1OPHA

Non-covalent complex between alpha-1-pi-pittsburgh and s195a trypsin
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
375
structure length
375
Chain Sequence
HPTFNKITPNLAEFAFSLYRQLAHQSNSTNILFSPVSIAAAFAMLSLGAKGDTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHSKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPRSIPPEVKFNKPFVFLIIEQNTKAPLFMGRVVNPTQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Canonical inhibitor-like interactions explain reactivity of alpha1-proteinase inhibitor Pittsburgh and antithrombin with proteinases
pubmed doi rcsb
molecule keywords Alpha-1-antitrypsin precursor
molecule tags Hydrolase/hydrolase inhibitor
source organism Homo sapiens
total genus 112
structure length 375
sequence length 375
ec nomenclature
pdb deposition date 2003-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00079 Serpin Serpin (serine protease inhibitor)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.39.10 Mainly Beta Roll Alpha-1-antitrypsin; domain 1 Alpha-1-antitrypsin, domain 1 1ophA01
3.30.497.10 Alpha Beta 2-Layer Sandwich Antithrombin; Chain I, domain 2 Antithrombin, subunit I, domain 2 1ophA02
3B9FI 7APIA 2H4RA 1DZGL 1SR5A 2ANTI 2ARQA 4EB1L 1SEKA 1WZ9A 1SNGA 5CDZA 2H4QA 2R9YA 1AZXI 4R9IA 4RO9A 2XN6A 1OVAC 1R1LI 4Y40A 1QMBA 1PSIA 2OL2A 2ZNHA 3CAAA 1ATUA 1KCTA 1OYHI 1M93B 4AQHA 1IZ2A 1LJ5A 4ROAA 2B4XI 2PEEA 3F5NA 3F1SA 1E03I 1JMJA 3DRUA 4P0FA 4ROBA 4PYWA 1OC0A 4AU3B 1AS4A 1K9OI 2HIJL 2WXZC 4KDSA 3PZFA 1OVAB 1ATTA 3Q03A 4X30A 5INWA 2WXXA 5CDXA 1HP7A 1OO8A 9PAIA 2H4PA 1DZHI 5HGCA 2CEOA 1TB6I 3DLWA 3STOA 1E04I 2XN5A 3NDFA 1E05I 1B3KA 4BB2A 1YXAA 5IO1A 1LK6I 3DRMA 3T1PA 3LW2A 3NDDA 9APIA 4ZK0A 1XQGA 3F02A 4ZK3A 3VVJA 2HI9A 3PB1I 1BY7A 3CWLA 1C8OA 2VH4A 1T1FA 5BRRI 2ARRA 1OVAA 4G8OA 2VDYA 1DB2A 4IF8A 1HLEA 4Y3KA 4AU2A 1NQ9I 2D26A 3FGQA 5EI0A 2BEHL 3DY0A 3Q02A 1A7CA 2RIVA 4YIAA 4DTEA 1DZGI 2B4XL 3H5CA 4EB1I 1ATHA 4P0OA 1BR8I 3R4LA 1XU8A 4GA7A 1MTPA 3EVJI 4RSQA 3NE4A 2ZV6A 2WY0C 2WXZA 1JMOA 2QUGA 3UT3A 4G8RA 3EOXA 2B5TI 2OAYA 8APIA 4IC0A 2XN7A 3OZQA 1ANTI 4AU3A 5C98A 4C49A 1IMVA 2VDXA 1XQJA 4AU4A 1DVNA 2DUTA 1DVMA 1DZHL 2ACHA 2V95A 1D5SA 1JVQI 2RIWA 1OYHL 2WXYC 2PEFA 3LE2A 1F0CA 1JRRA 4CAAA 3ZHAA 2WY1A 3CVMA 2HIJI 3NDAA 2BEHI 1QLPA 2GD4C 1OPHA 1JTIA 3KCGI 4DY0A 4AJUA 4C41A 4DY7C 1EZXA 4AFXA 5CE0A 2WXWA 1QMNA 1C5GA 4AJTA 2XN3A 1JJOC 3CWMA 1UHGA 1LQ8A
