3DRMA

2.2 angstrom crystal structure of thr114phe alpha1-antitrypsin
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
370
structure length
362
Chain Sequence
NKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTFGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic and cellular characterisation of two mechanisms stabilising the native fold of alpha1-antitrypsin: implications for disease and drug design.
pubmed doi rcsb
molecule keywords Alpha-1-antitrypsin
molecule tags Hydrolase inhibitor
source organism Homo sapiens
total genus 100
structure length 362
sequence length 370
ec nomenclature
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00079 Serpin Serpin (serine protease inhibitor)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.39.10 Mainly Beta Roll Alpha-1-antitrypsin; domain 1 Alpha-1-antitrypsin, domain 1 3drmA02
3.30.497.10 Alpha Beta 2-Layer Sandwich Antithrombin; Chain I, domain 2 Antithrombin, subunit I, domain 2 3drmA01
3F5NA 2XN5A 4AFXA 3NDFA 1QMBA 1AZXI 2H4QA 2D26A 3EVJI 3T1PA 2B4XI 2B5TI 3Q02A 1IZ2A 1IMVA 2RIVA 4P0OA 1DZGI 4AQHA 1LQ8A 4C49A 3NDDA 3UT3A 2VH4A 1M93B 3KCGI 4RSQA 4AU3A 3ZHAA 2ANTI 1T1FA 3DRUA 1OYHL 1C8OA 1B3KA 2WXXA 1KCTA 4Y3KA 3FGQA 2RIWA 1ATHA 4PYWA 4AU4A 4DY0A 2PEFA 1UHGA 1LJ5A 1MTPA 1OC0A 1XU8A 2WY1A 2ARRA 1ANTI 4Y40A 1K9OI 4P0FA 2WY0C 3F02A 3CVMA 1D5SA 4G8OA 1DVNA 1YXAA 3Q03A 2V95A 4X30A 1EZXA 1JTIA 1QMNA 3DY0A 3PZFA 4IF8A 9APIA 8APIA 3OZQA 5INWA 2PEEA 1OVAB 1C5GA 7APIA 2HIJL 1E03I 1XQJA 2HI9A 4GA7A 2XN7A 1NQ9I 2DUTA 1HLEA 1WZ9A 3CWLA 1XQGA 2OL2A 2VDYA 2QUGA 5IO1A 1TB6I 1SR5A 4R9IA 1DZHI 1ATUA 4EB1I 3F1SA 4IC0A 4AU2A 1JMOA 3NE4A 3B9FI 9PAIA 1JRRA 2BEHL 1QLPA 2XN3A 2ZNHA 3DRMA 2OAYA 1SNGA 1HP7A 1LK6I 4AU3B 5CDXA 4ZK0A 3R4LA 2WXZC 1JVQI 2H4PA 4BB2A 1F0CA 1OPHA 3STOA 5C98A 5CE0A 4RO9A 1SEKA 1DB2A 2WXZA 4ROBA 2B4XL 2XN6A 2ACHA 4ZK3A 1E05I 2H4RA 1DZGL 5CDZA 1PSIA 2GD4C 1OYHI 3CWMA 3DLWA 4YIAA 4DTEA 1DVMA 5EI0A 1BR8I 3VVJA 1ATTA 1E04I 1OVAC 3PB1I 4AJUA 2ARQA 4C41A 1R1LI 1A7CA 1JJOC 2ZV6A 2BEHI 2WXYC 3CAAA 4DY7C 1DZHL 4KDSA 4CAAA 4AJTA 4EB1L 3LE2A 2CEOA 3LW2A 1OVAA 2VDXA 2WXWA 1BY7A 3H5CA 3NDAA 4G8RA 5HGCA 1AS4A 3EOXA 5BRRI 1JMJA 1OO8A 2R9YA 4ROAA 2HIJI
