2V95A

Structure of corticosteroid-binding globulin in complex with cortisol
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
368
structure length
342
Chain Sequence
NSHRGLAPTNVDFAFNLYQRLVALNPDKNTLISPVSISMALAMVSLGSTQSLQSLGFNLTETSEAEIHQSFQYLNYLLKQSDTGLEMNMGNAMFLLQKLKLKDSFLADVKQYYESEALAIDFEDWTKASQQINQHVKDKTQGKIEHVFSDSPASFILVNYIFLRGIWELPFSPENTREEDFYVNETSTVKVPMMVQSGSIGYFRDSVFPCQLIQMDYVGNGTAFFILPDQGQMDTVIAALSRDTIDRWGKLMTPRQVNLYIPKFSMSDTYDLKDVLEDLNIKDLLTNLTLTMVHKAMLQLDEGNVLLRSEPLDIKFNKPFILLLFDKFTWSSLMMSQVVNPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Corticosteroid-Binding Globulin: Structural Basis for Steroid Transport and Proteinase-Triggered Release
pubmed doi rcsb
molecule keywords CORTICOSTEROID-BINDING GLOBULIN
molecule tags Transport protein
source organism Rattus norvegicus
total genus 105
structure length 342
sequence length 368
ec nomenclature
pdb deposition date 2007-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00079 Serpin Serpin (serine protease inhibitor)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.39.10 Mainly Beta Roll Alpha-1-antitrypsin; domain 1 Alpha-1-antitrypsin, domain 1 2v95A02
3.30.497.10 Alpha Beta 2-Layer Sandwich Antithrombin; Chain I, domain 2 Antithrombin, subunit I, domain 2 2v95A01
2VDYA 1JTIA 3LW2A 1BR8I 3CVMA 3PB1I 1JMOA 4AU3A 2RIWA 1LJ5A 4ZK3A 5BRRI 3F5NA 1KCTA 4RSQA 9PAIA 4PYWA 1PSIA 3DRUA 1E05I 1IMVA 4IC0A 4RO9A 1OO8A 2B5TI 1A7CA 1MTPA 2ARQA 4G8OA 4CAAA 1C5GA 2GD4C 1E03I 3Q02A 5INWA 2ACHA 3CWLA 3CAAA 3VVJA 1F0CA 4C49A 3NDDA 2H4PA 4P0FA 2ARRA 1IZ2A 1ATUA 1JJOC 4Y3KA 1M93B 4C41A 1OYHL 2WXZA 2BEHL 1TB6I 1ANTI 3UT3A 2OAYA 3FGQA 2B4XL 2HI9A 4DY0A 4AFXA 2PEEA 3CWMA 3EVJI 2WXXA 3NDAA 1DZGI 4AJTA 1AS4A 2D26A 4EB1L 1UHGA 3STOA 8APIA 3DLWA 4AU3B 2WY0C 1DZHI 4P0OA 4KDSA 1OVAA 5EI0A 5IO1A 3DRMA 3PZFA 2XN5A 2HIJL 1DB2A 1ATTA 1C8OA 2VH4A 1R1LI 4YIAA 1QMBA 3KCGI 2V95A 3T1PA 1XQGA 2XN3A 3F02A 2WY1A 1YXAA 1OVAB 2XN6A 3EOXA 1B3KA 1DVNA 1OVAC 1XQJA 3OZQA 2R9YA 3LE2A 2RIVA 2WXWA 1HP7A 4BB2A 3H5CA 4ZK0A 4AJUA 9APIA 1ATHA 1SEKA 2OL2A 3DY0A 3F1SA 1QLPA 1OC0A 5HGCA 5C98A 3NDFA 1LK6I 2WXZC 2XN7A 