3NDFA

Cleaved antitrypsin with p8-p6 asp
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
336
structure length
336
Chain Sequence
FNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHAKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGADDDEAIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Loop-sheet mechanism of serpin polymerization tested by reactive center loop mutations
pubmed doi rcsb
molecule keywords Alpha-1-antitrypsin
molecule tags Hydrolase inhibitor
source organism Homo sapiens
total genus 89
structure length 336
sequence length 336
ec nomenclature
pdb deposition date 2010-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.39.10 Mainly Beta Roll Alpha-1-antitrypsin; domain 1 Alpha-1-antitrypsin, domain 1 3ndfA02
3.30.497.10 Alpha Beta 2-Layer Sandwich Antithrombin; Chain I, domain 2 Antithrombin, subunit I, domain 2 3ndfA01
1JRRA 2HI9A 2R9YA 5INWA 5BRRI 2PEFA 3VVJA 4AU2A 1E03I 4AU4A 4AU3B 1AZXI 1R1LI 4PYWA 1DZHL 3F1SA 1D5SA 2WXZC 2CEOA 3H5CA 2WXZA 3EVJI 5HGCA 3F5NA 2BEHI 1K9OI 1OYHI 4RO9A 1QMBA 2B4XI 4IF8A 1JVQI 1T1FA 1DZGI 4ROAA 4Y3KA 3T1PA 2VDXA 5EI0A 1QMNA 2ACHA 1C5GA 1OO8A 2XN7A 4AJTA 3B9FI 2H4QA 1HLEA 1OPHA 2WY0C 3OZQA 1JMOA 2XN5A 3CWLA 3DLWA 3LW2A 1BR8I 1E04I 1YXAA 1NQ9I 1PSIA 3CAAA 1ATHA 3DRMA 2GD4C 3DY0A 1DVNA 4P0OA 8APIA 1SNGA 2ARQA 4C41A 4RSQA 4EB1L 2B5TI 3STOA 4BB2A 5CDXA 7APIA 1AS4A 2VDYA 2OAYA 2V95A 2ANTI 1HP7A 4X30A 2BEHL 1DVMA 1QLPA 1LQ8A 3Q03A 4AFXA 3LE2A 1DB2A 1DZGL 1F0CA 4G8RA 4AQHA 1OC0A 2WXYC 2VH4A 1C8OA 1MTPA 3ZHAA 2WXWA 4G8OA 1OVAC 4ZK3A 1OVAA 1SR5A 3UT3A 3F02A 2D26A 1JTIA 9APIA 3Q02A 4YIAA 1OVAB 1XU8A 4DY0A 1IZ2A 2XN6A 3CVMA 3NDAA 4ROBA 2RIVA 2H4PA 2ZNHA 3NE4A 1BY7A 1IMVA 3FGQA 1ATTA 1OYHL 1KCTA 4IC0A 4AJUA 2B4XL 2H4RA 4C49A 4CAAA 1UHGA 2RIWA 3PB1I 4DY7C 2HIJI 3PZFA 1ANTI 1LJ5A 1WZ9A 2OL2A 1EZXA 2QUGA 2ARRA 3CWMA 4ZK0A 5CDZA 4GA7A 2WY1A 4KDSA 3R4LA 9PAIA 4EB1I 1DZHI 2ZV6A 1SEKA 2WXXA 3NDFA 3KCGI 4R9IA 1ATUA 4DTEA 4P0FA 1TB6I 2XN3A 1JMJA 1LK6I 1M93B 5CE0A 1XQGA 2DUTA 1A7CA 1E05I 2PEEA 1XQJA 4Y40A 3NDDA 5IO1A 3EOXA 2HIJL 1B3KA 3DRUA 1JJOC 5C98A 4AU3A