chains in the Genus database with same CATH superfamily
3F5NA 2XN5A 4AFXA 3NDFA 1QMBA 1AZXI 2H4QA 2D26A 3EVJI 3T1PA 2B4XI 2B5TI 3Q02A 1IZ2A 1IMVA 2RIVA 4P0OA 1DZGI 4AQHA 1LQ8A 4C49A 3NDDA 3UT3A 2VH4A 1M93B 3KCGI 4RSQA 4AU3A 3ZHAA 2ANTI 1T1FA 3DRUA 1OYHL 1C8OA 1B3KA 2WXXA 1KCTA 4Y3KA 3FGQA 2RIWA 1ATHA 4PYWA 4AU4A 4DY0A 2PEFA 1UHGA 1LJ5A 1MTPA 1OC0A 1XU8A 2WY1A 2ARRA 1ANTI 4Y40A 1K9OI 4P0FA 2WY0C 3F02A 3CVMA 1D5SA 4G8OA 1DVNA 1YXAA 3Q03A 2V95A 4X30A 1EZXA 1JTIA 1QMNA 3DY0A 3PZFA 4IF8A 9APIA 8APIA 3OZQA 5INWA 2PEEA 1OVAB 1C5GA 7APIA 2HIJL 1E03I 1XQJA 2HI9A 4GA7A 2XN7A 1NQ9I 2DUTA 1HLEA 1WZ9A 3CWLA 1XQGA 2OL2A 2VDYA 2QUGA 5IO1A 1TB6I 1SR5A 4R9IA 1DZHI 1ATUA 4EB1I 3F1SA 4IC0A 4AU2A 1JMOA 3NE4A 3B9FI 9PAIA 1JRRA 2BEHL 1QLPA 2XN3A 2ZNHA 3DRMA 2OAYA 1SNGA 1HP7A 1LK6I 4AU3B 5CDXA 4ZK0A 3R4LA 2WXZC 1JVQI 2H4PA 4BB2A 1F0CA 1OPHA 3STOA 5C98A 5CE0A 4RO9A 1SEKA 1DB2A 2WXZA 4ROBA 2B4XL 2XN6A 2ACHA 4ZK3A 1E05I 2H4RA 1DZGL 5CDZA 1PSIA 2GD4C 1OYHI 3CWMA 3DLWA 4YIAA 4DTEA 1DVMA 5EI0A 1BR8I 3VVJA 1ATTA 1E04I 1OVAC 3PB1I 4AJUA 2ARQA 4C41A 1R1LI 1A7CA 1JJOC 2ZV6A 2BEHI 2WXYC 3CAAA 4DY7C 1DZHL 4KDSA 4CAAA 4AJTA 4EB1L 3LE2A 2CEOA 3LW2A 1OVAA 2VDXA 2WXWA 1BY7A 3H5CA 3NDAA 4G8RA 5HGCA 1AS4A 3EOXA 5BRRI 1JMJA 1OO8A 2R9YA 4ROAA 2HIJI
chains in the Genus database with same CATH topology
3F5NA 2XN5A 4AFXA 3NDFA 1QMBA 1AZXI 2H4QA 2D26A 3EVJI 3T1PA 2B4XI 2B5TI 3Q02A 1IZ2A 1IMVA 2RIVA 4P0OA 1DZGI 4AQHA 1LQ8A 4C49A 3NDDA 3UT3A 2VH4A 1M93B 3KCGI 4RSQA 4AU3A 3ZHAA 2ANTI 1T1FA 3DRUA 1OYHL 1C8OA 1B3KA 2WXXA 1KCTA 4Y3KA 3FGQA 2RIWA 1ATHA 4PYWA 4AU4A 4DY0A 2PEFA 1UHGA 1LJ5A 1MTPA 1OC0A 1XU8A 2WY1A 2ARRA 1ANTI 4Y40A 1K9OI 4P0FA 2WY0C 3F02A 3CVMA 1D5SA 4G8OA 1DVNA 1YXAA 3Q03A 2V95A 4X30A 1EZXA 1JTIA 1QMNA 3DY0A 3PZFA 4IF8A 9APIA 8APIA 3OZQA 5INWA 2PEEA 1OVAB 1C5GA 7APIA 2HIJL 1E03I 1XQJA 2HI9A 4GA7A 2XN7A 1NQ9I 2DUTA 1HLEA 1WZ9A 3CWLA 1XQGA 2OL2A 2VDYA 2QUGA 5IO1A 1TB6I 1SR5A 4R9IA 1DZHI 1ATUA 4EB1I 