3CWLA

Crystal structure of alpha-1-antitrypsin, crystal form b
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
372
structure length
371
Chain Sequence
FNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Preventing serpin aggregation: The molecular mechanism of citrate action upon antitrypsin unfolding.
pubmed doi rcsb
molecule keywords Alpha-1-antitrypsin
molecule tags Protease inhibitor
source organism Homo sapiens
total genus 109
structure length 371
sequence length 372
ec nomenclature
pdb deposition date 2008-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00079 Serpin Serpin (serine protease inhibitor)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.39.10 Mainly Beta Roll Alpha-1-antitrypsin; domain 1 Alpha-1-antitrypsin, domain 1 3cwlA02
3.30.497.10 Alpha Beta 2-Layer Sandwich Antithrombin; Chain I, domain 2 Antithrombin, subunit I, domain 2 3cwlA01
2B4XL 4R9IA 1XQGA 3STOA 2RIWA 4AU3A 4ZK0A 4RSQA 2ZNHA 4Y40A 9APIA 2B4XI 9PAIA 1ATHA 1OPHA 2BEHL 2WXZC 1JMOA 1OC0A 4G8OA 1SNGA 2WXZA 1AS4A 2DUTA 1HLEA 1C8OA 4G8RA 1DZHL 1R1LI 4ROBA 2HI9A 4EB1L 1EZXA 1LQ8A 1OYHL 4AU4A 1D5SA 4KDSA 1DZHI 1JVQI 3F5NA 3T1PA 1E05I 1OYHI 1K9OI 1XQJA 5CDXA 2RIVA 3OZQA 3R4LA 4RO9A 4AU3B 2XN7A 4CAAA 1DB2A 1YXAA 1C5GA 3CVMA 2VH4A 4P0OA 2H4PA 3PB1I 1JMJA 5CDZA 1QLPA 1ANTI 1M93B 2WXWA 3DRUA 4C49A 5C98A 1AZXI 1A7CA 1BY7A 1JTIA 3EVJI 4AQHA 1JRRA 3DRMA 3FGQA 1SEKA 1F0CA 4P0FA 4Y3KA 2WY1A 2R9YA 3EOXA 2WXYC 3DLWA 2OAYA 4BB2A 5CE0A 1LJ5A 2HIJI 1OVAC 3NDAA 3CAAA 3VVJA 2H4QA 3KCGI 3DY0A 2WY0C 4C41A 1OVAA 1OVAB 2B5TI 3Q02A 4IF8A 2ARRA 1B3KA 3CWLA 4ZK3A 4ROAA 1IZ2A 1SR5A 1E04I 4DY7C 4DTEA 2V95A 2XN5A 4AJTA 3NDFA 1OO8A 2ANTI 4IC0A 2VDXA 8APIA 1IMVA 1ATTA 2PEFA 1KCTA 4X30A 1DVMA 1BR8I 2ARQA 1LK6I 4GA7A 2HIJL 5HGCA 1MTPA 3B9FI 1HP7A 1UHGA 3UT3A 2OL2A 3ZHAA 2CEOA 2PEEA 1ATUA 1E03I 1DVNA 4YIAA 1QMBA 1XU8A 2ZV6A 3LE2A 1WZ9A 2H4RA 2XN6A 5BRRI 7APIA 1DZGL 2VDYA 3H5CA 3LW2A 3NE4A 2BEHI 1NQ9I 1PSIA 4AU2A 1DZGI 2ACHA 1T1FA 2QUGA 3Q03A 4AJUA 4DY0A 1JJOC 3F02A 1QMNA 3F1SA 1TB6I 2GD4C 4EB1I 5IO1A 2D26A 2WXXA 3NDDA 3PZFA 5EI0A 4PYWA 5INWA 4AFXA 2XN3A 3CWMA
