3T1PA

Crystal structure of an alpha-1-antitrypsin trimer
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
371
structure length
371
Chain Sequence
NKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHSKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLCITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLCIDEKGTEAAGAMFLEAIPRSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords Alpha-1-antitrypsin
publication title Molecular basis of alpha 1-antitrypsin deficiency revealed by the structure of a domain-swapped trimer.
pubmed doi rcsb
source organism Homo sapiens
total genus 77
structure length 371
sequence length 371
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00079 Serpin Serpin (serine protease inhibitor)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.39.10 Mainly Beta Roll Alpha-1-antitrypsin; domain 1 Alpha-1-antitrypsin, domain 1 3t1pA02
3.30.497.10 Alpha Beta 2-Layer Sandwich Antithrombin; Chain I, domain 2 Antithrombin, subunit I, domain 2 3t1pA01
3Q03A 3PZFA 4DTEA 4AU3A 1AS4A 3LW2A 1JJOC 1C5GA 1XU8A 2D26A 3CAAA 4P0OA 3NDAA 1D5SA 2BEHI 3FGQA 4AU2A 2GD4C 5C98A 2WXWA 1OYHI 4ZK0A 1SR5A 1SEKA 3T1PA 5INWA 2WY0C 3CVMA 1PSIA 3F5NA 2DUTA 3DLWA 2CEOA 2WXYC 2XN6A 1KCTA 1OVAB 1LQ8A 4AQHA 1OVAC 4EB1L 5CDZA 2OL2A 1JMOA 1R1LI 1OVAA 4AFXA 5BRRI 3KCGI 3H5CA 2OAYA 4X30A 1DVMA 3VVJA 1SNGA 1JMJA 1DZHL 3NDDA 4BB2A 1ANTI 1B3KA 1JRRA 1WZ9A 1IZ2A 4ROAA 1ATTA 2WXXA 1UHGA 4ZK3A 9PAIA 1C8OA 1OO8A 4RSQA 4DY0A 2R9YA 2BEHL 2RIVA 5CDXA 1QMNA 1HLEA 3NDFA 4KDSA 4YIAA 1E05I 4R9IA 1OYHL 2ANTI 3LE2A 4C49A 1M93B 1OC0A 3EVJI 4IC0A 2HI9A 2B4XI 2VH4A 2VDYA 1YXAA 3R4LA 2PEEA 2VDXA 2WXZC 3Q02A 1JVQI 1IMVA 3STOA 3F02A 3CWLA 4RO9A 3NE4A 2V95A 2ZNHA 2B5TI 1A7CA 1DZGI 1T1FA 1MTPA 2XN5A 7APIA 2HIJI 3B9FI 1ATHA 2H4RA 4PYWA 4C41A 4ROBA 1HP7A 1JTIA 5EI0A 2H4PA 1AZXI 4G8OA 2XN7A 1DZHI 2XN3A 1ATUA 2ARQA 4DY7C 4AJUA 1XQJA 2ARRA 9APIA 4Y40A 4AU3B 3DY0A 1LJ5A 2ACHA 1EZXA 2RIWA 4P0FA 1LK6I 2WXZA 3OZQA 3CWMA 5HGCA 2PEFA 2ZV6A 1QMBA 1DB2A 2B4XL 4Y3KA 1OPHA 1QLPA 4GA7A 1TB6I 1E03I 2WY1A 1BY7A 3DRUA 1BR8I 3ZHAA 4EB1I 5CE0A 4IF8A 1DZGL 1K9OI 4AU4A 1XQGA 2HIJL 2QUGA 3EOXA 1NQ9I 2H4QA 5IO1A 1E04I 3F1SA 1F0CA 3DRMA 8APIA 4G8RA 4CAAA 3PB1I 3UT3A 4AJTA 1DVNA
chains in the Genus database with same CATH superfamily
3Q03A 3PZFA 4DTEA 4AU3A 1AS4A 3LW2A 1JJOC 1C5GA 1XU8A 2D26A 3CAAA 4P0OA 3NDAA 1D5SA 2BEHI 3FGQA 4AU2A 2GD4C 5C98A 2WXWA 1OYHI 4ZK0A 1SR5A 1SEKA 3T1PA 5INWA 2WY0C 3CVMA 1PSIA 3F5NA 2DUTA 3DLWA 2CEOA 2WXYC 2XN6A 1KCTA 1OVAB 1LQ8A 4AQHA 1OVAC 4EB1L 5CDZA 2OL2A 1JMOA 1R1LI 1OVAA 4AFXA 5BRRI 3KCGI 3H5CA 2OAYA 4X30A 1DVMA 3VVJA 1SNGA 1JMJA 1DZHL 3NDDA 4BB2A 1ANTI 1B3KA 1JRRA 1WZ9A 1IZ2A 4ROAA 1ATTA 2WXXA 1UHGA 4ZK3A 9PAIA 1C8OA 1OO8A 4RSQA 4DY0A 2R9YA 2BEHL 2RIVA 5CDXA 1QMNA 1HLEA 3NDFA 4KDSA 4YIAA 1E05I 4R9IA 1OYHL 2ANTI 3LE2A 4C49A 1M93B 1OC0A 3EVJI 4IC0A 2HI9A 2B4XI 2VH4A 2VDYA 1YXAA 3R4LA 2PEEA 2VDXA 2WXZC 3Q02A 1JVQI 1IMVA 3STOA 3F02A 3CWLA 4RO9A 3NE4A 2V95A 2ZNHA 2B5TI 1A7CA 1DZGI 1T1FA 1MTPA 2XN5A 7APIA 2HIJI 3B9FI 1ATHA 2H4RA 4PYWA 4C41A 4ROBA 1HP7A 1JTIA 5EI0A 2H4PA 1AZXI 4G8OA 2XN7A 1DZHI 2XN3A 1ATUA 2ARQA 4DY7C 4AJUA 1XQJA 2ARRA 9APIA 4Y40A 4AU3B 3DY0A 1LJ5A 2ACHA 1EZXA 2RIWA 4P0FA 1LK6I 2WXZA 3OZQA 3CWMA 5HGCA 2PEFA 2ZV6A 1QMBA 1DB2A 2B4XL 4Y3KA 1OPHA 1QLPA 4GA7A 1TB6I 1E03I 2WY1A 1BY7A 3DRUA 1BR8I 3ZHAA 4EB1I 5CE0A 4IF8A 1DZGL 1K9OI 4AU4A 1XQGA 2HIJL 2QUGA 3EOXA 1NQ9I 2H4QA 5IO1A 1E04I 3F1SA 1F0CA 3DRMA 8APIA 4G8RA 4CAAA 3PB1I 3UT3A 4AJTA 1DVNA
chains in the Genus database with same CATH topology
3Q03A 3PZFA 4DTEA 4AU3A 1AS4A 3LW2A 1JJOC 1C5GA 1XU8A 2D26A 3CAAA 4P0OA 3NDAA 1D5SA 2BEHI 3FGQA 4AU2A 2GD4C 5C98A 2WXWA 1OYHI 4ZK0A 1SR5A 1SEKA 3T1PA 5INWA 2WY0C 3CVMA 1PSIA 3F5NA 2DUTA 3DLWA 2CEOA 2WXYC 2XN6A 1KCTA 1OVAB 1LQ8A 4AQHA 1OVAC 4EB1L 5CDZA 2OL2A 1JMOA 1R1LI 1OVAA 4AFXA 5BRRI 3KCGI 3H5CA 2OAYA 4X30A 1DVMA 3VVJA 