3F1SA 4IC0A 4AU2A 1JMOA 3NE4A 3B9FI 9PAIA 1JRRA 2BEHL 1QLPA 2XN3A 2ZNHA 3DRMA 2OAYA 1SNGA 1HP7A 1LK6I 4AU3B 5CDXA 4ZK0A 3R4LA 2WXZC 1JVQI 2H4PA 4BB2A 1F0CA 1OPHA 3STOA 5C98A 5CE0A 4RO9A 1SEKA 1DB2A 2WXZA 4ROBA 2B4XL 2XN6A 2ACHA 4ZK3A 1E05I 2H4RA 1DZGL 5CDZA 1PSIA 2GD4C 1OYHI 3CWMA 3DLWA 4YIAA 4DTEA 1DVMA 5EI0A 1BR8I 3VVJA 1ATTA 1E04I 1OVAC 3PB1I 4AJUA 2ARQA 4C41A 1R1LI 1A7CA 1JJOC 2ZV6A 2BEHI 2WXYC 3CAAA 4DY7C 1DZHL 4KDSA 4CAAA 4AJTA 4EB1L 3LE2A 2CEOA 3LW2A 1OVAA 2VDXA 2WXWA 1BY7A 3H5CA 3NDAA 4G8RA 5HGCA 1AS4A 3EOXA 5BRRI 1JMJA 1OO8A 2R9YA 4ROAA 2HIJI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F5N A;  2XN5 A;  4AFX A;  3NDF A;  1QMB A;  1AZX I;  2H4Q A;  2D26 A;  3EVJ I;  3T1P A;  2B4X I;  2B5T I;  3Q02 A;  1IZ2 A;  1IMV A;  2RIV A;  4P0O A;  1DZG I;  4AQH A;  1LQ8 A;  4C49 A;  3NDD A;  3UT3 A;  2VH4 A;  1M93 B;  3KCG I;  4RSQ A;  4AU3 A;  3ZHA A;  2ANT I;  1T1F A;  3DRU A;  1OYH L;  1C8O A;  1B3K A;  2WXX A;  1KCT A;  4Y3K A;  3FGQ A;  2RIW A;  1ATH A;  4PYW A;  4AU4 A;  4DY0 A;  2PEF A;  1UHG A;  1LJ5 A;  1MTP A;  1OC0 A;  1XU8 A;  2WY1 A;  2ARR A;  1ANT I;  4Y40 A;  1K9O I;  4P0F A;  2WY0 C;  3F02 A;  3CVM A;  1D5S A;  4G8O A;  1DVN A;  1YXA A;  3Q03 A;  2V95 A;  4X30 A;  1EZX A;  1JTI A;  1QMN A;  3DY0 A;  3PZF A;  4IF8 A;  9API A;  8API A;  3OZQ A;  5INW A;  2PEE A;  1OVA B;  1C5G A;  7API A;  2HIJ L;  1E03 I;  1XQJ A;  2HI9 A;  4GA7 A;  2XN7 A;  1NQ9 I;  2DUT A;  1HLE A;  1WZ9 A;  3CWL A;  1XQG A;  2OL2 A;  2VDY A;  2QUG A;  5IO1 A;  1TB6 I;  1SR5 A;  4R9I A;  1DZH I;  1ATU A;  4EB1 I;  3F1S A;  4IC0 A;  4AU2 A;  1JMO A;  3NE4 A;  3B9F I;  9PAI A;  1JRR A;  2BEH L;  1QLP A;  2XN3 A;  2ZNH A;  3DRM A;  2OAY A;  1SNG A;  1HP7 A;  1LK6 I;  4AU3 B;  5CDX A;  4ZK0 A;  3R4L A;  2WXZ C;  1JVQ I;  2H4P A;  4BB2 A;  1F0C A;  1OPH A;  3STO A;  5C98 A;  5CE0 A;  4RO9 A;  1SEK A;  1DB2 A;  2WXZ A;  4ROB A;  2B4X L;  2XN6 A;  2ACH A;  4ZK3 A;  1E05 I;  2H4R A;  1DZG L;  5CDZ A;  1PSI A;  2GD4 C;  1OYH I;  3CWM A;  3DLW A;  4YIA A;  4DTE A;  1DVM A;  5EI0 A;  1BR8 I;  3VVJ A;  1ATT A;  1E04 I;  1OVA C;  3PB1 I;  4AJU A;  2ARQ A;  4C41 A;  1R1L I;  1A7C A;  1JJO C;  2ZV6 A;  2BEH I;  2WXY C;  3CAA A;  4DY7 C;  1DZH L;  4KDS A;  4CAA A;  4AJT A;  4EB1 L;  3LE2 A;  2CEO A;  3LW2 A;  1OVA A;  2VDX A;  2WXW A;  1BY7 A;  3H5C A;  3NDA A;  4G8R A;  5HGC A;  1AS4 A;  3EOX A;  5BRR I;  1JMJ A;  1OO8 A;  2R9Y A;  4ROA A;  2HIJ I; 
#chains in the Genus database with same CATH topology
 3F5N A;  2XN5 A;  4AFX A;  3NDF A;  1QMB A;  1AZX I;  2H4Q A;  2D26 A;  3EVJ I;  3T1P A;  2B4X I;  2B5T I;  3Q02 A;  1IZ2 A;  1IMV A;  2RIV A;  4P0O A;  1DZG I;  4AQH A;  1LQ8 A;  4C49 A;  3NDD A;  3UT3 A;  2VH4 A;  1M93 B;  3KCG I;  4RSQ A;  4AU3 A;  3ZHA A;  2ANT I;  1T1F A;  3DRU A;  1OYH L;  1C8O A;  1B3K A;  2WXX A;  1KCT A;  4Y3K A;  3FGQ A;  2RIW A;  1ATH A;  4PYW A;  4AU4 A;  4DY0 A;  2PEF A;  1UHG A;  1LJ5 A;  1MTP A;  1OC0 A;  1XU8 A;  2WY1 A;  2ARR A;  1ANT I;  4Y40 A;  1K9O I;  4P0F A;  2WY0 C;  3F02 A;  3CVM A;  1D5S A;  4G8O A;  1DVN A;  1YXA A;  3Q03 A;  2V95 A;  4X30 A;  1EZX A;  1JTI A;  1QMN A;  3DY0 A;  3PZF A;  4IF8 A;  9API A;  8API A;  3OZQ A;  5INW A;  2PEE A;  1OVA B;  1C5G A;  7API A;  2HIJ L;  1E03 I;  1XQJ A;  2HI9 A;  4GA7 A;  2XN7 A;  1NQ9 I;  2DUT A;  1HLE A;  1WZ9 A;  3CWL A;  1XQG A;  2OL2 A;  2VDY A;  2QUG A;  5IO1 A;  1TB6 I;  1SR5 A;  4R9I A;  1DZH I;  1ATU A;  4EB1 I;  3F1S A;  4IC0 A;  4AU2 A;  1JMO A;  3NE4 A;  3B9F I;  9PAI A;  1JRR A;  2BEH L;  1QLP A;  2XN3 A;  2ZNH A;  3DRM A;  2OAY A;  1SNG A;  1HP7 A;  1LK6 I;  4AU3 B;  5CDX A;  4ZK0 A;  3R4L A;  2WXZ C;  1JVQ I;  2H4P A;  4BB2 A;  1F0C A;  1OPH A;  3STO A;  5C98 A;  5CE0 A;  4RO9 A;  1SEK A;  1DB2 A;  2WXZ A;  4ROB A;  2B4X L;  2XN6 A;  2ACH A;  4ZK3 A;  1E05 I;  2H4R A;  1DZG L;  5CDZ A;  1PSI A;  2GD4 C;  1OYH I;  3CWM A;  3DLW A;  4YIA A;  4DTE A;  1DVM A;  5EI0 A;  1BR8 I;  3VVJ A;  1ATT A;  1E04 I;  1OVA C;  3PB1 I;  4AJU A;  2ARQ A;  4C41 A;  1R1L I;  1A7C A;  1JJO C;  2ZV6 A;  2BEH I;  2WXY C;  3CAA A;  4DY7 C;  1DZH L;  4KDS A;  4CAA A;  4AJT A;  4EB1 L;  3LE2 A;  2CEO A;  3LW2 A;  1OVA A;  2VDX A;  2WXW A;  1BY7 A;  3H5C A;  3NDA A;  4G8R A;  5HGC A;  1AS4 A;  3EOX A;  5BRR I;  1JMJ A;  1OO8 A;  2R9Y A;  4ROA A;  2HIJ I; 