chains in the Genus database with same CATH superfamily
3B9FI 7APIA 2H4RA 1DZGL 1SR5A 2ANTI 2ARQA 4EB1L 1SEKA 1WZ9A 1SNGA 5CDZA 2H4QA 2R9YA 1AZXI 4R9IA 4RO9A 2XN6A 1OVAC 1R1LI 4Y40A 1QMBA 1PSIA 2OL2A 2ZNHA 3CAAA 1ATUA 1KCTA 1OYHI 1M93B 4AQHA 1IZ2A 1LJ5A 4ROAA 2B4XI 2PEEA 3F5NA 3F1SA 1E03I 1JMJA 3DRUA 4P0FA 4ROBA 4PYWA 1OC0A 4AU3B 1AS4A 1K9OI 2HIJL 2WXZC 4KDSA 3PZFA 1OVAB 1ATTA 3Q03A 4X30A 5INWA 2WXXA 5CDXA 1HP7A 1OO8A 9PAIA 2H4PA 1DZHI 5HGCA 2CEOA 1TB6I 3DLWA 3STOA 1E04I 2XN5A 3NDFA 1E05I 1B3KA 4BB2A 1YXAA 5IO1A 1LK6I 3DRMA 3T1PA 3LW2A 3NDDA 9APIA 4ZK0A 1XQGA 3F02A 4ZK3A 3VVJA 2HI9A 3PB1I 1BY7A 3CWLA 1C8OA 2VH4A 1T1FA 5BRRI 2ARRA 1OVAA 4G8OA 2VDYA 1DB2A 4IF8A 1HLEA 4Y3KA 4AU2A 1NQ9I 2D26A 3FGQA 5EI0A 2BEHL 3DY0A 3Q02A 1A7CA 2RIVA 4YIAA 4DTEA 1DZGI 2B4XL 3H5CA 4EB1I 1ATHA 4P0OA 1BR8I 3R4LA 1XU8A 4GA7A 1MTPA 3EVJI 4RSQA 3NE4A 2ZV6A 2WY0C 2WXZA 1JMOA 2QUGA 3UT3A 4G8RA 3EOXA 2B5TI 2OAYA 8APIA 4IC0A 2XN7A 3OZQA 1ANTI 4AU3A 5C98A 4C49A 1IMVA 2VDXA 1XQJA 4AU4A 1DVNA 2DUTA 1DVMA 1DZHL 2ACHA 2V95A 1D5SA 1JVQI 2RIWA 1OYHL 2WXYC 2PEFA 3LE2A 1F0CA 1JRRA 4CAAA 3ZHAA 2WY1A 3CVMA 2HIJI 3NDAA 2BEHI 1QLPA 2GD4C 1OPHA 1JTIA 3KCGI 4DY0A 4AJUA 4C41A 4DY7C 1EZXA 4AFXA 5CE0A 2WXWA 1QMNA 1C5GA 4AJTA 2XN3A 1JJOC 3CWMA 1UHGA 1LQ8A
chains in the Genus database with same CATH topology
3B9FI 7APIA 2H4RA 1DZGL 1SR5A 2ANTI 2ARQA 4EB1L 1SEKA 1WZ9A 1SNGA 5CDZA 2H4QA 2R9YA 1AZXI 4R9IA 4RO9A 2XN6A 1OVAC 1R1LI 4Y40A 1QMBA 1PSIA 2OL2A 2ZNHA 3CAAA 1ATUA 1KCTA 1OYHI 1M93B 4AQHA 1IZ2A 1LJ5A 4ROAA 2B4XI 2PEEA 3F5NA 3F1SA 1E03I 1JMJA 3DRUA 4P0FA 4ROBA 4PYWA 1OC0A 4AU3B 1AS4A 1K9OI 2HIJL 2WXZC 4KDSA 3PZFA 1OVAB 1ATTA 3Q03A 4X30A 5INWA 2WXXA 5CDXA 1HP7A 1OO8A 9PAIA 2H4PA 1DZHI 5HGCA 2CEOA 1TB6I 3DLWA 3STOA 1E04I 2XN5A 3NDFA 1E05I 1B3KA 4BB2A 1YXAA 5IO1A 1LK6I 3DRMA 3T1PA 3LW2A 3NDDA 9APIA 