3NDDA

Cleaved antitrypsin with p10 pro, and p9-p6 asp
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
335
structure length
335
Chain Sequence
NKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHAKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAPDDDDEAIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Loop-sheet mechanism of serpin polymerization tested by reactive center loop mutations
pubmed doi rcsb
molecule keywords Alpha-1-antitrypsin
molecule tags Hydrolase inhibitor
source organism Homo sapiens
total genus 95
structure length 335
sequence length 335
ec nomenclature
pdb deposition date 2010-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.39.10 Mainly Beta Roll Alpha-1-antitrypsin; domain 1 Alpha-1-antitrypsin, domain 1 3nddA02
3.30.497.10 Alpha Beta 2-Layer Sandwich Antithrombin; Chain I, domain 2 Antithrombin, subunit I, domain 2 3nddA01
4RO9A 2VH4A 4C49A 1OYHL 2RIVA 3OZQA 1QLPA 4AQHA 1IMVA 1OO8A 1DZHI 4EB1I 2BEHL 7APIA 1C5GA 2ACHA 4YIAA 1T1FA 1DVMA 1JMJA 4X30A 1KCTA 3B9FI 1OC0A 2WXYC 3DRUA 1QMNA 3KCGI 4IC0A 5HGCA 2XN5A 5EI0A 1XQJA 1JMOA 1DZGL 4KDSA 2R9YA 3NDFA 4BB2A 2ANTI 3CWMA 1K9OI 3PB1I 4PYWA 3STOA 8APIA 4AU3B 1WZ9A 2VDXA 1F0CA 2WXZA 4AJTA 2ZNHA 4Y3KA 3Q03A 1SR5A 4AJUA 3CAAA 1EZXA 3DRMA 1D5SA 2ARRA 3F02A 3H5CA 1HP7A 2WXZC 4EB1L 1DZHL 9PAIA 2ARQA 1ATHA 2H4PA 4C41A 1ATUA 4AFXA 3DY0A 2HIJI 2XN3A 4ZK3A 3F1SA 1JTIA 3T1PA 3EVJI 1LJ5A 1ATTA 5CE0A 2RIWA 4G8RA 3FGQA 1NQ9I 4ZK0A 1XQGA 2OL2A 1OPHA 1BR8I 1E03I 2HI9A 4DY0A 2WY1A 3R4LA 4GA7A 3ZHAA 4DTEA 5C98A 1SNGA 1ANTI 3VVJA 1UHGA 1DVNA 2WXXA 1JJOC 1SEKA 3NDDA 1A7CA 1JVQI 4Y40A 1C8OA 1LK6I 1HLEA 3EOXA 3F5NA 2V95A 4P0OA 1IZ2A 2XN7A 1TB6I 1M93B 3LW2A 3LE2A 2XN6A 2PEEA 2WXWA 3CWLA 1MTPA 4AU2A 1DB2A 2HIJL 1OVAB 2B4XI 1OYHI 5CDZA 1OVAA 1E04I 2QUGA 2VDYA 2H4QA 2BEHI 2H4RA 1JRRA 9APIA 2DUTA 3CVMA 4RSQA 2ZV6A 3UT3A 1OVAC 1AS4A 1PSIA 5IO1A 3DLWA 1DZGI 5CDXA 3NDAA 1BY7A 4ROAA 4ROBA 4AU4A 4P0FA 1XU8A 2WY0C 2PEFA 3NE4A 1R1LI 2D26A 5INWA 4G8OA 1QMBA 2GD4C 2CEOA 1E05I 4CAAA 4R9IA 2OAYA 3PZFA 4IF8A 1YXAA 1B3KA 2B5TI 3Q02A 1LQ8A 5BRRI 4DY7C 1AZXI 4AU3A 2B4XL