7APIA 1HLEA 1LQ8A 1OYHI 1WZ9A 1JMJA 1NQ9I 2BEHI 5CDXA 1T1FA 4GA7A 4G8RA 2B4XI 1E04I 4AU4A 1K9OI 2VDXA 2H4RA 2PEFA 1XU8A 2WXYC 3R4LA 3B9FI 4ROBA 2H4QA 1BY7A 1DVMA 4EB1I 1D5SA 1OPHA 3ZHAA 2ANTI 2QUGA 2ZNHA 4Y40A 4AQHA 4AU2A 4IF8A 2CEOA 1JRRA 1DZGL 4DY7C 4R9IA 4ROAA 5CE0A 1EZXA 2HIJI 4X30A 1SNGA 2DUTA 1SR5A 1AZXI 1JVQI 3NE4A 1DZHL 3Q03A 2ZV6A 1QMNA 4DTEA 5CDZA
chains in the Genus database with same CATH superfamily
2VDYA 1JTIA 3LW2A 1BR8I 3CVMA 3PB1I 1JMOA 4AU3A 2RIWA 1LJ5A 4ZK3A 5BRRI 3F5NA 1KCTA 4RSQA 9PAIA 4PYWA 1PSIA 3DRUA 1E05I 1IMVA 4IC0A 4RO9A 1OO8A 2B5TI 1A7CA 1MTPA 2ARQA 4G8OA 4CAAA 1C5GA 2GD4C 1E03I 3Q02A 5INWA 2ACHA 3CWLA 3CAAA 3VVJA 1F0CA 4C49A 3NDDA 2H4PA 4P0FA 2ARRA 1IZ2A 1ATUA 1JJOC 4Y3KA 1M93B 4C41A 1OYHL 2WXZA 2BEHL 1TB6I 1ANTI 3UT3A 2OAYA 3FGQA 2B4XL 2HI9A 4DY0A 4AFXA 2PEEA 3CWMA 3EVJI 2WXXA 3NDAA 1DZGI 4AJTA 1AS4A 2D26A 4EB1L 1UHGA 3STOA 8APIA 3DLWA 4AU3B 2WY0C 1DZHI 4P0OA 4KDSA 1OVAA 5EI0A 5IO1A 3DRMA 3PZFA 2XN5A 2HIJL 1DB2A 1ATTA 1C8OA 2VH4A 1R1LI 4YIAA 1QMBA 3KCGI 2V95A 3T1PA 1XQGA 2XN3A 3F02A 2WY1A 1YXAA 1OVAB 2XN6A 3EOXA 1B3KA 1DVNA 1OVAC 1XQJA 3OZQA 2R9YA 3LE2A 2RIVA 2WXWA 1HP7A 4BB2A 3H5CA 4ZK0A 4AJUA 9APIA 1ATHA 1SEKA 2OL2A 3DY0A 3F1SA 1QLPA 1OC0A 5HGCA 5C98A 3NDFA 1LK6I 2WXZC 2XN7A 7APIA 1HLEA 1LQ8A 1OYHI 1WZ9A 1JMJA 1NQ9I 2BEHI 5CDXA 1T1FA 4GA7A 4G8RA 2B4XI 1E04I 4AU4A 1K9OI 2VDXA 2H4RA 2PEFA 1XU8A 2WXYC 3R4LA 3B9FI 4ROBA 2H4QA 1BY7A 1DVMA 4EB1I 1D5SA 1OPHA 3ZHAA 2ANTI 2QUGA 2ZNHA 4Y40A 4AQHA 4AU2A 4IF8A 2CEOA 1JRRA 1DZGL 4DY7C 4R9IA 4ROAA 5CE0A 1EZXA 2HIJI 4X30A 1SNGA 2DUTA 1SR5A 1AZXI 1JVQI 3NE4A 1DZHL 3Q03A 2ZV6A 1QMNA 4DTEA 5CDZA
chains in the Genus database with same CATH topology
2VDYA 1JTIA 3LW2A 1BR8I 3CVMA 3PB1I 1JMOA 4AU3A 2RIWA 1LJ5A 4ZK3A 5BRRI 3F5NA 1KCTA 4RSQA 9PAIA 4PYWA 1PSIA 3DRUA 1E05I 1IMVA 4IC0A 4RO9A 1OO8A 2B5TI 1A7CA 1MTPA 2ARQA 4G8OA 4CAAA 1C5GA 2GD4C 1E03I 3Q02A 5INWA 2ACHA 3CWLA 3CAAA 3VVJA 1F0CA 4C49A 3NDDA 2H4PA 4P0FA 2ARRA 1IZ2A 1ATUA 1JJOC 4Y3KA 1M93B 4C41A 1OYHL 2WXZA 2BEHL 1TB6I 1ANTI 3UT3A 2OAYA 3FGQA 2B4XL 2HI9A 4DY0A 4AFXA 2PEEA 3CWMA 3EVJI 2WXXA 3NDAA 1DZGI 4AJTA 1AS4A 2D26A 