4Y3KA

Structure of vaspin mutant e379s
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
380
structure length
367
Chain Sequence
EVQGWKQRMAAKELARQNMDLGFKLLKKLAFYNPGRNIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLHEGFHYIIHELTQKTQDLKLSIGNTLFIDQRLQPQRKFLEDAKNFYSAETILTNFQNLEMAQKQINDFISQKTHGKINNLIENIDPGTVMLLANYIFFRARWKHEFDPNVTKEEDFFLEKNSSVKVPMMFRSGIYQVGYDDKLSCTILEIPYQKNITAIFILPDEGKLKHLEKGLQVDTFSRWKTLLSRRVVDVSVPRLHMTGTFDLKKTLSYIGVSKIFEEHGDLTKIAPHRSLKVGEAVHKAELKMDERGTEGPLVVKIDKPYLLLIYSEKIPSVLFLGKIVNPIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A unique serpin P1' glutamate and a conserved beta-sheet C arginine are key residues for activity, protease recognition and stability of serpinA12 (vaspin).
pubmed doi rcsb
molecule keywords Serpin A12
molecule tags Hydrolase inhibitor
source organism Homo sapiens
total genus 113
structure length 367
sequence length 380
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00079 Serpin Serpin (serine protease inhibitor)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.39.10 Mainly Beta Roll Alpha-1-antitrypsin; domain 1 Alpha-1-antitrypsin, domain 1 4y3kA02
3.30.497.10 Alpha Beta 2-Layer Sandwich Antithrombin; Chain I, domain 2 Antithrombin, subunit I, domain 2 4y3kA01
4AJTA 5CE0A 3F5NA 2WXZC 1PSIA 3FGQA 9PAIA 1DVMA 3F02A 4GA7A 3EVJI 4P0OA 1OPHA 4AU3A 1EZXA 1KCTA 1ANTI 2ARQA 2VDXA 4RO9A 1BR8I 1C5GA 1DZGL 4YIAA 1JMOA 3LE2A 2RIVA 1D5SA 2CEOA 4KDSA 3STOA 4Y3KA 4EB1L 3DLWA 5BRRI 1DVNA 1XQGA 2WXWA 2R9YA 1LJ5A 1F0CA 3F1SA 4AFXA 3DRMA 1OO8A 1ATUA 2WXXA 1HP7A 3H5CA 3VVJA 1OYHL 3Q03A 1OVAA 1SEKA 4G8OA 3UT3A 1UHGA 4RSQA 1B3KA 2VDYA 3CWLA 2WXZA 1BY7A 1QMNA 3CVMA 1OC0A 4AQHA 4PYWA 1R1LI 4C49A 5EI0A 4R9IA 1IZ2A 1JTIA 3CAAA 3DY0A 4IF8A 2RIWA 2GD4C 2BEHI 3PZFA 4X30A 2WY0C 1JMJA 1DZHI 4ROBA 2PEEA 2XN6A 2ARRA 5CDZA 1QLPA 1E03I 1QMBA 3R4LA 1JJOC 2ACHA 3NDFA 2HIJI 2ANTI 1LK6I 1XU8A 1LQ8A 1HLEA 2OL2A 2B4XI 1JRRA 3NDDA 4AJUA 4AU3B 3CWMA 4CAAA 1XQJA 1AS4A 2B5TI 9APIA 2WXYC 2D26A 2DUTA 3NDAA 5CDXA 4DTEA 4C41A 3Q02A 1K9OI 1AZXI 2PEFA 4IC0A 2H4RA 1TB6I 5INWA 2HI9A 4AU4A 4ZK3A 3PB1I 3B9FI 2ZV6A 4BB2A 