DY0A 3OZQA 2HIJL 2HI9A 4RSQA 1DVMA 2ANTI 1WZ9A 1AZXI 2CEOA 4IF8A 3NDAA 2DUTA 4AQHA 3FGQA 1IMVA 2WY1A 1HP7A 4AU2A 3F1SA 1ANTI 2ZV6A 3NDFA 1UHGA 4BB2A 2ZNHA 1QLPA 2ACHA 1DZGI 1NQ9I 3KCGI 3NE4A 2OL2A 4EB1I 1OYHL 1JMJA 3H5CA 4G8RA 1D5SA 1OPHA 4IC0A 4P0FA 4AJUA 1DVNA 2B4XL 1DZHI 3CVMA 2XN3A 2ARQA 2PEFA 4Y40A 3VVJA 5CDZA 3T1PA 3F5NA 4ZK0A 4DTEA 2XN6A 1B3KA 4P0OA 2VDYA 1R1LI 3PB1I 1ATTA 1A7CA 1QMBA 4GA7A 1DB2A 1OO8A 2RIWA 2WY0C 4PYWA 2RIVA 4AU4A 1BR8I 1OVAC 2H4RA 4YIAA 4DY7C 3CWMA 2QUGA 1C5GA 4KDSA 1JVQI 1TB6I 4X30A 9APIA 5HGCA 1OVAA 3LE2A 3UT3A 4AJTA 1DZHL 3Q02A 4G8OA 3EVJI 3B9FI 1EZXA 4AU3A 1PSIA 2ARRA 1XU8A 1JMOA 1JJOC 1C8OA 1KCTA 2HIJI 2WXZC 3LW2A 1IZ2A 4Y3KA 4R9IA 1K9OI 4RO9A 3EOXA 1LQ8A 2WXXA 1E05I 2D26A 3DRMA 1OVAB 1ATUA 9PAIA 1T1FA 5EI0A 1F0CA 1DZGL 1MTPA 4EB1L 4CAAA 2OAYA 4AU3B 2H4QA 1M93B 2B4XI 1JTIA 2PEEA 3STOA 8APIA 1LJ5A 2BEHI 2VDXA 2WXYC 3CAAA 2V95A 2XN7A 4C49A
chains in the Genus database with same CATH topology
1AS4A 1ATHA 1QMNA 4C41A 5IO1A 1E03I 2XN5A 3DLWA 3CWLA 3DY0A 4ROAA 1SNGA 2GD4C 1XQGA 3PZFA 4ROBA 1OC0A 5C98A 1XQJA 7APIA 2WXWA 4AFXA 2H4PA 2WXZA 4ZK3A 3DRUA 2R9YA 1HLEA 5INWA 3F02A 1E04I 5BRRI 1BY7A 1YXAA 1JRRA 5CDXA 3R4LA 1SEKA 2VH4A 3ZHAA 1OYHI 1SR5A 2BEHL 3NDDA 2B5TI 3Q03A 5CE0A 1LK6I 4DY0A 3OZQA 2HIJL 2HI9A 4RSQA 1DVMA 2ANTI 1WZ9A 1AZXI 2CEOA 4IF8A 3NDAA 2DUTA 4AQHA 3FGQA 1IMVA 2WY1A 1HP7A 4AU2A 3F1SA 1ANTI 2ZV6A 3NDFA 1UHGA 4BB2A 2ZNHA 1QLPA 2ACHA 1DZGI 1NQ9I 3KCGI 3NE4A 2OL2A 4EB1I 1OYHL 1JMJA 3H5CA 4G8RA 1D5SA 1OPHA 4IC0A 4P0FA 4AJUA 1DVNA 2B4XL 1DZHI 3CVMA 2XN3A 2ARQA 2PEFA 4Y40A 3VVJA 5CDZA 3T1PA 3F5NA 4ZK0A 4DTEA 2XN6A 1B3KA 4P0OA 2VDYA 1R1LI 3PB1I 1ATTA 1A7CA 1QMBA 4GA7A 1DB2A 1OO8A 2RIWA 2WY0C 4PYWA 2RIVA 4AU4A 1BR8I 1OVAC 2H4RA 4YIAA 4DY7C 3CWMA 2QUGA 1C5GA 4KDSA 1JVQI 1TB6I 4X30A 9APIA 5HGCA 1OVAA 3LE2A 3UT3A 4AJTA 1DZHL 3Q02A 4G8OA 3EVJI 3B9FI 1EZXA 4AU3A 1PSIA 2ARRA 1XU8A 1JMOA 1JJOC 1C8OA 1KCTA 2HIJI 2WXZC 3LW2A 1IZ2A 4Y3KA 4R9IA 