chains in the Genus database with same CATH superfamily
4RO9A 2VH4A 4C49A 1OYHL 2RIVA 3OZQA 1QLPA 4AQHA 1IMVA 1OO8A 1DZHI 4EB1I 2BEHL 7APIA 1C5GA 2ACHA 4YIAA 1T1FA 1DVMA 1JMJA 4X30A 1KCTA 3B9FI 1OC0A 2WXYC 3DRUA 1QMNA 3KCGI 4IC0A 5HGCA 2XN5A 5EI0A 1XQJA 1JMOA 1DZGL 4KDSA 2R9YA 3NDFA 4BB2A 2ANTI 3CWMA 1K9OI 3PB1I 4PYWA 3STOA 8APIA 4AU3B 1WZ9A 2VDXA 1F0CA 2WXZA 4AJTA 2ZNHA 4Y3KA 3Q03A 1SR5A 4AJUA 3CAAA 1EZXA 3DRMA 1D5SA 2ARRA 3F02A 3H5CA 1HP7A 2WXZC 4EB1L 1DZHL 9PAIA 2ARQA 1ATHA 2H4PA 4C41A 1ATUA 4AFXA 3DY0A 2HIJI 2XN3A 4ZK3A 3F1SA 1JTIA 3T1PA 3EVJI 1LJ5A 1ATTA 5CE0A 2RIWA 4G8RA 3FGQA 1NQ9I 4ZK0A 1XQGA 2OL2A 1OPHA 1BR8I 1E03I 2HI9A 4DY0A 2WY1A 3R4LA 4GA7A 3ZHAA 4DTEA 5C98A 1SNGA 1ANTI 3VVJA 1UHGA 1DVNA 2WXXA 1JJOC 1SEKA 3NDDA 1A7CA 1JVQI 4Y40A 1C8OA 1LK6I 1HLEA 3EOXA 3F5NA 2V95A 4P0OA 1IZ2A 2XN7A 1TB6I 1M93B 3LW2A 3LE2A 2XN6A 2PEEA 2WXWA 3CWLA 1MTPA 4AU2A 1DB2A 2HIJL 1OVAB 2B4XI 1OYHI 5CDZA 1OVAA 1E04I 2QUGA 2VDYA 2H4QA 2BEHI 2H4RA 1JRRA 9APIA 2DUTA 3CVMA 4RSQA 2ZV6A 3UT3A 1OVAC 1AS4A 1PSIA 5IO1A 3DLWA 1DZGI 5CDXA 3NDAA 1BY7A 4ROAA 4ROBA 4AU4A 4P0FA 1XU8A 2WY0C 2PEFA 3NE4A 1R1LI 2D26A 5INWA 4G8OA 1QMBA 2GD4C 2CEOA 1E05I 4CAAA 4R9IA 2OAYA 3PZFA 4IF8A 1YXAA 1B3KA 2B5TI 3Q02A 1LQ8A 5BRRI 4DY7C 1AZXI 4AU3A 2B4XL
chains in the Genus database with same CATH topology
4RO9A 2VH4A 4C49A 1OYHL 2RIVA 3OZQA 1QLPA 4AQHA 1IMVA 1OO8A 1DZHI 4EB1I 2BEHL 7APIA 1C5GA 2ACHA 4YIAA 1T1FA 1DVMA 1JMJA 4X30A 1KCTA 3B9FI 1OC0A 2WXYC 3DRUA 1QMNA 3KCGI 4IC0A 5HGCA 2XN5A 5EI0A 1XQJA 1JMOA 1DZGL 4KDSA 2R9YA 3NDFA 4BB2A 2ANTI 3CWMA 1K9OI 3PB1I 4PYWA 3STOA 8APIA 4AU3B 1WZ9A 2VDXA 1F0CA 2WXZA 4AJTA 2ZNHA 4Y3KA 3Q03A 1SR5A 4AJUA 3CAAA 1EZXA 3DRMA 1D5SA 2ARRA 3F02A 3H5CA 1HP7A 2WXZC 4EB1L 1DZHL 9PAIA 2ARQA 1ATHA 2H4PA 4C41A 1ATUA 4AFXA 3DY0A 2HIJI 2XN3A 4ZK3A 3F1SA 1JTIA 3T1PA 3EVJI 1LJ5A 1ATTA 5CE0A 2RIWA 4G8RA 3FGQA 1NQ9I 4ZK0A 1XQGA 2OL2A 1OPHA 1BR8I 1E03I 2HI9A 4DY0A 2WY1A 3R4LA 4GA7A 3ZHAA 4DTEA 5C98A 1SNGA 1ANTI 3VVJA 1UHGA 1DVNA 2WXXA 