2QUGA 4Y40A 2XN5A 2XN7A 3DRUA 4ROAA 1JVQI 3OZQA 1NQ9I 4AU2A 3T1PA 1DZGI 1M93B 1WZ9A 2BEHL 1OVAB 1YXAA 2OAYA 1DZHL 2WY1A 2ZNHA 3ZHAA 5IO1A 4EB1I 4DY7C 1ATHA 8APIA 5C98A 5HGCA 2H4QA 3KCGI 2HIJL 1ATTA 1MTPA 1SNGA 2B4XL 2XN3A 3EOXA 2H4PA 1DB2A 4G8RA 1C8OA 1OYHI 1E04I 3LW2A 2VH4A 4P0FA 4ZK0A 2V95A 1OVAC 4DY0A 7APIA 1IMVA 1E05I 1SR5A 1T1FA 3NE4A 1A7CA
chains in the Genus database with same CATH superfamily
4AJTA 5CE0A 3F5NA 2WXZC 1PSIA 3FGQA 9PAIA 1DVMA 3F02A 4GA7A 3EVJI 4P0OA 1OPHA 4AU3A 1EZXA 1KCTA 1ANTI 2ARQA 2VDXA 4RO9A 1BR8I 1C5GA 1DZGL 4YIAA 1JMOA 3LE2A 2RIVA 1D5SA 2CEOA 4KDSA 3STOA 4Y3KA 4EB1L 3DLWA 5BRRI 1DVNA 1XQGA 2WXWA 2R9YA 1LJ5A 1F0CA 3F1SA 4AFXA 3DRMA 1OO8A 1ATUA 2WXXA 1HP7A 3H5CA 3VVJA 1OYHL 3Q03A 1OVAA 1SEKA 4G8OA 3UT3A 1UHGA 4RSQA 1B3KA 2VDYA 3CWLA 2WXZA 1BY7A 1QMNA 3CVMA 1OC0A 4AQHA 4PYWA 1R1LI 4C49A 5EI0A 4R9IA 1IZ2A 1JTIA 3CAAA 3DY0A 4IF8A 2RIWA 2GD4C 2BEHI 3PZFA 4X30A 2WY0C 1JMJA 1DZHI 4ROBA 2PEEA 2XN6A 2ARRA 5CDZA 1QLPA 1E03I 1QMBA 3R4LA 1JJOC 2ACHA 3NDFA 2HIJI 2ANTI 1LK6I 1XU8A 1LQ8A 1HLEA 2OL2A 2B4XI 1JRRA 3NDDA 4AJUA 4AU3B 3CWMA 4CAAA 1XQJA 1AS4A 2B5TI 9APIA 2WXYC 2D26A 2DUTA 3NDAA 5CDXA 4DTEA 4C41A 3Q02A 1K9OI 1AZXI 2PEFA 4IC0A 2H4RA 1TB6I 5INWA 2HI9A 4AU4A 4ZK3A 3PB1I 3B9FI 2ZV6A 4BB2A 2QUGA 4Y40A 2XN5A 2XN7A 3DRUA 4ROAA 1JVQI 3OZQA 1NQ9I 4AU2A 3T1PA 1DZGI 1M93B 1WZ9A 2BEHL 1OVAB 1YXAA 2OAYA 1DZHL 2WY1A 2ZNHA 3ZHAA 5IO1A 4EB1I 4DY7C 1ATHA 8APIA 5C98A 5HGCA 2H4QA 3KCGI 2HIJL 1ATTA 1MTPA 1SNGA 2B4XL 2XN3A 3EOXA 2H4PA 1DB2A 4G8RA 1C8OA 1OYHI 1E04I 3LW2A 2VH4A 4P0FA 4ZK0A 2V95A 1OVAC 4DY0A 7APIA 1IMVA 1E05I 1SR5A 1T1FA 3NE4A 1A7CA
chains in the Genus database with same CATH topology
4AJTA 5CE0A 3F5NA 2WXZC 1PSIA 3FGQA 9PAIA 1DVMA 3F02A 4GA7A 3EVJI 4P0OA 1OPHA 4AU3A 1EZXA 1KCTA 1ANTI 2ARQA 2VDXA 4RO9A 1BR8I 1C5GA 1DZGL 4YIAA 1JMOA 3LE2A 2RIVA 1D5SA 2CEOA 4KDSA 3STOA 4Y3KA 4EB1L 3DLWA 5BRRI 1DVNA 1XQGA 2WXWA 2R9YA 1LJ5A 1F0CA 3F1SA 4AFXA 3DRMA 1OO8A 1ATUA 2WXXA 1HP7A 3H5CA 3VVJA 1OYHL 3Q03A 1OVAA 1SEKA 4G8OA 3UT3A 1UHGA 4RSQA 1B3KA 2VDYA 3CWLA 2WXZA 1BY7A 1QMNA 3CVMA 1OC0A 4AQHA 4PYWA 1R1LI 4C49A 5EI0A 4R9IA 1IZ2A 