1SNGA 1JMJA 1DZHL 3NDDA 4BB2A 1ANTI 1B3KA 1JRRA 1WZ9A 1IZ2A 4ROAA 1ATTA 2WXXA 1UHGA 4ZK3A 9PAIA 1C8OA 1OO8A 4RSQA 4DY0A 2R9YA 2BEHL 2RIVA 5CDXA 1QMNA 1HLEA 3NDFA 4KDSA 4YIAA 1E05I 4R9IA 1OYHL 2ANTI 3LE2A 4C49A 1M93B 1OC0A 3EVJI 4IC0A 2HI9A 2B4XI 2VH4A 2VDYA 1YXAA 3R4LA 2PEEA 2VDXA 2WXZC 3Q02A 1JVQI 1IMVA 3STOA 3F02A 3CWLA 4RO9A 3NE4A 2V95A 2ZNHA 2B5TI 1A7CA 1DZGI 1T1FA 1MTPA 2XN5A 7APIA 2HIJI 3B9FI 1ATHA 2H4RA 4PYWA 4C41A 4ROBA 1HP7A 1JTIA 5EI0A 2H4PA 1AZXI 4G8OA 2XN7A 1DZHI 2XN3A 1ATUA 2ARQA 4DY7C 4AJUA 1XQJA 2ARRA 9APIA 4Y40A 4AU3B 3DY0A 1LJ5A 2ACHA 1EZXA 2RIWA 4P0FA 1LK6I 2WXZA 3OZQA 3CWMA 5HGCA 2PEFA 2ZV6A 1QMBA 1DB2A 2B4XL 4Y3KA 1OPHA 1QLPA 4GA7A 1TB6I 1E03I 2WY1A 1BY7A 3DRUA 1BR8I 3ZHAA 4EB1I 5CE0A 4IF8A 1DZGL 1K9OI 4AU4A 1XQGA 2HIJL 2QUGA 3EOXA 1NQ9I 2H4QA 5IO1A 1E04I 3F1SA 1F0CA 3DRMA 8APIA 4G8RA 4CAAA 3PB1I 3UT3A 4AJTA 1DVNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q03 A;  3PZF A;  4DTE A;  4AU3 A;  1AS4 A;  3LW2 A;  1JJO C;  1C5G A;  1XU8 A;  2D26 A;  3CAA A;  4P0O A;  3NDA A;  1D5S A;  2BEH I;  3FGQ A;  4AU2 A;  2GD4 C;  5C98 A;  2WXW A;  1OYH I;  4ZK0 A;  1SR5 A;  1SEK A;  3T1P A;  5INW A;  2WY0 C;  3CVM A;  1PSI A;  3F5N A;  2DUT A;  3DLW A;  2CEO A;  2WXY C;  2XN6 A;  1KCT A;  1OVA B;  1LQ8 A;  4AQH A;  1OVA C;  4EB1 L;  5CDZ A;  2OL2 A;  1JMO A;  1R1L I;  1OVA A;  4AFX A;  5BRR I;  3KCG I;  3H5C A;  2OAY A;  4X30 A;  1DVM A;  3VVJ A;  1SNG A;  1JMJ A;  1DZH L;  3NDD A;  4BB2 A;  1ANT I;  1B3K A;  1JRR A;  1WZ9 A;  1IZ2 A;  4ROA A;  1ATT A;  2WXX A;  1UHG A;  4ZK3 A;  9PAI A;  1C8O A;  1OO8 A;  4RSQ A;  4DY0 A;  2R9Y A;  2BEH L;  2RIV A;  5CDX A;  1QMN A;  1HLE A;  3NDF A;  4KDS A;  4YIA A;  1E05 I;  4R9I A;  1OYH L;  2ANT I;  3LE2 A;  4C49 A;  1M93 B;  1OC0 A;  3EVJ I;  4IC0 A;  2HI9 A;  2B4X I;  2VH4 A;  2VDY A;  1YXA A;  3R4L A;  2PEE A;  2VDX A;  2WXZ C;  3Q02 A;  1JVQ I;  1IMV A;  3STO A;  3F02 A;  3CWL A;  4RO9 A;  3NE4 A;  