chains in the Genus database with same CATH superfamily
2B4XL 4R9IA 1XQGA 3STOA 2RIWA 4AU3A 4ZK0A 4RSQA 2ZNHA 4Y40A 9APIA 2B4XI 9PAIA 1ATHA 1OPHA 2BEHL 2WXZC 1JMOA 1OC0A 4G8OA 1SNGA 2WXZA 1AS4A 2DUTA 1HLEA 1C8OA 4G8RA 1DZHL 1R1LI 4ROBA 2HI9A 4EB1L 1EZXA 1LQ8A 1OYHL 4AU4A 1D5SA 4KDSA 1DZHI 1JVQI 3F5NA 3T1PA 1E05I 1OYHI 1K9OI 1XQJA 5CDXA 2RIVA 3OZQA 3R4LA 4RO9A 4AU3B 2XN7A 4CAAA 1DB2A 1YXAA 1C5GA 3CVMA 2VH4A 4P0OA 2H4PA 3PB1I 1JMJA 5CDZA 1QLPA 1ANTI 1M93B 2WXWA 3DRUA 4C49A 5C98A 1AZXI 1A7CA 1BY7A 1JTIA 3EVJI 4AQHA 1JRRA 3DRMA 3FGQA 1SEKA 1F0CA 4P0FA 4Y3KA 2WY1A 2R9YA 3EOXA 2WXYC 3DLWA 2OAYA 4BB2A 5CE0A 1LJ5A 2HIJI 1OVAC 3NDAA 3CAAA 3VVJA 2H4QA 3KCGI 3DY0A 2WY0C 4C41A 1OVAA 1OVAB 2B5TI 3Q02A 4IF8A 2ARRA 1B3KA 3CWLA 4ZK3A 4ROAA 1IZ2A 1SR5A 1E04I 4DY7C 4DTEA 2V95A 2XN5A 4AJTA 3NDFA 1OO8A 2ANTI 4IC0A 2VDXA 8APIA 1IMVA 1ATTA 2PEFA 1KCTA 4X30A 1DVMA 1BR8I 2ARQA 1LK6I 4GA7A 2HIJL 5HGCA 1MTPA 3B9FI 1HP7A 1UHGA 3UT3A 2OL2A 3ZHAA 2CEOA 2PEEA 1ATUA 1E03I 1DVNA 4YIAA 1QMBA 1XU8A 2ZV6A 3LE2A 1WZ9A 2H4RA 2XN6A 5BRRI 7APIA 1DZGL 2VDYA 3H5CA 3LW2A 3NE4A 2BEHI 1NQ9I 1PSIA 4AU2A 1DZGI 2ACHA 1T1FA 2QUGA 3Q03A 4AJUA 4DY0A 1JJOC 3F02A 1QMNA 3F1SA 1TB6I 2GD4C 4EB1I 5IO1A 2D26A 2WXXA 3NDDA 3PZFA 5EI0A 4PYWA 5INWA 4AFXA 2XN3A 3CWMA
chains in the Genus database with same CATH topology
2B4XL 4R9IA 1XQGA 3STOA 2RIWA 4AU3A 4ZK0A 4RSQA 2ZNHA 4Y40A 9APIA 2B4XI 9PAIA 1ATHA 1OPHA 2BEHL 2WXZC 1JMOA 1OC0A 4G8OA 1SNGA 2WXZA 1AS4A 2DUTA 1HLEA 1C8OA 4G8RA 1DZHL 1R1LI 4ROBA 2HI9A 4EB1L 1EZXA 1LQ8A 1OYHL 4AU4A 1D5SA 4KDSA 1DZHI 1JVQI 3F5NA 3T1PA 1E05I 1OYHI 1K9OI 1XQJA 5CDXA 2RIVA 3OZQA 3R4LA 4RO9A 4AU3B 2XN7A 4CAAA 1DB2A 1YXAA 1C5GA 3CVMA 2VH4A 4P0OA 2H4PA 3PB1I 1JMJA 5CDZA 1QLPA 1ANTI 1M93B 2WXWA 3DRUA 4C49A 5C98A 1AZXI 1A7CA 1BY7A 1JTIA 3EVJI 4AQHA 1JRRA 3DRMA 3FGQA 1SEKA 1F0CA 4P0FA 4Y3KA 2WY1A 2R9YA 3EOXA 2WXYC 3DLWA 2OAYA 4BB2A 5CE0A 1LJ5A 2HIJI 1OVAC 3NDAA 3CAAA 3VVJA 2H4QA 3KCGI 3DY0A 2WY0C 4C41A 1OVAA 1OVAB 2B5TI 3Q02A 4IF8A 2ARRA 