chains in the Genus database with same CATH superfamily
1JRRA 2HI9A 2R9YA 5INWA 5BRRI 2PEFA 3VVJA 4AU2A 1E03I 4AU4A 4AU3B 1AZXI 1R1LI 4PYWA 1DZHL 3F1SA 1D5SA 2WXZC 2CEOA 3H5CA 2WXZA 3EVJI 5HGCA 3F5NA 2BEHI 1K9OI 1OYHI 4RO9A 1QMBA 2B4XI 4IF8A 1JVQI 1T1FA 1DZGI 4ROAA 4Y3KA 3T1PA 2VDXA 5EI0A 1QMNA 2ACHA 1C5GA 1OO8A 2XN7A 4AJTA 3B9FI 2H4QA 1HLEA 1OPHA 2WY0C 3OZQA 1JMOA 2XN5A 3CWLA 3DLWA 3LW2A 1BR8I 1E04I 1YXAA 1NQ9I 1PSIA 3CAAA 1ATHA 3DRMA 2GD4C 3DY0A 1DVNA 4P0OA 8APIA 1SNGA 2ARQA 4C41A 4RSQA 4EB1L 2B5TI 3STOA 4BB2A 5CDXA 7APIA 1AS4A 2VDYA 2OAYA 2V95A 2ANTI 1HP7A 4X30A 2BEHL 1DVMA 1QLPA 1LQ8A 3Q03A 4AFXA 3LE2A 1DB2A 1DZGL 1F0CA 4G8RA 4AQHA 1OC0A 2WXYC 2VH4A 1C8OA 1MTPA 3ZHAA 2WXWA 4G8OA 1OVAC 4ZK3A 1OVAA 1SR5A 3UT3A 3F02A 2D26A 1JTIA 9APIA 3Q02A 4YIAA 1OVAB 1XU8A 4DY0A 1IZ2A 2XN6A 3CVMA 3NDAA 4ROBA 2RIVA 2H4PA 2ZNHA 3NE4A 1BY7A 1IMVA 3FGQA 1ATTA 1OYHL 1KCTA 4IC0A 4AJUA 2B4XL 2H4RA 4C49A 4CAAA 1UHGA 2RIWA 3PB1I 4DY7C 2HIJI 3PZFA 1ANTI 1LJ5A 1WZ9A 2OL2A 1EZXA 2QUGA 2ARRA 3CWMA 4ZK0A 5CDZA 4GA7A 2WY1A 4KDSA 3R4LA 9PAIA 4EB1I 1DZHI 2ZV6A 1SEKA 2WXXA 3NDFA 3KCGI 4R9IA 1ATUA 4DTEA 4P0FA 1TB6I 2XN3A 1JMJA 1LK6I 1M93B 5CE0A 1XQGA 2DUTA 1A7CA 1E05I 2PEEA 1XQJA 4Y40A 3NDDA 5IO1A 3EOXA 2HIJL 1B3KA 3DRUA 1JJOC 5C98A 4AU3A
chains in the Genus database with same CATH topology
1JRRA 2HI9A 2R9YA 5INWA 5BRRI 2PEFA 3VVJA 4AU2A 1E03I 4AU4A 4AU3B 1AZXI 1R1LI 4PYWA 1DZHL 3F1SA 1D5SA 2WXZC 2CEOA 3H5CA 2WXZA 3EVJI 5HGCA 3F5NA 2BEHI 1K9OI 1OYHI 4RO9A 1QMBA 2B4XI 4IF8A 1JVQI 1T1FA 1DZGI 4ROAA 4Y3KA 3T1PA 2VDXA 5EI0A 1QMNA 2ACHA 1C5GA 1OO8A 2XN7A 4AJTA 3B9FI 2H4QA 1HLEA 1OPHA 2WY0C 3OZQA 1JMOA 2XN5A 3CWLA 3DLWA 3LW2A 1BR8I 1E04I 1YXAA 1NQ9I 1PSIA 3CAAA 1ATHA 3DRMA 2GD4C 3DY0A 1DVNA 4P0OA 8APIA 1SNGA 2ARQA 4C41A 4RSQA 4EB1L 2B5TI 3STOA 4BB2A 5CDXA 7APIA 1AS4A 2VDYA 2OAYA 2V95A 2ANTI 1HP7A 4X30A 2BEHL 1DVMA 1QLPA 1LQ8A 3Q03A 4AFXA 3LE2A 1DB2A 1DZGL 1F0CA 4G8RA 4AQHA 1OC0A 2WXYC 2VH4A 1C8OA 1MTPA 3ZHAA 2WXWA 4G8OA 1OVAC 4ZK3A 1OVAA 1SR5A 3UT3A 