1JTIA 3CAAA 3DY0A 4IF8A 2RIWA 2GD4C 2BEHI 3PZFA 4X30A 2WY0C 1JMJA 1DZHI 4ROBA 2PEEA 2XN6A 2ARRA 5CDZA 1QLPA 1E03I 1QMBA 3R4LA 1JJOC 2ACHA 3NDFA 2HIJI 2ANTI 1LK6I 1XU8A 1LQ8A 1HLEA 2OL2A 2B4XI 1JRRA 3NDDA 4AJUA 4AU3B 3CWMA 4CAAA 1XQJA 1AS4A 2B5TI 9APIA 2WXYC 2D26A 2DUTA 3NDAA 5CDXA 4DTEA 4C41A 3Q02A 1K9OI 1AZXI 2PEFA 4IC0A 2H4RA 1TB6I 5INWA 2HI9A 4AU4A 4ZK3A 3PB1I 3B9FI 2ZV6A 4BB2A 2QUGA 4Y40A 2XN5A 2XN7A 3DRUA 4ROAA 1JVQI 3OZQA 1NQ9I 4AU2A 3T1PA 1DZGI 1M93B 1WZ9A 2BEHL 1OVAB 1YXAA 2OAYA 1DZHL 2WY1A 2ZNHA 3ZHAA 5IO1A 4EB1I 4DY7C 1ATHA 8APIA 5C98A 5HGCA 2H4QA 3KCGI 2HIJL 1ATTA 1MTPA 1SNGA 2B4XL 2XN3A 3EOXA 2H4PA 1DB2A 4G8RA 1C8OA 1OYHI 1E04I 3LW2A 2VH4A 4P0FA 4ZK0A 2V95A 1OVAC 4DY0A 7APIA 1IMVA 1E05I 1SR5A 1T1FA 3NE4A 1A7CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AJT A;  5CE0 A;  3F5N A;  2WXZ C;  1PSI A;  3FGQ A;  9PAI A;  1DVM A;  3F02 A;  4GA7 A;  3EVJ I;  4P0O A;  1OPH A;  4AU3 A;  1EZX A;  1KCT A;  1ANT I;  2ARQ A;  2VDX A;  4RO9 A;  1BR8 I;  1C5G A;  1DZG L;  4YIA A;  1JMO A;  3LE2 A;  2RIV A;  1D5S A;  2CEO A;  4KDS A;  3STO A;  4Y3K A;  4EB1 L;  3DLW A;  5BRR I;  1DVN A;  1XQG A;  2WXW A;  2R9Y A;  1LJ5 A;  1F0C A;  3F1S A;  4AFX A;  3DRM A;  1OO8 A;  1ATU A;  2WXX A;  1HP7 A;  3H5C A;  3VVJ A;  1OYH L;  3Q03 A;  1OVA A;  1SEK A;  4G8O A;  3UT3 A;  1UHG A;  4RSQ A;  1B3K A;  2VDY A;  3CWL A;  2WXZ A;  1BY7 A;  1QMN A;  3CVM A;  1OC0 A;  4AQH A;  4PYW A;  1R1L I;  4C49 A;  5EI0 A;  4R9I A;  1IZ2 A;  1JTI A;  3CAA A;  3DY0 A;  4IF8 A;  2RIW A;  2GD4 C;  2BEH I;  3PZF A;  4X30 A;  2WY0 C;  1JMJ A;  1DZH I;  4ROB A;  2PEE A;  2XN6 A;  2ARR A;  5CDZ A;  1QLP A;  1E03 I;  1QMB A;  3R4L A;  1JJO C;  2ACH A;  3NDF A;  2HIJ I;  2ANT I;  1LK6 I;  1XU8 A;  1LQ8 A;  1HLE A;  2OL2 A;  2B4X I;  1JRR A;  3NDD A;  4AJU A;  4AU3 B;  3CWM A;  4CAA A;  1XQJ A;  1AS4 A;  2B5T I;  9API A;  2WXY C;  2D26 A;  2DUT A;  3NDA A;  5CDX A;  4DTE A;  4C41 A;  3Q02 A;  1K9O I;  1AZX I;  2PEF A;  4IC0 A;  2H4R A;  1TB6 I;  5INW A;  2HI9 A;  4AU4 A;  4ZK3 A;  3PB1 I;  3B9F I;  2ZV6 A;  4BB2 A;  2QUG A;  4Y40 A;  2XN5 A;  2XN7 A;  3DRU A;  4ROA A;  