1B3KA 3CWLA 4ZK3A 4ROAA 1IZ2A 1SR5A 1E04I 4DY7C 4DTEA 2V95A 2XN5A 4AJTA 3NDFA 1OO8A 2ANTI 4IC0A 2VDXA 8APIA 1IMVA 1ATTA 2PEFA 1KCTA 4X30A 1DVMA 1BR8I 2ARQA 1LK6I 4GA7A 2HIJL 5HGCA 1MTPA 3B9FI 1HP7A 1UHGA 3UT3A 2OL2A 3ZHAA 2CEOA 2PEEA 1ATUA 1E03I 1DVNA 4YIAA 1QMBA 1XU8A 2ZV6A 3LE2A 1WZ9A 2H4RA 2XN6A 5BRRI 7APIA 1DZGL 2VDYA 3H5CA 3LW2A 3NE4A 2BEHI 1NQ9I 1PSIA 4AU2A 1DZGI 2ACHA 1T1FA 2QUGA 3Q03A 4AJUA 4DY0A 1JJOC 3F02A 1QMNA 3F1SA 1TB6I 2GD4C 4EB1I 5IO1A 2D26A 2WXXA 3NDDA 3PZFA 5EI0A 4PYWA 5INWA 4AFXA 2XN3A 3CWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B4X L;  4R9I A;  1XQG A;  3STO A;  2RIW A;  4AU3 A;  4ZK0 A;  4RSQ A;  2ZNH A;  4Y40 A;  9API A;  2B4X I;  9PAI A;  1ATH A;  1OPH A;  2BEH L;  2WXZ C;  1JMO A;  1OC0 A;  4G8O A;  1SNG A;  2WXZ A;  1AS4 A;  2DUT A;  1HLE A;  1C8O A;  4G8R A;  1DZH L;  1R1L I;  4ROB A;  2HI9 A;  4EB1 L;  1EZX A;  1LQ8 A;  1OYH L;  4AU4 A;  1D5S A;  4KDS A;  1DZH I;  1JVQ I;  3F5N A;  3T1P A;  1E05 I;  1OYH I;  1K9O I;  1XQJ A;  5CDX A;  2RIV A;  3OZQ A;  3R4L A;  4RO9 A;  4AU3 B;  2XN7 A;  4CAA A;  1DB2 A;  1YXA A;  1C5G A;  3CVM A;  2VH4 A;  4P0O A;  2H4P A;  3PB1 I;  1JMJ A;  5CDZ A;  1QLP A;  1ANT I;  1M93 B;  2WXW A;  3DRU A;  4C49 A;  5C98 A;  1AZX I;  1A7C A;  1BY7 A;  1JTI A;  3EVJ I;  4AQH A;  1JRR A;  3DRM A;  3FGQ A;  1SEK A;  1F0C A;  4P0F A;  4Y3K A;  2WY1 A;  2R9Y A;  3EOX A;  2WXY C;  3DLW A;  2OAY A;  4BB2 A;  5CE0 A;  1LJ5 A;  2HIJ I;  1OVA C;  3NDA A;  3CAA A;  3VVJ A;  2H4Q A;  3KCG I;  3DY0 A;  2WY0 C;  4C41 A;  1OVA A;  1OVA B;  2B5T I;  3Q02 A;  4IF8 A;  2ARR A;  1B3K A;  3CWL A;  4ZK3 A;  4ROA A;  1IZ2 A;  1SR5 A;  1E04 I;  4DY7 C;  4DTE A;  2V95 A;  2XN5 A;  4AJT A;  3NDF A;  1OO8 A;  2ANT I;  4IC0 A;  2VDX A;  8API A;  1IMV A;  1ATT A;  2PEF A;  1KCT A;  4X30 A;  1DVM A;  1BR8 I;  2ARQ A;  1LK6 I;  4GA7 A;  2HIJ L;  5HGC A;  1MTP A;  3B9F I;  1HP7 A;  1UHG A;  3UT3 A;  2OL2 A;  3ZHA A;  2CEO A;  2PEE A;  1ATU A;  1E03 I;  1DVN A;  4YIA A;  1QMB A;  1XU8 A;  2ZV6 A;  3LE2 A;  1WZ9 A;  2H4R A;  2XN6 A;  