4EB1L 1UHGA 3STOA 8APIA 3DLWA 4AU3B 2WY0C 1DZHI 4P0OA 4KDSA 1OVAA 5EI0A 5IO1A 3DRMA 3PZFA 2XN5A 2HIJL 1DB2A 1ATTA 1C8OA 2VH4A 1R1LI 4YIAA 1QMBA 3KCGI 2V95A 3T1PA 1XQGA 2XN3A 3F02A 2WY1A 1YXAA 1OVAB 2XN6A 3EOXA 1B3KA 1DVNA 1OVAC 1XQJA 3OZQA 2R9YA 3LE2A 2RIVA 2WXWA 1HP7A 4BB2A 3H5CA 4ZK0A 4AJUA 9APIA 1ATHA 1SEKA 2OL2A 3DY0A 3F1SA 1QLPA 1OC0A 5HGCA 5C98A 3NDFA 1LK6I 2WXZC 2XN7A 7APIA 1HLEA 1LQ8A 1OYHI 1WZ9A 1JMJA 1NQ9I 2BEHI 5CDXA 1T1FA 4GA7A 4G8RA 2B4XI 1E04I 4AU4A 1K9OI 2VDXA 2H4RA 2PEFA 1XU8A 2WXYC 3R4LA 3B9FI 4ROBA 2H4QA 1BY7A 1DVMA 4EB1I 1D5SA 1OPHA 3ZHAA 2ANTI 2QUGA 2ZNHA 4Y40A 4AQHA 4AU2A 4IF8A 2CEOA 1JRRA 1DZGL 4DY7C 4R9IA 4ROAA 5CE0A 1EZXA 2HIJI 4X30A 1SNGA 2DUTA 1SR5A 1AZXI 1JVQI 3NE4A 1DZHL 3Q03A 2ZV6A 1QMNA 4DTEA 5CDZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VDY A;  1JTI A;  3LW2 A;  1BR8 I;  3CVM A;  3PB1 I;  1JMO A;  4AU3 A;  2RIW A;  1LJ5 A;  4ZK3 A;  5BRR I;  3F5N A;  1KCT A;  4RSQ A;  9PAI A;  4PYW A;  1PSI A;  3DRU A;  1E05 I;  1IMV A;  4IC0 A;  4RO9 A;  1OO8 A;  2B5T I;  1A7C A;  1MTP A;  2ARQ A;  4G8O A;  4CAA A;  1C5G A;  2GD4 C;  1E03 I;  3Q02 A;  5INW A;  2ACH A;  3CWL A;  3CAA A;  3VVJ A;  1F0C A;  4C49 A;  3NDD A;  2H4P A;  4P0F A;  2ARR A;  1IZ2 A;  1ATU A;  1JJO C;  4Y3K A;  1M93 B;  4C41 A;  1OYH L;  2WXZ A;  2BEH L;  1TB6 I;  1ANT I;  3UT3 A;  2OAY A;  3FGQ A;  2B4X L;  2HI9 A;  4DY0 A;  4AFX A;  2PEE A;  3CWM A;  3EVJ I;  2WXX A;  3NDA A;  1DZG I;  4AJT A;  1AS4 A;  2D26 A;  4EB1 L;  1UHG A;  3STO A;  8API A;  3DLW A;  4AU3 B;  2WY0 C;  1DZH I;  4P0O A;  4KDS A;  1OVA A;  5EI0 A;  5IO1 A;  3DRM A;  3PZF A;  2XN5 A;  2HIJ L;  1DB2 A;  1ATT A;  1C8O A;  2VH4 A;  1R1L I;  4YIA A;  1QMB A;  3KCG I;  2V95 A;  3T1P A;  1XQG A;  2XN3 A;  3F02 A;  2WY1 A;  1YXA A;  1OVA B;  2XN6 A;  3EOX A;  1B3K A;  1DVN A;  1OVA C;  1XQJ A;  3OZQ A;  2R9Y A;  3LE2 A;  2RIV A;  2WXW A;  1HP7 A;  4BB2 A;  3H5C A;  4ZK0 A;  4AJU A;  9API A;  1ATH A;  1SEK A;  2OL2 A;  3DY0 A;  3F1S A;  1QLP A;  1OC0 A;  5HGC A;  5C98 A;  3NDF A;  1LK6 I;  2WXZ C;  2XN7 A;  7API A;  1HLE A;  1LQ8 A;  1OYH I;  1WZ9 A;  1JMJ A;  1NQ9 I;  2BEH