1K9OI 4RO9A 3EOXA 1LQ8A 2WXXA 1E05I 2D26A 3DRMA 1OVAB 1ATUA 9PAIA 1T1FA 5EI0A 1F0CA 1DZGL 1MTPA 4EB1L 4CAAA 2OAYA 4AU3B 2H4QA 1M93B 2B4XI 1JTIA 2PEEA 3STOA 8APIA 1LJ5A 2BEHI 2VDXA 2WXYC 3CAAA 2V95A 2XN7A 4C49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AS4 A;  1ATH A;  1QMN A;  4C41 A;  5IO1 A;  1E03 I;  2XN5 A;  3DLW A;  3CWL A;  3DY0 A;  4ROA A;  1SNG A;  2GD4 C;  1XQG A;  3PZF A;  4ROB A;  1OC0 A;  5C98 A;  1XQJ A;  7API A;  2WXW A;  4AFX A;  2H4P A;  2WXZ A;  4ZK3 A;  3DRU A;  2R9Y A;  1HLE A;  5INW A;  3F02 A;  1E04 I;  5BRR I;  1BY7 A;  1YXA A;  1JRR A;  5CDX A;  3R4L A;  1SEK A;  2VH4 A;  3ZHA A;  1OYH I;  1SR5 A;  2BEH L;  3NDD A;  2B5T I;  3Q03 A;  5CE0 A;  1LK6 I;  4DY0 A;  3OZQ A;  2HIJ L;  2HI9 A;  4RSQ A;  1DVM A;  2ANT I;  1WZ9 A;  1AZX I;  2CEO A;  4IF8 A;  3NDA A;  2DUT A;  4AQH A;  3FGQ A;  1IMV A;  2WY1 A;  1HP7 A;  4AU2 A;  3F1S A;  1ANT I;  2ZV6 A;  3NDF A;  1UHG A;  4BB2 A;  2ZNH A;  1QLP A;  2ACH A;  1DZG I;  1NQ9 I;  3KCG I;  3NE4 A;  2OL2 A;  4EB1 I;  1OYH L;  1JMJ A;  3H5C A;  4G8R A;  1D5S A;  1OPH A;  4IC0 A;  4P0F A;  4AJU A;  1DVN A;  2B4X L;  1DZH I;  3CVM A;  2XN3 A;  2ARQ A;  2PEF A;  4Y40 A;  3VVJ A;  5CDZ A;  3T1P A;  3F5N A;  4ZK0 A;  4DTE A;  2XN6 A;  1B3K A;  4P0O A;  2VDY A;  1R1L I;  3PB1 I;  1ATT A;  1A7C A;  1QMB A;  4GA7 A;  1DB2 A;  1OO8 A;  2RIW A;  2WY0 C;  4PYW A;  2RIV A;  4AU4 A;  1BR8 I;  1OVA C;  2H4R A;  4YIA A;  4DY7 C;  3CWM A;  2QUG A;  1C5G A;  4KDS A;  1JVQ I;  1TB6 I;  4X30 A;  9API A;  5HGC A;  1OVA A;  3LE2 A;  3UT3 A;  4AJT A;  1DZH L;  3Q02 A;  4G8O A;  3EVJ I;  3B9F I;  1EZX A;  4AU3 A;  1PSI A;  2ARR A;  1XU8 A;  1JMO A;  1JJO C;  1C8O A;  1KCT A;  2HIJ I;  2WXZ C;  3LW2 A;  1IZ2 A;  4Y3K A;  4R9I A;  1K9O I;  4RO9 A;  3EOX A;  1LQ8 A;  2WXX A;  1E05 I;  2D26 A;  3DRM A;  1OVA B;  1ATU A;  9PAI A;  1T1F A;  5EI0 A;  1F0C A;  1DZG L;  1MTP A;  4EB1 L;  4CAA A;  2OAY A;  4AU3 B;  2H4Q A;  1M93 B;  2B4X I;  1JTI A;  2PEE A;  3STO A;  8API A;  1LJ5 A;  2BEH I;  2VDX A;  2WXY C;  3CAA A;  2V95 A;  2XN7 A;  4C49 A; 