4ZK0A 1XQGA 3F02A 4ZK3A 3VVJA 2HI9A 3PB1I 1BY7A 3CWLA 1C8OA 2VH4A 1T1FA 5BRRI 2ARRA 1OVAA 4G8OA 2VDYA 1DB2A 4IF8A 1HLEA 4Y3KA 4AU2A 1NQ9I 2D26A 3FGQA 5EI0A 2BEHL 3DY0A 3Q02A 1A7CA 2RIVA 4YIAA 4DTEA 1DZGI 2B4XL 3H5CA 4EB1I 1ATHA 4P0OA 1BR8I 3R4LA 1XU8A 4GA7A 1MTPA 3EVJI 4RSQA 3NE4A 2ZV6A 2WY0C 2WXZA 1JMOA 2QUGA 3UT3A 4G8RA 3EOXA 2B5TI 2OAYA 8APIA 4IC0A 2XN7A 3OZQA 1ANTI 4AU3A 5C98A 4C49A 1IMVA 2VDXA 1XQJA 4AU4A 1DVNA 2DUTA 1DVMA 1DZHL 2ACHA 2V95A 1D5SA 1JVQI 2RIWA 1OYHL 2WXYC 2PEFA 3LE2A 1F0CA 1JRRA 4CAAA 3ZHAA 2WY1A 3CVMA 2HIJI 3NDAA 2BEHI 1QLPA 2GD4C 1OPHA 1JTIA 3KCGI 4DY0A 4AJUA 4C41A 4DY7C 1EZXA 4AFXA 5CE0A 2WXWA 1QMNA 1C5GA 4AJTA 2XN3A 1JJOC 3CWMA 1UHGA 1LQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B9F I;  7API A;  2H4R A;  1DZG L;  1SR5 A;  2ANT I;  2ARQ A;  4EB1 L;  1SEK A;  1WZ9 A;  1SNG A;  5CDZ A;  2H4Q A;  2R9Y A;  1AZX I;  4R9I A;  4RO9 A;  2XN6 A;  1OVA C;  1R1L I;  4Y40 A;  1QMB A;  1PSI A;  2OL2 A;  2ZNH A;  3CAA A;  1ATU A;  1KCT A;  1OYH I;  1M93 B;  4AQH A;  1IZ2 A;  1LJ5 A;  4ROA A;  2B4X I;  2PEE A;  3F5N A;  3F1S A;  1E03 I;  1JMJ A;  3DRU A;  4P0F A;  4ROB A;  4PYW A;  1OC0 A;  4AU3 B;  1AS4 A;  1K9O I;  2HIJ L;  2WXZ C;  4KDS A;  3PZF A;  1OVA B;  1ATT A;  3Q03 A;  4X30 A;  5INW A;  2WXX A;  5CDX A;  1HP7 A;  1OO8 A;  9PAI A;  2H4P A;  1DZH I;  5HGC A;  2CEO A;  1TB6 I;  3DLW A;  3STO A;  1E04 I;  2XN5 A;  3NDF A;  1E05 I;  1B3K A;  4BB2 A;  1YXA A;  5IO1 A;  1LK6 I;  3DRM A;  3T1P A;  3LW2 A;  3NDD A;  9API A;  4ZK0 A;  1XQG A;  3F02 A;  4ZK3 A;  3VVJ A;  2HI9 A;  3PB1 I;  1BY7 A;  3CWL A;  1C8O A;  2VH4 A;  1T1F A;  5BRR I;  2ARR A;  1OVA A;  4G8O A;  2VDY A;  1DB2 A;  4IF8 A;  1HLE A;  4Y3K A;  4AU2 A;  1NQ9 I;  2D26 A;  3FGQ A;  5EI0 A;  2BEH L;  3DY0 A;  3Q02 A;  1A7C A;  2RIV A;  4YIA A;  4DTE A;  1DZG I;  2B4X L;  3H5C A;  4EB1 I;  1ATH A;  4P0O A;  1BR8 I;  3R4L A;  1XU8 A;  4GA7 A;  1MTP A;  3EVJ I;  4RSQ A;  3NE4 A;  2ZV6 A;  2WY0 C;  2WXZ A;  1JMO A;  2QUG A;  3UT3 A;  4G8R A;  3EOX A;  2B5T I;  2OAY A;  8API A;  4IC0 A;  2XN7 A;  3OZQ A;  1ANT I;  4AU3 A;  5C98 A;  4C49 