I;  5CDX A;  1T1F A;  4GA7 A;  4G8R A;  2B4X I;  1E04 I;  4AU4 A;  1K9O I;  2VDX A;  2H4R A;  2PEF A;  1XU8 A;  2WXY C;  3R4L A;  3B9F I;  4ROB A;  2H4Q A;  1BY7 A;  1DVM A;  4EB1 I;  1D5S A;  1OPH A;  3ZHA A;  2ANT I;  2QUG A;  2ZNH A;  4Y40 A;  4AQH A;  4AU2 A;  4IF8 A;  2CEO A;  1JRR A;  1DZG L;  4DY7 C;  4R9I A;  4ROA A;  5CE0 A;  1EZX A;  2HIJ I;  4X30 A;  1SNG A;  2DUT A;  1SR5 A;  1AZX I;  1JVQ I;  3NE4 A;  1DZH L;  3Q03 A;  2ZV6 A;  1QMN A;  4DTE A;  5CDZ A; 
#chains in the Genus database with same CATH topology
 2VDY A;  1JTI A;  3LW2 A;  1BR8 I;  3CVM A;  3PB1 I;  1JMO A;  4AU3 A;  2RIW A;  1LJ5 A;  4ZK3 A;  5BRR I;  3F5N A;  1KCT A;  4RSQ A;  9PAI A;  4PYW A;  1PSI A;  3DRU A;  1E05 I;  1IMV A;  4IC0 A;  4RO9 A;  1OO8 A;  2B5T I;  1A7C A;  1MTP A;  2ARQ A;  4G8O A;  4CAA A;  1C5G A;  2GD4 C;  1E03 I;  3Q02 A;  5INW A;  2ACH A;  3CWL A;  3CAA A;  3VVJ A;  1F0C A;  4C49 A;  3NDD A;  2H4P A;  4P0F A;  2ARR A;  1IZ2 A;  1ATU A;  1JJO C;  4Y3K A;  1M93 B;  4C41 A;  1OYH L;  2WXZ A;  2BEH L;  1TB6 I;  1ANT I;  3UT3 A;  2OAY A;  3FGQ A;  2B4X L;  2HI9 A;  4DY0 A;  4AFX A;  2PEE A;  3CWM A;  3EVJ I;  2WXX A;  3NDA A;  1DZG I;  4AJT A;  1AS4 A;  2D26 A;  4EB1 L;  1UHG A;  3STO A;  8API A;  3DLW A;  4AU3 B;  2WY0 C;  1DZH I;  4P0O A;  4KDS A;  1OVA A;  5EI0 A;  5IO1 A;  3DRM A;  3PZF A;  2XN5 A;  2HIJ L;  1DB2 A;  1ATT A;  1C8O A;  2VH4 A;  1R1L I;  4YIA A;  1QMB A;  3KCG I;  2V95 A;  3T1P A;  1XQG A;  2XN3 A;  3F02 A;  2WY1 A;  1YXA A;  1OVA B;  2XN6 A;  3EOX A;  1B3K A;  1DVN A;  1OVA C;  1XQJ A;  3OZQ A;  2R9Y A;  3LE2 A;  2RIV A;  2WXW A;  1HP7 A;  4BB2 A;  3H5C A;  4ZK0 A;  4AJU A;  9API A;  1ATH A;  1SEK A;  2OL2 A;  3DY0 A;  3F1S A;  1QLP A;  1OC0 A;  5HGC A;  5C98 A;  3NDF A;  1LK6 I;  2WXZ C;  2XN7 A;  7API A;  1HLE A;  1LQ8 A;  1OYH I;  1WZ9 A;  1JMJ A;  1NQ9 I;  2BEH I;  5CDX A;  1T1F A;  4GA7 A;  4G8R A;  2B4X I;  1E04 I;  4AU4 A;  1K9O I;  2VDX A;  2H4R A;  2PEF A;  1XU8 A;  2WXY C;  3R4L A;  3B9F I;  4ROB A;  2H4Q A;  1BY7 A;  1DVM A;  4EB1 I;  1D5S A;  1OPH A;  3ZHA A;  2ANT I;  2QUG A;  2ZNH A;  4Y40 A;  4AQH A;  4AU2 A;  4IF8 A;  2CEO A;  1JRR A;  1DZG L;  4DY7 C;  4R9I A;  4ROA A;  5CE0 A;  1EZX A;  2HIJ I;  4X30 A;  1SNG A;  2DUT A;  1SR5 A;  1AZX I;  1JVQ I;  3NE4 A;  1DZH L;  3Q03 A;  2ZV6 A;  1QMN A;  4DTE A;  5CDZ A; 