1JVQ I;  3OZQ A;  1NQ9 I;  4AU2 A;  3T1P A;  1DZG I;  1M93 B;  1WZ9 A;  2BEH L;  1OVA B;  1YXA A;  2OAY A;  1DZH L;  2WY1 A;  2ZNH A;  3ZHA A;  5IO1 A;  4EB1 I;  4DY7 C;  1ATH A;  8API A;  5C98 A;  5HGC A;  2H4Q A;  3KCG I;  2HIJ L;  1ATT A;  1MTP A;  1SNG A;  2B4X L;  2XN3 A;  3EOX A;  2H4P A;  1DB2 A;  4G8R A;  1C8O A;  1OYH I;  1E04 I;  3LW2 A;  2VH4 A;  4P0F A;  4ZK0 A;  2V95 A;  1OVA C;  4DY0 A;  7API A;  1IMV A;  1E05 I;  1SR5 A;  1T1F A;  3NE4 A;  1A7C A; 
#chains in the Genus database with same CATH topology
 4AJT A;  5CE0 A;  3F5N A;  2WXZ C;  1PSI A;  3FGQ A;  9PAI A;  1DVM A;  3F02 A;  4GA7 A;  3EVJ I;  4P0O A;  1OPH A;  4AU3 A;  1EZX A;  1KCT A;  1ANT I;  2ARQ A;  2VDX A;  4RO9 A;  1BR8 I;  1C5G A;  1DZG L;  4YIA A;  1JMO A;  3LE2 A;  2RIV A;  1D5S A;  2CEO A;  4KDS A;  3STO A;  4Y3K A;  4EB1 L;  3DLW A;  5BRR I;  1DVN A;  1XQG A;  2WXW A;  2R9Y A;  1LJ5 A;  1F0C A;  3F1S A;  4AFX A;  3DRM A;  1OO8 A;  1ATU A;  2WXX A;  1HP7 A;  3H5C A;  3VVJ A;  1OYH L;  3Q03 A;  1OVA A;  1SEK A;  4G8O A;  3UT3 A;  1UHG A;  4RSQ A;  1B3K A;  2VDY A;  3CWL A;  2WXZ A;  1BY7 A;  1QMN A;  3CVM A;  1OC0 A;  4AQH A;  4PYW A;  1R1L I;  4C49 A;  5EI0 A;  4R9I A;  1IZ2 A;  1JTI A;  3CAA A;  3DY0 A;  4IF8 A;  2RIW A;  2GD4 C;  2BEH I;  3PZF A;  4X30 A;  2WY0 C;  1JMJ A;  1DZH I;  4ROB A;  2PEE A;  2XN6 A;  2ARR A;  5CDZ A;  1QLP A;  1E03 I;  1QMB A;  3R4L A;  1JJO C;  2ACH A;  3NDF A;  2HIJ I;  2ANT I;  1LK6 I;  1XU8 A;  1LQ8 A;  1HLE A;  2OL2 A;  2B4X I;  1JRR A;  3NDD A;  4AJU A;  4AU3 B;  3CWM A;  4CAA A;  1XQJ A;  1AS4 A;  2B5T I;  9API A;  2WXY C;  2D26 A;  2DUT A;  3NDA A;  5CDX A;  4DTE A;  4C41 A;  3Q02 A;  1K9O I;  1AZX I;  2PEF A;  4IC0 A;  2H4R A;  1TB6 I;  5INW A;  2HI9 A;  4AU4 A;  4ZK3 A;  3PB1 I;  3B9F I;  2ZV6 A;  4BB2 A;  2QUG A;  4Y40 A;  2XN5 A;  2XN7 A;  3DRU A;  4ROA A;  1JVQ I;  3OZQ A;  1NQ9 I;  4AU2 A;  3T1P A;  1DZG I;  1M93 B;  1WZ9 A;  2BEH L;  1OVA B;  1YXA A;  2OAY A;  1DZH L;  2WY1 A;  2ZNH A;  3ZHA A;  5IO1 A;  4EB1 I;  4DY7 C;  1ATH A;  8API A;  5C98 A;  5HGC A;  2H4Q A;  3KCG I;  2HIJ L;  1ATT A;  1MTP A;  1SNG A;  2B4X L;  2XN3 A;  3EOX A;  2H4P A;  1DB2 A;  4G8R A;  1C8O A;  1OYH I;  1E04 I;  3LW2 A;  2VH4 A;  4P0F A;  4ZK0 A;  2V95 A;  1OVA C;  4DY0 A;  7API A;  1IMV A;  1E05 I;  1SR5 A;  1T1F A;  3NE4 A;  1A7C A; 