A;  1IMV A;  2VDX A;  1XQJ A;  4AU4 A;  1DVN A;  2DUT A;  1DVM A;  1DZH L;  2ACH A;  2V95 A;  1D5S A;  1JVQ I;  2RIW A;  1OYH L;  2WXY C;  2PEF A;  3LE2 A;  1F0C A;  1JRR A;  4CAA A;  3ZHA A;  2WY1 A;  3CVM A;  2HIJ I;  3NDA A;  2BEH I;  1QLP A;  2GD4 C;  1OPH A;  1JTI A;  3KCG I;  4DY0 A;  4AJU A;  4C41 A;  4DY7 C;  1EZX A;  4AFX A;  5CE0 A;  2WXW A;  1QMN A;  1C5G A;  4AJT A;  2XN3 A;  1JJO C;  3CWM A;  1UHG A;  1LQ8 A; 
#chains in the Genus database with same CATH topology
 3B9F I;  7API A;  2H4R A;  1DZG L;  1SR5 A;  2ANT I;  2ARQ A;  4EB1 L;  1SEK A;  1WZ9 A;  1SNG A;  5CDZ A;  2H4Q A;  2R9Y A;  1AZX I;  4R9I A;  4RO9 A;  2XN6 A;  1OVA C;  1R1L I;  4Y40 A;  1QMB A;  1PSI A;  2OL2 A;  2ZNH A;  3CAA A;  1ATU A;  1KCT A;  1OYH I;  1M93 B;  4AQH A;  1IZ2 A;  1LJ5 A;  4ROA A;  2B4X I;  2PEE A;  3F5N A;  3F1S A;  1E03 I;  1JMJ A;  3DRU A;  4P0F A;  4ROB A;  4PYW A;  1OC0 A;  4AU3 B;  1AS4 A;  1K9O I;  2HIJ L;  2WXZ C;  4KDS A;  3PZF A;  1OVA B;  1ATT A;  3Q03 A;  4X30 A;  5INW A;  2WXX A;  5CDX A;  1HP7 A;  1OO8 A;  9PAI A;  2H4P A;  1DZH I;  5HGC A;  2CEO A;  1TB6 I;  3DLW A;  3STO A;  1E04 I;  2XN5 A;  3NDF A;  1E05 I;  1B3K A;  4BB2 A;  1YXA A;  5IO1 A;  1LK6 I;  3DRM A;  3T1P A;  3LW2 A;  3NDD A;  9API A;  4ZK0 A;  1XQG A;  3F02 A;  4ZK3 A;  3VVJ A;  2HI9 A;  3PB1 I;  1BY7 A;  3CWL A;  1C8O A;  2VH4 A;  1T1F A;  5BRR I;  2ARR A;  1OVA A;  4G8O A;  2VDY A;  1DB2 A;  4IF8 A;  1HLE A;  4Y3K A;  4AU2 A;  1NQ9 I;  2D26 A;  3FGQ A;  5EI0 A;  2BEH L;  3DY0 A;  3Q02 A;  1A7C A;  2RIV A;  4YIA A;  4DTE A;  1DZG I;  2B4X L;  3H5C A;  4EB1 I;  1ATH A;  4P0O A;  1BR8 I;  3R4L A;  1XU8 A;  4GA7 A;  1MTP A;  3EVJ I;  4RSQ A;  3NE4 A;  2ZV6 A;  2WY0 C;  2WXZ A;  1JMO A;  2QUG A;  3UT3 A;  4G8R A;  3EOX A;  2B5T I;  2OAY A;  8API A;  4IC0 A;  2XN7 A;  3OZQ A;  1ANT I;  4AU3 A;  5C98 A;  4C49 A;  1IMV A;  2VDX A;  1XQJ A;  4AU4 A;  1DVN A;  2DUT A;  1DVM A;  1DZH L;  2ACH A;  2V95 A;  1D5S A;  1JVQ I;  2RIW A;  1OYH L;  2WXY C;  2PEF A;  3LE2 A;  1F0C A;  1JRR A;  4CAA A;  3ZHA A;  2WY1 A;  3CVM A;  2HIJ I;  3NDA A;  2BEH I;  1QLP A;  2GD4 C;  1OPH A;  1JTI A;  3KCG I;  4DY0 A;  4AJU A;  4C41 A;  4DY7 C;  1EZX A;  4AFX A;  5CE0 A;  2WXW A;  1QMN A;  1C5G A;  4AJT A;  2XN3 A;  1JJO C;  3CWM A;  1UHG A;  1LQ8 A; 