3F02A 2D26A 1JTIA 9APIA 3Q02A 4YIAA 1OVAB 1XU8A 4DY0A 1IZ2A 2XN6A 3CVMA 3NDAA 4ROBA 2RIVA 2H4PA 2ZNHA 3NE4A 1BY7A 1IMVA 3FGQA 1ATTA 1OYHL 1KCTA 4IC0A 4AJUA 2B4XL 2H4RA 4C49A 4CAAA 1UHGA 2RIWA 3PB1I 4DY7C 2HIJI 3PZFA 1ANTI 1LJ5A 1WZ9A 2OL2A 1EZXA 2QUGA 2ARRA 3CWMA 4ZK0A 5CDZA 4GA7A 2WY1A 4KDSA 3R4LA 9PAIA 4EB1I 1DZHI 2ZV6A 1SEKA 2WXXA 3NDFA 3KCGI 4R9IA 1ATUA 4DTEA 4P0FA 1TB6I 2XN3A 1JMJA 1LK6I 1M93B 5CE0A 1XQGA 2DUTA 1A7CA 1E05I 2PEEA 1XQJA 4Y40A 3NDDA 5IO1A 3EOXA 2HIJL 1B3KA 3DRUA 1JJOC 5C98A 4AU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JRR A;  2HI9 A;  2R9Y A;  5INW A;  5BRR I;  2PEF A;  3VVJ A;  4AU2 A;  1E03 I;  4AU4 A;  4AU3 B;  1AZX I;  1R1L I;  4PYW A;  1DZH L;  3F1S A;  1D5S A;  2WXZ C;  2CEO A;  3H5C A;  2WXZ A;  3EVJ I;  5HGC A;  3F5N A;  2BEH I;  1K9O I;  1OYH I;  4RO9 A;  1QMB A;  2B4X I;  4IF8 A;  1JVQ I;  1T1F A;  1DZG I;  4ROA A;  4Y3K A;  3T1P A;  2VDX A;  5EI0 A;  1QMN A;  2ACH A;  1C5G A;  1OO8 A;  2XN7 A;  4AJT A;  3B9F I;  2H4Q A;  1HLE A;  1OPH A;  2WY0 C;  3OZQ A;  1JMO A;  2XN5 A;  3CWL A;  3DLW A;  3LW2 A;  1BR8 I;  1E04 I;  1YXA A;  1NQ9 I;  1PSI A;  3CAA A;  1ATH A;  3DRM A;  2GD4 C;  3DY0 A;  1DVN A;  4P0O A;  8API A;  1SNG A;  2ARQ A;  4C41 A;  4RSQ A;  4EB1 L;  2B5T I;  3STO A;  4BB2 A;  5CDX A;  7API A;  1AS4 A;  2VDY A;  2OAY A;  2V95 A;  2ANT I;  1HP7 A;  4X30 A;  2BEH L;  1DVM A;  1QLP A;  1LQ8 A;  3Q03 A;  4AFX A;  3LE2 A;  1DB2 A;  1DZG L;  1F0C A;  4G8R A;  4AQH A;  1OC0 A;  2WXY C;  2VH4 A;  1C8O A;  1MTP A;  3ZHA A;  2WXW A;  4G8O A;  1OVA C;  4ZK3 A;  1OVA A;  1SR5 A;  3UT3 A;  3F02 A;  2D26 A;  1JTI A;  9API A;  3Q02 A;  4YIA A;  1OVA B;  1XU8 A;  4DY0 A;  1IZ2 A;  2XN6 A;  3CVM A;  3NDA A;  4ROB A;  2RIV A;  2H4P A;  2ZNH A;  3NE4 A;  1BY7 A;  1IMV A;  3FGQ A;  1ATT A;  1OYH L;  1KCT A;  4IC0 A;  4AJU A;  2B4X L;  2H4R A;  4C49 A;  4CAA A;  1UHG A;  2RIW A;  3PB1 I;  4DY7 C;  2HIJ I;  3PZF A;  1ANT I;  1LJ5 A;  1WZ9 A;  2OL2 A;  1EZX A;  2QUG A;  2ARR A;  3CWM A;  4ZK0 A;  5CDZ A;  4GA7 A;  2WY1 A;  4KDS A;  