5BRR I;  7API A;  1DZG L;  2VDY A;  3H5C A;  3LW2 A;  3NE4 A;  2BEH I;  1NQ9 I;  1PSI A;  4AU2 A;  1DZG I;  2ACH A;  1T1F A;  2QUG A;  3Q03 A;  4AJU A;  4DY0 A;  1JJO C;  3F02 A;  1QMN A;  3F1S A;  1TB6 I;  2GD4 C;  4EB1 I;  5IO1 A;  2D26 A;  2WXX A;  3NDD A;  3PZF A;  5EI0 A;  4PYW A;  5INW A;  4AFX A;  2XN3 A;  3CWM A; 
#chains in the Genus database with same CATH topology
 2B4X L;  4R9I A;  1XQG A;  3STO A;  2RIW A;  4AU3 A;  4ZK0 A;  4RSQ A;  2ZNH A;  4Y40 A;  9API A;  2B4X I;  9PAI A;  1ATH A;  1OPH A;  2BEH L;  2WXZ C;  1JMO A;  1OC0 A;  4G8O A;  1SNG A;  2WXZ A;  1AS4 A;  2DUT A;  1HLE A;  1C8O A;  4G8R A;  1DZH L;  1R1L I;  4ROB A;  2HI9 A;  4EB1 L;  1EZX A;  1LQ8 A;  1OYH L;  4AU4 A;  1D5S A;  4KDS A;  1DZH I;  1JVQ I;  3F5N A;  3T1P A;  1E05 I;  1OYH I;  1K9O I;  1XQJ A;  5CDX A;  2RIV A;  3OZQ A;  3R4L A;  4RO9 A;  4AU3 B;  2XN7 A;  4CAA A;  1DB2 A;  1YXA A;  1C5G A;  3CVM A;  2VH4 A;  4P0O A;  2H4P A;  3PB1 I;  1JMJ A;  5CDZ A;  1QLP A;  1ANT I;  1M93 B;  2WXW A;  3DRU A;  4C49 A;  5C98 A;  1AZX I;  1A7C A;  1BY7 A;  1JTI A;  3EVJ I;  4AQH A;  1JRR A;  3DRM A;  3FGQ A;  1SEK A;  1F0C A;  4P0F A;  4Y3K A;  2WY1 A;  2R9Y A;  3EOX A;  2WXY C;  3DLW A;  2OAY A;  4BB2 A;  5CE0 A;  1LJ5 A;  2HIJ I;  1OVA C;  3NDA A;  3CAA A;  3VVJ A;  2H4Q A;  3KCG I;  3DY0 A;  2WY0 C;  4C41 A;  1OVA A;  1OVA B;  2B5T I;  3Q02 A;  4IF8 A;  2ARR A;  1B3K A;  3CWL A;  4ZK3 A;  4ROA A;  1IZ2 A;  1SR5 A;  1E04 I;  4DY7 C;  4DTE A;  2V95 A;  2XN5 A;  4AJT A;  3NDF A;  1OO8 A;  2ANT I;  4IC0 A;  2VDX A;  8API A;  1IMV A;  1ATT A;  2PEF A;  1KCT A;  4X30 A;  1DVM A;  1BR8 I;  2ARQ A;  1LK6 I;  4GA7 A;  2HIJ L;  5HGC A;  1MTP A;  3B9F I;  1HP7 A;  1UHG A;  3UT3 A;  2OL2 A;  3ZHA A;  2CEO A;  2PEE A;  1ATU A;  1E03 I;  1DVN A;  4YIA A;  1QMB A;  1XU8 A;  2ZV6 A;  3LE2 A;  1WZ9 A;  2H4R A;  2XN6 A;  5BRR I;  7API A;  1DZG L;  2VDY A;  3H5C A;  3LW2 A;  3NE4 A;  2BEH I;  1NQ9 I;  1PSI A;  4AU2 A;  1DZG I;  2ACH A;  1T1F A;  2QUG A;  3Q03 A;  4AJU A;  4DY0 A;  1JJO C;  3F02 A;  1QMN A;  3F1S A;  1TB6 I;  2GD4 C;  4EB1 I;  5IO1 A;  2D26 A;  2WXX A;  3NDD A;  3PZF A;  5EI0 A;  4PYW A;  5INW A;  4AFX A;  2XN3 A;  3CWM A; 