#chains in the Genus database with same CATH topology
 1AS4 A;  1ATH A;  1QMN A;  4C41 A;  5IO1 A;  1E03 I;  2XN5 A;  3DLW A;  3CWL A;  3DY0 A;  4ROA A;  1SNG A;  2GD4 C;  1XQG A;  3PZF A;  4ROB A;  1OC0 A;  5C98 A;  1XQJ A;  7API A;  2WXW A;  4AFX A;  2H4P A;  2WXZ A;  4ZK3 A;  3DRU A;  2R9Y A;  1HLE A;  5INW A;  3F02 A;  1E04 I;  5BRR I;  1BY7 A;  1YXA A;  1JRR A;  5CDX A;  3R4L A;  1SEK A;  2VH4 A;  3ZHA A;  1OYH I;  1SR5 A;  2BEH L;  3NDD A;  2B5T I;  3Q03 A;  5CE0 A;  1LK6 I;  4DY0 A;  3OZQ A;  2HIJ L;  2HI9 A;  4RSQ A;  1DVM A;  2ANT I;  1WZ9 A;  1AZX I;  2CEO A;  4IF8 A;  3NDA A;  2DUT A;  4AQH A;  3FGQ A;  1IMV A;  2WY1 A;  1HP7 A;  4AU2 A;  3F1S A;  1ANT I;  2ZV6 A;  3NDF A;  1UHG A;  4BB2 A;  2ZNH A;  1QLP A;  2ACH A;  1DZG I;  1NQ9 I;  3KCG I;  3NE4 A;  2OL2 A;  4EB1 I;  1OYH L;  1JMJ A;  3H5C A;  4G8R A;  1D5S A;  1OPH A;  4IC0 A;  4P0F A;  4AJU A;  1DVN A;  2B4X L;  1DZH I;  3CVM A;  2XN3 A;  2ARQ A;  2PEF A;  4Y40 A;  3VVJ A;  5CDZ A;  3T1P A;  3F5N A;  4ZK0 A;  4DTE A;  2XN6 A;  1B3K A;  4P0O A;  2VDY A;  1R1L I;  3PB1 I;  1ATT A;  1A7C A;  1QMB A;  4GA7 A;  1DB2 A;  1OO8 A;  2RIW A;  2WY0 C;  4PYW A;  2RIV A;  4AU4 A;  1BR8 I;  1OVA C;  2H4R A;  4YIA A;  4DY7 C;  3CWM A;  2QUG A;  1C5G A;  4KDS A;  1JVQ I;  1TB6 I;  4X30 A;  9API A;  5HGC A;  1OVA A;  3LE2 A;  3UT3 A;  4AJT A;  1DZH L;  3Q02 A;  4G8O A;  3EVJ I;  3B9F I;  1EZX A;  4AU3 A;  1PSI A;  2ARR A;  1XU8 A;  1JMO A;  1JJO C;  1C8O A;  1KCT A;  2HIJ I;  2WXZ C;  3LW2 A;  1IZ2 A;  4Y3K A;  4R9I A;  1K9O I;  4RO9 A;  3EOX A;  1LQ8 A;  2WXX A;  1E05 I;  2D26 A;  3DRM A;  1OVA B;  1ATU A;  9PAI A;  1T1F A;  5EI0 A;  1F0C A;  1DZG L;  1MTP A;  4EB1 L;  4CAA A;  2OAY A;  4AU3 B;  2H4Q A;  1M93 B;  2B4X I;  1JTI A;  2PEE A;  3STO A;  8API A;  1LJ5 A;  2BEH I;  2VDX A;  2WXY C;  3CAA A;  2V95 A;  2XN7 A;  4C49 A; 