2V95 A;  2ZNH A;  2B5T I;  1A7C A;  1DZG I;  1T1F A;  1MTP A;  2XN5 A;  7API A;  2HIJ I;  3B9F I;  1ATH A;  2H4R A;  4PYW A;  4C41 A;  4ROB A;  1HP7 A;  1JTI A;  5EI0 A;  2H4P A;  1AZX I;  4G8O A;  2XN7 A;  1DZH I;  2XN3 A;  1ATU A;  2ARQ A;  4DY7 C;  4AJU A;  1XQJ A;  2ARR A;  9API A;  4Y40 A;  4AU3 B;  3DY0 A;  1LJ5 A;  2ACH A;  1EZX A;  2RIW A;  4P0F A;  1LK6 I;  2WXZ A;  3OZQ A;  3CWM A;  5HGC A;  2PEF A;  2ZV6 A;  1QMB A;  1DB2 A;  2B4X L;  4Y3K A;  1OPH A;  1QLP A;  4GA7 A;  1TB6 I;  1E03 I;  2WY1 A;  1BY7 A;  3DRU A;  1BR8 I;  3ZHA A;  4EB1 I;  5CE0 A;  4IF8 A;  1DZG L;  1K9O I;  4AU4 A;  1XQG A;  2HIJ L;  2QUG A;  3EOX A;  1NQ9 I;  2H4Q A;  5IO1 A;  1E04 I;  3F1S A;  1F0C A;  3DRM A;  8API A;  4G8R A;  4CAA A;  3PB1 I;  3UT3 A;  4AJT A;  1DVN A; 
#chains in the Genus database with same CATH topology
 3Q03 A;  3PZF A;  4DTE A;  4AU3 A;  1AS4 A;  3LW2 A;  1JJO C;  1C5G A;  1XU8 A;  2D26 A;  3CAA A;  4P0O A;  3NDA A;  1D5S A;  2BEH I;  3FGQ A;  4AU2 A;  2GD4 C;  5C98 A;  2WXW A;  1OYH I;  4ZK0 A;  1SR5 A;  1SEK A;  3T1P A;  5INW A;  2WY0 C;  3CVM A;  1PSI A;  3F5N A;  2DUT A;  3DLW A;  2CEO A;  2WXY C;  2XN6 A;  1KCT A;  1OVA B;  1LQ8 A;  4AQH A;  1OVA C;  4EB1 L;  5CDZ A;  2OL2 A;  1JMO A;  1R1L I;  1OVA A;  4AFX A;  5BRR I;  3KCG I;  3H5C A;  2OAY A;  4X30 A;  1DVM A;  3VVJ A;  1SNG A;  1JMJ A;  1DZH L;  3NDD A;  4BB2 A;  1ANT I;  1B3K A;  1JRR A;  1WZ9 A;  1IZ2 A;  4ROA A;  1ATT A;  2WXX A;  1UHG A;  4ZK3 A;  9PAI A;  1C8O A;  1OO8 A;  4RSQ A;  4DY0 A;  2R9Y A;  2BEH L;  2RIV A;  5CDX A;  1QMN A;  1HLE A;  3NDF A;  4KDS A;  4YIA A;  1E05 I;  4R9I A;  1OYH L;  2ANT I;  3LE2 A;  4C49 A;  1M93 B;  1OC0 A;  3EVJ I;  4IC0 A;  2HI9 A;  2B4X I;  2VH4 A;  2VDY A;  1YXA A;  3R4L A;  2PEE A;  2VDX A;  2WXZ C;  3Q02 A;  1JVQ I;  1IMV A;  3STO A;  3F02 A;  3CWL A;  4RO9 A;  3NE4 A;  2V95 A;  2ZNH A;  2B5T I;  1A7C A;  1DZG I;  1T1F A;  1MTP A;  2XN5 A;  7API