3R4L A;  9PAI A;  4EB1 I;  1DZH I;  2ZV6 A;  1SEK A;  2WXX A;  3NDF A;  3KCG I;  4R9I A;  1ATU A;  4DTE A;  4P0F A;  1TB6 I;  2XN3 A;  1JMJ A;  1LK6 I;  1M93 B;  5CE0 A;  1XQG A;  2DUT A;  1A7C A;  1E05 I;  2PEE A;  1XQJ A;  4Y40 A;  3NDD A;  5IO1 A;  3EOX A;  2HIJ L;  1B3K A;  3DRU A;  1JJO C;  5C98 A;  4AU3 A; 
#chains in the Genus database with same CATH topology
 1JRR A;  2HI9 A;  2R9Y A;  5INW A;  5BRR I;  2PEF A;  3VVJ A;  4AU2 A;  1E03 I;  4AU4 A;  4AU3 B;  1AZX I;  1R1L I;  4PYW A;  1DZH L;  3F1S A;  1D5S A;  2WXZ C;  2CEO A;  3H5C A;  2WXZ A;  3EVJ I;  5HGC A;  3F5N A;  2BEH I;  1K9O I;  1OYH I;  4RO9 A;  1QMB A;  2B4X I;  4IF8 A;  1JVQ I;  1T1F A;  1DZG I;  4ROA A;  4Y3K A;  3T1P A;  2VDX A;  5EI0 A;  1QMN A;  2ACH A;  1C5G A;  1OO8 A;  2XN7 A;  4AJT A;  3B9F I;  2H4Q A;  1HLE A;  1OPH A;  2WY0 C;  3OZQ A;  1JMO A;  2XN5 A;  3CWL A;  3DLW A;  3LW2 A;  1BR8 I;  1E04 I;  1YXA A;  1NQ9 I;  1PSI A;  3CAA A;  1ATH A;  3DRM A;  2GD4 C;  3DY0 A;  1DVN A;  4P0O A;  8API A;  1SNG A;  2ARQ A;  4C41 A;  4RSQ A;  4EB1 L;  2B5T I;  3STO A;  4BB2 A;  5CDX A;  7API A;  1AS4 A;  2VDY A;  2OAY A;  2V95 A;  2ANT I;  1HP7 A;  4X30 A;  2BEH L;  1DVM A;  1QLP A;  1LQ8 A;  3Q03 A;  4AFX A;  3LE2 A;  1DB2 A;  1DZG L;  1F0C A;  4G8R A;  4AQH A;  1OC0 A;  2WXY C;  2VH4 A;  1C8O A;  1MTP A;  3ZHA A;  2WXW A;  4G8O A;  1OVA C;  4ZK3 A;  1OVA A;  1SR5 A;  3UT3 A;  3F02 A;  2D26 A;  1JTI A;  9API A;  3Q02 A;  4YIA A;  1OVA B;  1XU8 A;  4DY0 A;  1IZ2 A;  2XN6 A;  3CVM A;  3NDA A;  4ROB A;  2RIV A;  2H4P A;  2ZNH A;  3NE4 A;  1BY7 A;  1IMV A;  3FGQ A;  1ATT A;  1OYH L;  1KCT A;  4IC0 A;  4AJU A;  2B4X L;  2H4R A;  4C49 A;  4CAA A;  1UHG A;  2RIW A;  3PB1 I;  4DY7 C;  2HIJ I;  3PZF A;  1ANT I;  1LJ5 A;  1WZ9 A;  2OL2 A;  1EZX A;  2QUG A;  2ARR A;  3CWM A;  4ZK0 A;  5CDZ A;  4GA7 A;  2WY1 A;  4KDS A;  3R4L A;  9PAI A;  4EB1 I;  1DZH I;  2ZV6 A;  1SEK A;  2WXX A;  3NDF A;  3KCG I;  4R9I A;  1ATU A;  4DTE A;  4P0F A;  1TB6 I;  2XN3 A;  1JMJ A;  1LK6 I;  1M93 B;  5CE0 A;  1XQG A;  2DUT A;  1A7C A;  1E05 I;  2PEE A;  1XQJ A;  4Y40 A;  3NDD A;  5IO1 A;  3EOX A;  2HIJ L;  1B3K A;  3DRU A;  1JJO C;  5C98 A;  4AU3 A; 