#chains in the Genus database with same CATH homology
 1AS4 A;  1ATH A;  1QMN A;  4C41 A;  5IO1 A;  1E03 I;  2XN5 A;  3DLW A;  3CWL A;  3DY0 A;  4ROA A;  1SNG A;  2GD4 C;  1XQG A;  3PZF A;  4ROB A;  1OC0 A;  5C98 A;  1XQJ A;  7API A;  2WXW A;  4AFX A;  2H4P A;  2WXZ A;  4ZK3 A;  3DRU A;  2R9Y A;  1HLE A;  5INW A;  3F02 A;  1E04 I;  5BRR I;  1BY7 A;  1YXA A;  1JRR A;  5CDX A;  3R4L A;  1SEK A;  2VH4 A;  3ZHA A;  1OYH I;  1SR5 A;  2BEH L;  3NDD A;  2B5T I;  3Q03 A;  5CE0 A;  1LK6 I;  4DY0 A;  3OZQ A;  2HIJ L;  2HI9 A;  4RSQ A;  1DVM A;  2ANT I;  1WZ9 A;  1AZX I;  2CEO A;  4IF8 A;  3NDA A;  2DUT A;  4AQH A;  3FGQ A;  1IMV A;  2WY1 A;  1HP7 A;  4AU2 A;  3F1S A;  1ANT I;  2ZV6 A;  3NDF A;  1UHG A;  4BB2 A;  2ZNH A;  1QLP A;  2ACH A;  1DZG I;  1NQ9 I;  3KCG I;  3NE4 A;  2OL2 A;  4EB1 I;  1OYH L;  1JMJ A;  3H5C A;  4G8R A;  1D5S A;  1OPH A;  4IC0 A;  4P0F A;  4AJU A;  1DVN A;  2B4X L;  1DZH I;  3CVM A;  2XN3 A;  2ARQ A;  2PEF A;  4Y40 A;  3VVJ A;  5CDZ A;  3T1P A;  3F5N A;  4ZK0 A;  4DTE A;  2XN6 A;  1B3K A;  4P0O A;  2VDY A;  1R1L I;  3PB1 I;  1ATT A;  1A7C A;  1QMB A;  4GA7 A;  1DB2 A;  1OO8 A;  2RIW A;  2WY0 C;  4PYW A;  2RIV A;  4AU4 A;  1BR8 I;  1OVA C;  2H4R A;  4YIA A;  4DY7 C;  3CWM A;  2QUG A;  1C5G A;  4KDS A;  1JVQ I;  1TB6 I;  4X30 A;  9API A;  5HGC A;  1OVA A;  3LE2 A;  3UT3 A;  4AJT A;  1DZH L;  3Q02 A;  4G8O A;  3EVJ I;  3B9F I;  1EZX A;  4AU3 A;  1PSI A;  2ARR A;  1XU8 A;  1JMO A;  1JJO C;  1C8O A;  1KCT A;  2HIJ I;  2WXZ C;  3LW2 A;  1IZ2 A;  4Y3K A;  4R9I A;  1K9O I;  4RO9 A;  3EOX A;  1LQ8 A;  2WXX A;  1E05 I;  2D26 A;  3DRM A;  1OVA B;  1ATU A;  9PAI A;  1T1F A;  5EI0 A;  1F0C A;  1DZG L;  1MTP A;  4EB1 L;  4CAA A;  2OAY A;  4AU3 B;  2H4Q A;  1M93 B;  2B4X I;  1JTI A;  2PEE A;  3STO A;  8API A;  1LJ5 A;  2BEH I;  2VDX A;  2WXY C;  3CAA A;  2V95 A;  2XN7 A;  4C49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...