#chains in the Genus database with same CATH homology
 2B4X L;  4R9I A;  1XQG A;  3STO A;  2RIW A;  4AU3 A;  4ZK0 A;  4RSQ A;  2ZNH A;  4Y40 A;  9API A;  2B4X I;  9PAI A;  1ATH A;  1OPH A;  2BEH L;  2WXZ C;  1JMO A;  1OC0 A;  4G8O A;  1SNG A;  2WXZ A;  1AS4 A;  2DUT A;  1HLE A;  1C8O A;  4G8R A;  1DZH L;  1R1L I;  4ROB A;  2HI9 A;  4EB1 L;  1EZX A;  1LQ8 A;  1OYH L;  4AU4 A;  1D5S A;  4KDS A;  1DZH I;  1JVQ I;  3F5N A;  3T1P A;  1E05 I;  1OYH I;  1K9O I;  1XQJ A;  5CDX A;  2RIV A;  3OZQ A;  3R4L A;  4RO9 A;  4AU3 B;  2XN7 A;  4CAA A;  1DB2 A;  1YXA A;  1C5G A;  3CVM A;  2VH4 A;  4P0O A;  2H4P A;  3PB1 I;  1JMJ A;  5CDZ A;  1QLP A;  1ANT I;  1M93 B;  2WXW A;  3DRU A;  4C49 A;  5C98 A;  1AZX I;  1A7C A;  1BY7 A;  1JTI A;  3EVJ I;  4AQH A;  1JRR A;  3DRM A;  3FGQ A;  1SEK A;  1F0C A;  4P0F A;  4Y3K A;  2WY1 A;  2R9Y A;  3EOX A;  2WXY C;  3DLW A;  2OAY A;  4BB2 A;  5CE0 A;  1LJ5 A;  2HIJ I;  1OVA C;  3NDA A;  3CAA A;  3VVJ A;  2H4Q A;  3KCG I;  3DY0 A;  2WY0 C;  4C41 A;  1OVA A;  1OVA B;  2B5T I;  3Q02 A;  4IF8 A;  2ARR A;  1B3K A;  3CWL A;  4ZK3 A;  4ROA A;  1IZ2 A;  1SR5 A;  1E04 I;  4DY7 C;  4DTE A;  2V95 A;  2XN5 A;  4AJT A;  3NDF A;  1OO8 A;  2ANT I;  4IC0 A;  2VDX A;  8API A;  1IMV A;  1ATT A;  2PEF A;  1KCT A;  4X30 A;  1DVM A;  1BR8 I;  2ARQ A;  1LK6 I;  4GA7 A;  2HIJ L;  5HGC A;  1MTP A;  3B9F I;  1HP7 A;  1UHG A;  3UT3 A;  2OL2 A;  3ZHA A;  2CEO A;  2PEE A;  1ATU A;  1E03 I;  1DVN A;  4YIA A;  1QMB A;  1XU8 A;  2ZV6 A;  3LE2 A;  1WZ9 A;  2H4R A;  2XN6 A;  5BRR I;  7API A;  1DZG L;  2VDY A;  3H5C A;  3LW2 A;  3NE4 A;  2BEH I;  1NQ9 I;  1PSI A;  4AU2 A;  1DZG I;  2ACH A;  1T1F A;  2QUG A;  3Q03 A;  4AJU A;  4DY0 A;  1JJO C;  3F02 A;  1QMN A;  3F1S A;  1TB6 I;  2GD4 C;  4EB1 I;  5IO1 A;  2D26 A;  2WXX A;  3NDD A;  3PZF A;  5EI0 A;  4PYW A;  5INW A;  4AFX A;  2XN3 A;  3CWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...