#chains in the Genus database with same CATH homology
 1JRR A;  2HI9 A;  2R9Y A;  5INW A;  5BRR I;  2PEF A;  3VVJ A;  4AU2 A;  1E03 I;  4AU4 A;  4AU3 B;  1AZX I;  1R1L I;  4PYW A;  1DZH L;  3F1S A;  1D5S A;  2WXZ C;  2CEO A;  3H5C A;  2WXZ A;  3EVJ I;  5HGC A;  3F5N A;  2BEH I;  1K9O I;  1OYH I;  4RO9 A;  1QMB A;  2B4X I;  4IF8 A;  1JVQ I;  1T1F A;  1DZG I;  4ROA A;  4Y3K A;  3T1P A;  2VDX A;  5EI0 A;  1QMN A;  2ACH A;  1C5G A;  1OO8 A;  2XN7 A;  4AJT A;  3B9F I;  2H4Q A;  1HLE A;  1OPH A;  2WY0 C;  3OZQ A;  1JMO A;  2XN5 A;  3CWL A;  3DLW A;  3LW2 A;  1BR8 I;  1E04 I;  1YXA A;  1NQ9 I;  1PSI A;  3CAA A;  1ATH A;  3DRM A;  2GD4 C;  3DY0 A;  1DVN A;  4P0O A;  8API A;  1SNG A;  2ARQ A;  4C41 A;  4RSQ A;  4EB1 L;  2B5T I;  3STO A;  4BB2 A;  5CDX A;  7API A;  1AS4 A;  2VDY A;  2OAY A;  2V95 A;  2ANT I;  1HP7 A;  4X30 A;  2BEH L;  1DVM A;  1QLP A;  1LQ8 A;  3Q03 A;  4AFX A;  3LE2 A;  1DB2 A;  1DZG L;  1F0C A;  4G8R A;  4AQH A;  1OC0 A;  2WXY C;  2VH4 A;  1C8O A;  1MTP A;  3ZHA A;  2WXW A;  4G8O A;  1OVA C;  4ZK3 A;  1OVA A;  1SR5 A;  3UT3 A;  3F02 A;  2D26 A;  1JTI A;  9API A;  3Q02 A;  4YIA A;  1OVA B;  1XU8 A;  4DY0 A;  1IZ2 A;  2XN6 A;  3CVM A;  3NDA A;  4ROB A;  2RIV A;  2H4P A;  2ZNH A;  3NE4 A;  1BY7 A;  1IMV A;  3FGQ A;  1ATT A;  1OYH L;  1KCT A;  4IC0 A;  4AJU A;  2B4X L;  2H4R A;  4C49 A;  4CAA A;  1UHG A;  2RIW A;  3PB1 I;  4DY7 C;  2HIJ I;  3PZF A;  1ANT I;  1LJ5 A;  1WZ9 A;  2OL2 A;  1EZX A;  2QUG A;  2ARR A;  3CWM A;  4ZK0 A;  5CDZ A;  4GA7 A;  2WY1 A;  4KDS A;  3R4L A;  9PAI A;  4EB1 I;  1DZH I;  2ZV6 A;  1SEK A;  2WXX A;  3NDF A;  3KCG I;  4R9I A;  1ATU A;  4DTE A;  4P0F A;  1TB6 I;  2XN3 A;  1JMJ A;  1LK6 I;  1M93 B;  5CE0 A;  1XQG A;  2DUT A;  1A7C A;  1E05 I;  2PEE A;  1XQJ A;  4Y40 A;  3NDD A;  5IO1 A;  3EOX A;  2HIJ L;  1B3K A;  3DRU A;  1JJO C;  5C98 A;  4AU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...