#chains in the Genus database with same CATH homology
 3B9F I;  7API A;  2H4R A;  1DZG L;  1SR5 A;  2ANT I;  2ARQ A;  4EB1 L;  1SEK A;  1WZ9 A;  1SNG A;  5CDZ A;  2H4Q A;  2R9Y A;  1AZX I;  4R9I A;  4RO9 A;  2XN6 A;  1OVA C;  1R1L I;  4Y40 A;  1QMB A;  1PSI A;  2OL2 A;  2ZNH A;  3CAA A;  1ATU A;  1KCT A;  1OYH I;  1M93 B;  4AQH A;  1IZ2 A;  1LJ5 A;  4ROA A;  2B4X I;  2PEE A;  3F5N A;  3F1S A;  1E03 I;  1JMJ A;  3DRU A;  4P0F A;  4ROB A;  4PYW A;  1OC0 A;  4AU3 B;  1AS4 A;  1K9O I;  2HIJ L;  2WXZ C;  4KDS A;  3PZF A;  1OVA B;  1ATT A;  3Q03 A;  4X30 A;  5INW A;  2WXX A;  5CDX A;  1HP7 A;  1OO8 A;  9PAI A;  2H4P A;  1DZH I;  5HGC A;  2CEO A;  1TB6 I;  3DLW A;  3STO A;  1E04 I;  2XN5 A;  3NDF A;  1E05 I;  1B3K A;  4BB2 A;  1YXA A;  5IO1 A;  1LK6 I;  3DRM A;  3T1P A;  3LW2 A;  3NDD A;  9API A;  4ZK0 A;  1XQG A;  3F02 A;  4ZK3 A;  3VVJ A;  2HI9 A;  3PB1 I;  1BY7 A;  3CWL A;  1C8O A;  2VH4 A;  1T1F A;  5BRR I;  2ARR A;  1OVA A;  4G8O A;  2VDY A;  1DB2 A;  4IF8 A;  1HLE A;  4Y3K A;  4AU2 A;  1NQ9 I;  2D26 A;  3FGQ A;  5EI0 A;  2BEH L;  3DY0 A;  3Q02 A;  1A7C A;  2RIV A;  4YIA A;  4DTE A;  1DZG I;  2B4X L;  3H5C A;  4EB1 I;  1ATH A;  4P0O A;  1BR8 I;  3R4L A;  1XU8 A;  4GA7 A;  1MTP A;  3EVJ I;  4RSQ A;  3NE4 A;  2ZV6 A;  2WY0 C;  2WXZ A;  1JMO A;  2QUG A;  3UT3 A;  4G8R A;  3EOX A;  2B5T I;  2OAY A;  8API A;  4IC0 A;  2XN7 A;  3OZQ A;  1ANT I;  4AU3 A;  5C98 A;  4C49 A;  1IMV A;  2VDX A;  1XQJ A;  4AU4 A;  1DVN A;  2DUT A;  1DVM A;  1DZH L;  2ACH A;  2V95 A;  1D5S A;  1JVQ I;  2RIW A;  1OYH L;  2WXY C;  2PEF A;  3LE2 A;  1F0C A;  1JRR A;  4CAA A;  3ZHA A;  2WY1 A;  3CVM A;  2HIJ I;  3NDA A;  2BEH I;  1QLP A;  2GD4 C;  1OPH A;  1JTI A;  3KCG I;  4DY0 A;  4AJU A;  4C41 A;  4DY7 C;  1EZX A;  4AFX A;  5CE0 A;  2WXW A;  1QMN A;  1C5G A;  4AJT A;  2XN3 A;  1JJO C;  3CWM A;  1UHG A;  1LQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...