#chains in the Genus database with same CATH homology
 3F5N A;  2XN5 A;  4AFX A;  3NDF A;  1QMB A;  1AZX I;  2H4Q A;  2D26 A;  3EVJ I;  3T1P A;  2B4X I;  2B5T I;  3Q02 A;  1IZ2 A;  1IMV A;  2RIV A;  4P0O A;  1DZG I;  4AQH A;  1LQ8 A;  4C49 A;  3NDD A;  3UT3 A;  2VH4 A;  1M93 B;  3KCG I;  4RSQ A;  4AU3 A;  3ZHA A;  2ANT I;  1T1F A;  3DRU A;  1OYH L;  1C8O A;  1B3K A;  2WXX A;  1KCT A;  4Y3K A;  3FGQ A;  2RIW A;  1ATH A;  4PYW A;  4AU4 A;  4DY0 A;  2PEF A;  1UHG A;  1LJ5 A;  1MTP A;  1OC0 A;  1XU8 A;  2WY1 A;  2ARR A;  1ANT I;  4Y40 A;  1K9O I;  4P0F A;  2WY0 C;  3F02 A;  3CVM A;  1D5S A;  4G8O A;  1DVN A;  1YXA A;  3Q03 A;  2V95 A;  4X30 A;  1EZX A;  1JTI A;  1QMN A;  3DY0 A;  3PZF A;  4IF8 A;  9API A;  8API A;  3OZQ A;  5INW A;  2PEE A;  1OVA B;  1C5G A;  7API A;  2HIJ L;  1E03 I;  1XQJ A;  2HI9 A;  4GA7 A;  2XN7 A;  1NQ9 I;  2DUT A;  1HLE A;  1WZ9 A;  3CWL A;  1XQG A;  2OL2 A;  2VDY A;  2QUG A;  5IO1 A;  1TB6 I;  1SR5 A;  4R9I A;  1DZH I;  1ATU A;  4EB1 I;  3F1S A;  4IC0 A;  4AU2 A;  1JMO A;  3NE4 A;  3B9F I;  9PAI A;  1JRR A;  2BEH L;  1QLP A;  2XN3 A;  2ZNH A;  3DRM A;  2OAY A;  1SNG A;  1HP7 A;  1LK6 I;  4AU3 B;  5CDX A;  4ZK0 A;  3R4L A;  2WXZ C;  1JVQ I;  2H4P A;  4BB2 A;  1F0C A;  1OPH A;  3STO A;  5C98 A;  5CE0 A;  4RO9 A;  1SEK A;  1DB2 A;  2WXZ A;  4ROB A;  2B4X L;  2XN6 A;  2ACH A;  4ZK3 A;  1E05 I;  2H4R A;  1DZG L;  5CDZ A;  1PSI A;  2GD4 C;  1OYH I;  3CWM A;  3DLW A;  4YIA A;  4DTE A;  1DVM A;  5EI0 A;  1BR8 I;  3VVJ A;  1ATT A;  1E04 I;  1OVA C;  3PB1 I;  4AJU A;  2ARQ A;  4C41 A;  1R1L I;  1A7C A;  1JJO C;  2ZV6 A;  2BEH I;  2WXY C;  3CAA A;  4DY7 C;  1DZH L;  4KDS A;  4CAA A;  4AJT A;  4EB1 L;  3LE2 A;  2CEO A;  3LW2 A;  1OVA A;  2VDX A;  2WXW A;  1BY7 A;  3H5C A;  3NDA A;  4G8R A;  5HGC A;  1AS4 A;  3EOX A;  5BRR I;  1JMJ A;  1OO8 A;  2R9Y A;  4ROA A;  2HIJ I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...