1JJOC 1SEKA 3NDDA 1A7CA 1JVQI 4Y40A 1C8OA 1LK6I 1HLEA 3EOXA 3F5NA 2V95A 4P0OA 1IZ2A 2XN7A 1TB6I 1M93B 3LW2A 3LE2A 2XN6A 2PEEA 2WXWA 3CWLA 1MTPA 4AU2A 1DB2A 2HIJL 1OVAB 2B4XI 1OYHI 5CDZA 1OVAA 1E04I 2QUGA 2VDYA 2H4QA 2BEHI 2H4RA 1JRRA 9APIA 2DUTA 3CVMA 4RSQA 2ZV6A 3UT3A 1OVAC 1AS4A 1PSIA 5IO1A 3DLWA 1DZGI 5CDXA 3NDAA 1BY7A 4ROAA 4ROBA 4AU4A 4P0FA 1XU8A 2WY0C 2PEFA 3NE4A 1R1LI 2D26A 5INWA 4G8OA 1QMBA 2GD4C 2CEOA 1E05I 4CAAA 4R9IA 2OAYA 3PZFA 4IF8A 1YXAA 1B3KA 2B5TI 3Q02A 1LQ8A 5BRRI 4DY7C 1AZXI 4AU3A 2B4XL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RO9 A;  2VH4 A;  4C49 A;  1OYH L;  2RIV A;  3OZQ A;  1QLP A;  4AQH A;  1IMV A;  1OO8 A;  1DZH I;  4EB1 I;  2BEH L;  7API A;  1C5G A;  2ACH A;  4YIA A;  1T1F A;  1DVM A;  1JMJ A;  4X30 A;  1KCT A;  3B9F I;  1OC0 A;  2WXY C;  3DRU A;  1QMN A;  3KCG I;  4IC0 A;  5HGC A;  2XN5 A;  5EI0 A;  1XQJ A;  1JMO A;  1DZG L;  4KDS A;  2R9Y A;  3NDF A;  4BB2 A;  2ANT I;  3CWM A;  1K9O I;  3PB1 I;  4PYW A;  3STO A;  8API A;  4AU3 B;  1WZ9 A;  2VDX A;  1F0C A;  2WXZ A;  4AJT A;  2ZNH A;  4Y3K A;  3Q03 A;  1SR5 A;  4AJU A;  3CAA A;  1EZX A;  3DRM A;  1D5S A;  2ARR A;  3F02 A;  3H5C A;  1HP7 A;  2WXZ C;  4EB1 L;  1DZH L;  9PAI A;  2ARQ A;  1ATH A;  2H4P A;  4C41 A;  1ATU A;  4AFX A;  3DY0 A;  2HIJ I;  2XN3 A;  4ZK3 A;  3F1S A;  1JTI A;  3T1P A;  3EVJ I;  1LJ5 A;  1ATT A;  5CE0 A;  2RIW A;  4G8R A;  3FGQ A;  1NQ9 I;  4ZK0 A;  1XQG A;  2OL2 A;  1OPH A;  1BR8 I;  1E03 I;  2HI9 A;  4DY0 A;  2WY1 A;  3R4L A;  4GA7 A;  3ZHA A;  4DTE A;  5C98 A;  1SNG A;  1ANT I;  3VVJ A;  1UHG A;  1DVN A;  2WXX A;  1JJO C;  1SEK A;  3NDD A;  1A7C A;  1JVQ I;  4Y40 A;  1C8O A;  1LK6 I;  1HLE A;  3EOX A;  3F5N A;  2V95 A;  4P0O A;  1IZ2 A;  2XN7 A;  1TB6 I;  1M93 B;  3LW2 A;  3LE2 A;  2XN6 A;  2PEE A;  2WXW A;  3CWL A;  1MTP A;  4AU2 A;  1DB2 A;  2HIJ L;  1OVA B;  2B4X I;  1OYH I;  5CDZ A;  1OVA A;  1E04 I;  2QUG A;  2VDY A;  2H4Q A;  2BEH I;  2H4R A;  1JRR A;  9API A;  2DUT A;  3CVM A;  4RSQ A;  2ZV6 A;  3UT3 A;  1OVA C;  1AS4 A;  1PSI A;  5IO1 A;  3DLW