#chains in the Genus database with same CATH homology
 2VDY A;  1JTI A;  3LW2 A;  1BR8 I;  3CVM A;  3PB1 I;  1JMO A;  4AU3 A;  2RIW A;  1LJ5 A;  4ZK3 A;  5BRR I;  3F5N A;  1KCT A;  4RSQ A;  9PAI A;  4PYW A;  1PSI A;  3DRU A;  1E05 I;  1IMV A;  4IC0 A;  4RO9 A;  1OO8 A;  2B5T I;  1A7C A;  1MTP A;  2ARQ A;  4G8O A;  4CAA A;  1C5G A;  2GD4 C;  1E03 I;  3Q02 A;  5INW A;  2ACH A;  3CWL A;  3CAA A;  3VVJ A;  1F0C A;  4C49 A;  3NDD A;  2H4P A;  4P0F A;  2ARR A;  1IZ2 A;  1ATU A;  1JJO C;  4Y3K A;  1M93 B;  4C41 A;  1OYH L;  2WXZ A;  2BEH L;  1TB6 I;  1ANT I;  3UT3 A;  2OAY A;  3FGQ A;  2B4X L;  2HI9 A;  4DY0 A;  4AFX A;  2PEE A;  3CWM A;  3EVJ I;  2WXX A;  3NDA A;  1DZG I;  4AJT A;  1AS4 A;  2D26 A;  4EB1 L;  1UHG A;  3STO A;  8API A;  3DLW A;  4AU3 B;  2WY0 C;  1DZH I;  4P0O A;  4KDS A;  1OVA A;  5EI0 A;  5IO1 A;  3DRM A;  3PZF A;  2XN5 A;  2HIJ L;  1DB2 A;  1ATT A;  1C8O A;  2VH4 A;  1R1L I;  4YIA A;  1QMB A;  3KCG I;  2V95 A;  3T1P A;  1XQG A;  2XN3 A;  3F02 A;  2WY1 A;  1YXA A;  1OVA B;  2XN6 A;  3EOX A;  1B3K A;  1DVN A;  1OVA C;  1XQJ A;  3OZQ A;  2R9Y A;  3LE2 A;  2RIV A;  2WXW A;  1HP7 A;  4BB2 A;  3H5C A;  4ZK0 A;  4AJU A;  9API A;  1ATH A;  1SEK A;  2OL2 A;  3DY0 A;  3F1S A;  1QLP A;  1OC0 A;  5HGC A;  5C98 A;  3NDF A;  1LK6 I;  2WXZ C;  2XN7 A;  7API A;  1HLE A;  1LQ8 A;  1OYH I;  1WZ9 A;  1JMJ A;  1NQ9 I;  2BEH I;  5CDX A;  1T1F A;  4GA7 A;  4G8R A;  2B4X I;  1E04 I;  4AU4 A;  1K9O I;  2VDX A;  2H4R A;  2PEF A;  1XU8 A;  2WXY C;  3R4L A;  3B9F I;  4ROB A;  2H4Q A;  1BY7 A;  1DVM A;  4EB1 I;  1D5S A;  1OPH A;  3ZHA A;  2ANT I;  2QUG A;  2ZNH A;  4Y40 A;  4AQH A;  4AU2 A;  4IF8 A;  2CEO A;  1JRR A;  1DZG L;  4DY7 C;  4R9I A;  4ROA A;  5CE0 A;  1EZX A;  2HIJ I;  4X30 A;  1SNG A;  2DUT A;  1SR5 A;  1AZX I;  1JVQ I;  3NE4 A;  1DZH L;  3Q03 A;  2ZV6 A;  1QMN A;  4DTE A;  5CDZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...