#chains in the Genus database with same CATH homology
 4AJT A;  5CE0 A;  3F5N A;  2WXZ C;  1PSI A;  3FGQ A;  9PAI A;  1DVM A;  3F02 A;  4GA7 A;  3EVJ I;  4P0O A;  1OPH A;  4AU3 A;  1EZX A;  1KCT A;  1ANT I;  2ARQ A;  2VDX A;  4RO9 A;  1BR8 I;  1C5G A;  1DZG L;  4YIA A;  1JMO A;  3LE2 A;  2RIV A;  1D5S A;  2CEO A;  4KDS A;  3STO A;  4Y3K A;  4EB1 L;  3DLW A;  5BRR I;  1DVN A;  1XQG A;  2WXW A;  2R9Y A;  1LJ5 A;  1F0C A;  3F1S A;  4AFX A;  3DRM A;  1OO8 A;  1ATU A;  2WXX A;  1HP7 A;  3H5C A;  3VVJ A;  1OYH L;  3Q03 A;  1OVA A;  1SEK A;  4G8O A;  3UT3 A;  1UHG A;  4RSQ A;  1B3K A;  2VDY A;  3CWL A;  2WXZ A;  1BY7 A;  1QMN A;  3CVM A;  1OC0 A;  4AQH A;  4PYW A;  1R1L I;  4C49 A;  5EI0 A;  4R9I A;  1IZ2 A;  1JTI A;  3CAA A;  3DY0 A;  4IF8 A;  2RIW A;  2GD4 C;  2BEH I;  3PZF A;  4X30 A;  2WY0 C;  1JMJ A;  1DZH I;  4ROB A;  2PEE A;  2XN6 A;  2ARR A;  5CDZ A;  1QLP A;  1E03 I;  1QMB A;  3R4L A;  1JJO C;  2ACH A;  3NDF A;  2HIJ I;  2ANT I;  1LK6 I;  1XU8 A;  1LQ8 A;  1HLE A;  2OL2 A;  2B4X I;  1JRR A;  3NDD A;  4AJU A;  4AU3 B;  3CWM A;  4CAA A;  1XQJ A;  1AS4 A;  2B5T I;  9API A;  2WXY C;  2D26 A;  2DUT A;  3NDA A;  5CDX A;  4DTE A;  4C41 A;  3Q02 A;  1K9O I;  1AZX I;  2PEF A;  4IC0 A;  2H4R A;  1TB6 I;  5INW A;  2HI9 A;  4AU4 A;  4ZK3 A;  3PB1 I;  3B9F I;  2ZV6 A;  4BB2 A;  2QUG A;  4Y40 A;  2XN5 A;  2XN7 A;  3DRU A;  4ROA A;  1JVQ I;  3OZQ A;  1NQ9 I;  4AU2 A;  3T1P A;  1DZG I;  1M93 B;  1WZ9 A;  2BEH L;  1OVA B;  1YXA A;  2OAY A;  1DZH L;  2WY1 A;  2ZNH A;  3ZHA A;  5IO1 A;  4EB1 I;  4DY7 C;  1ATH A;  8API A;  5C98 A;  5HGC A;  2H4Q A;  3KCG I;  2HIJ L;  1ATT A;  1MTP A;  1SNG A;  2B4X L;  2XN3 A;  3EOX A;  2H4P A;  1DB2 A;  4G8R A;  1C8O A;  1OYH I;  1E04 I;  3LW2 A;  2VH4 A;  4P0F A;  4ZK0 A;  2V95 A;  1OVA C;  4DY0 A;  7API A;  1IMV A;  1E05 I;  1SR5 A;  1T1F A;  3NE4 A;  1A7C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...