A;  1DZG I;  5CDX A;  3NDA A;  1BY7 A;  4ROA A;  4ROB A;  4AU4 A;  4P0F A;  1XU8 A;  2WY0 C;  2PEF A;  3NE4 A;  1R1L I;  2D26 A;  5INW A;  4G8O A;  1QMB A;  2GD4 C;  2CEO A;  1E05 I;  4CAA A;  4R9I A;  2OAY A;  3PZF A;  4IF8 A;  1YXA A;  1B3K A;  2B5T I;  3Q02 A;  1LQ8 A;  5BRR I;  4DY7 C;  1AZX I;  4AU3 A;  2B4X L; 
#chains in the Genus database with same CATH topology
 4RO9 A;  2VH4 A;  4C49 A;  1OYH L;  2RIV A;  3OZQ A;  1QLP A;  4AQH A;  1IMV A;  1OO8 A;  1DZH I;  4EB1 I;  2BEH L;  7API A;  1C5G A;  2ACH A;  4YIA A;  1T1F A;  1DVM A;  1JMJ A;  4X30 A;  1KCT A;  3B9F I;  1OC0 A;  2WXY C;  3DRU A;  1QMN A;  3KCG I;  4IC0 A;  5HGC A;  2XN5 A;  5EI0 A;  1XQJ A;  1JMO A;  1DZG L;  4KDS A;  2R9Y A;  3NDF A;  4BB2 A;  2ANT I;  3CWM A;  1K9O I;  3PB1 I;  4PYW A;  3STO A;  8API A;  4AU3 B;  1WZ9 A;  2VDX A;  1F0C A;  2WXZ A;  4AJT A;  2ZNH A;  4Y3K A;  3Q03 A;  1SR5 A;  4AJU A;  3CAA A;  1EZX A;  3DRM A;  1D5S A;  2ARR A;  3F02 A;  3H5C A;  1HP7 A;  2WXZ C;  4EB1 L;  1DZH L;  9PAI A;  2ARQ A;  1ATH A;  2H4P A;  4C41 A;  1ATU A;  4AFX A;  3DY0 A;  2HIJ I;  2XN3 A;  4ZK3 A;  3F1S A;  1JTI A;  3T1P A;  3EVJ I;  1LJ5 A;  1ATT A;  5CE0 A;  2RIW A;  4G8R A;  3FGQ A;  1NQ9 I;  4ZK0 A;  1XQG A;  2OL2 A;  1OPH A;  1BR8 I;  1E03 I;  2HI9 A;  4DY0 A;  2WY1 A;  3R4L A;  4GA7 A;  3ZHA A;  4DTE A;  5C98 A;  1SNG A;  1ANT I;  3VVJ A;  1UHG A;  1DVN A;  2WXX A;  1JJO C;  1SEK A;  3NDD A;  1A7C A;  1JVQ I;  4Y40 A;  1C8O A;  1LK6 I;  1HLE A;  3EOX A;  3F5N A;  2V95 A;  4P0O A;  1IZ2 A;  2XN7 A;  1TB6 I;  1M93 B;  3LW2 A;  3LE2 A;  2XN6 A;  2PEE A;  2WXW A;  3CWL A;  1MTP A;  4AU2 A;  1DB2 A;  2HIJ L;  1OVA B;  2B4X I;  1OYH I;  5CDZ A;  1OVA A;  1E04 I;  2QUG A;  2VDY A;  2H4Q A;  2BEH I;  2H4R A;  1JRR A;  9API A;  2DUT A;  3CVM A;  4RSQ A;  2ZV6 A;  3UT3 A;  1OVA C;  1AS4 A;  1PSI A;  5IO1 A;  3DLW A;  1DZG I;  5CDX A;  3NDA A;  1BY7 A;  4ROA A;  4ROB A;  4AU4 A;  4P0F A;  1XU8 A;  2WY0 C;  2PEF A;  3NE4 A;  1R1L I;  2D26 A;  5INW A;  4G8O A;  1QMB A;  2GD4 C;  2CEO A;  1E05 I;  4CAA A;  4R9I A;  2OAY A;  3PZF A;  4IF8 A;  1YXA A;  1B3K A;  2B5T I;  3Q02 A;  1LQ8 A;  5BRR I;  4DY7 C;  1AZX I;  4AU3 A;  2B4X L; 
#chains in the Genus database with same CATH homology
 4RO9 A;  2VH4 A;  4C49 A;  1OYH L;  2RIV A;  3OZQ A;  1QLP A;  4AQH A;  1IMV A;  1OO8 A;  1DZH I;  4EB1 I;  2BEH L;  7API A;  1C5G A;  2ACH A;  4YIA A;  1T1F A;  1DVM A;  1JMJ A;  4X30 A;  1KCT A;  3B9F I;  1OC0 A;  2WXY C;  3DRU A;  1QMN A;  3KCG I;  4IC0 A;  5HGC A;  2XN5 A;  5EI0 A;  1XQJ A;  1JMO A;  1DZG L;  4KDS A;  2R9Y A;  3NDF A;  4BB2 A;  2ANT I;  3CWM A;  1K9O I;  3PB1 I;  4PYW A;  3STO A;  8API A;  4AU3 B;  1WZ9 A;  2VDX A;  1F0C A;  2WXZ A;  4AJT A;  2ZNH A;  4Y3K A;  3Q03 A;  1SR5 A;  4AJU A;  3CAA A;  1EZX A;  3DRM A;  1D5S A;  2ARR A;  3F02 A;  3H5C A;  1HP7 A;  2WXZ C;  4EB1 L;  1DZH L;  9PAI A;  2ARQ A;  1ATH A;  2H4P A;  4C41 A;  1ATU A;  4AFX A;  3DY0 A;  2HIJ I;  2XN3 A;  4ZK3 A;  3F1S A;  1JTI A;  3T1P A;  3EVJ I;  1LJ5 A;  1ATT A;  5CE0 A;  2RIW A;  4G8R A;  3FGQ A;  1NQ9 I;  4ZK0 A;  1XQG A;  2OL2 A;  1OPH A;  1BR8 I;  1E03 I;  2HI9 A;  4DY0 A;  2WY1 A;  3R4L A;  4GA7 A;  3ZHA A;  4DTE A;  5C98 A;  1SNG A;  1ANT I;  3VVJ A;  1UHG A;  1DVN A;  2WXX A;  1JJO C;  1SEK A;  3NDD A;  1A7C A;  1JVQ I;  4Y40 A;  1C8O A;  1LK6 I;  1HLE A;  3EOX A;  3F5N A;  2V95 A;  4P0O A;  1IZ2 A;  2XN7 A;  1TB6 I;  1M93 B;  3LW2 A;  3LE2 A;  2XN6 A;  2PEE A;  2WXW A;  3CWL A;  1MTP A;  4AU2 A;  1DB2 A;  2HIJ L;  1OVA B;  2B4X I;  1OYH I;  5CDZ A;  1OVA A;  1E04 I;  2QUG A;  2VDY A;  2H4Q A;  2BEH I;  2H4R A;  1JRR A;  9API A;  2DUT A;  3CVM A;  4RSQ A;  2ZV6 A;  3UT3 A;  1OVA C;  1AS4 A;  1PSI A;  5IO1 A;  3DLW A;  1DZG I;  5CDX A;  3NDA A;  1BY7 A;  4ROA A;  4ROB A;  4AU4 A;  4P0F A;  1XU8 A;  2WY0 C;  2PEF A;  3NE4 A;  1R1L I;  2D26 A;  5INW A;  4G8O A;  1QMB A;  2GD4 C;  2CEO A;  1E05 I;  4CAA A;  4R9I A;  2OAY A;  3PZF A;  4IF8 A;  1YXA A;  1B3K A;  2B5T I;  3Q02 A;  1LQ8 A;  5BRR I;  4DY7 C;  1AZX I;  4AU3 A;  2B4X L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...