A;  2HIJ I;  3B9F I;  1ATH A;  2H4R A;  4PYW A;  4C41 A;  4ROB A;  1HP7 A;  1JTI A;  5EI0 A;  2H4P A;  1AZX I;  4G8O A;  2XN7 A;  1DZH I;  2XN3 A;  1ATU A;  2ARQ A;  4DY7 C;  4AJU A;  1XQJ A;  2ARR A;  9API A;  4Y40 A;  4AU3 B;  3DY0 A;  1LJ5 A;  2ACH A;  1EZX A;  2RIW A;  4P0F A;  1LK6 I;  2WXZ A;  3OZQ A;  3CWM A;  5HGC A;  2PEF A;  2ZV6 A;  1QMB A;  1DB2 A;  2B4X L;  4Y3K A;  1OPH A;  1QLP A;  4GA7 A;  1TB6 I;  1E03 I;  2WY1 A;  1BY7 A;  3DRU A;  1BR8 I;  3ZHA A;  4EB1 I;  5CE0 A;  4IF8 A;  1DZG L;  1K9O I;  4AU4 A;  1XQG A;  2HIJ L;  2QUG A;  3EOX A;  1NQ9 I;  2H4Q A;  5IO1 A;  1E04 I;  3F1S A;  1F0C A;  3DRM A;  8API A;  4G8R A;  4CAA A;  3PB1 I;  3UT3 A;  4AJT A;  1DVN A; 
#chains in the Genus database with same CATH homology
 3Q03 A;  3PZF A;  4DTE A;  4AU3 A;  1AS4 A;  3LW2 A;  1JJO C;  1C5G A;  1XU8 A;  2D26 A;  3CAA A;  4P0O A;  3NDA A;  1D5S A;  2BEH I;  3FGQ A;  4AU2 A;  2GD4 C;  5C98 A;  2WXW A;  1OYH I;  4ZK0 A;  1SR5 A;  1SEK A;  3T1P A;  5INW A;  2WY0 C;  3CVM A;  1PSI A;  3F5N A;  2DUT A;  3DLW A;  2CEO A;  2WXY C;  2XN6 A;  1KCT A;  1OVA B;  1LQ8 A;  4AQH A;  1OVA C;  4EB1 L;  5CDZ A;  2OL2 A;  1JMO A;  1R1L I;  1OVA A;  4AFX A;  5BRR I;  3KCG I;  3H5C A;  2OAY A;  4X30 A;  1DVM A;  3VVJ A;  1SNG A;  1JMJ A;  1DZH L;  3NDD A;  4BB2 A;  1ANT I;  1B3K A;  1JRR A;  1WZ9 A;  1IZ2 A;  4ROA A;  1ATT A;  2WXX A;  1UHG A;  4ZK3 A;  9PAI A;  1C8O A;  1OO8 A;  4RSQ A;  4DY0 A;  2R9Y A;  2BEH L;  2RIV A;  5CDX A;  1QMN A;  1HLE A;  3NDF A;  4KDS A;  4YIA A;  1E05 I;  4R9I A;  1OYH L;  2ANT I;  3LE2 A;  4C49 A;  1M93 B;  1OC0 A;  3EVJ I;  4IC0 A;  2HI9 A;  2B4X I;  2VH4 A;  2VDY A;  1YXA A;  3R4L A;  2PEE A;  2VDX A;  2WXZ C;  3Q02 A;  1JVQ I;  1IMV A;  3STO A;  3F02 A;  3CWL A;  4RO9 A;  3NE4 A;  2V95 A;  2ZNH A;  2B5T I;  1A7C A;  1DZG I;  1T1F A;  1MTP A;  2XN5 A;  7API A;  2HIJ I;  3B9F I;  1ATH A;  2H4R A;  4PYW A;  4C41 A;  4ROB A;  1HP7 A;  1JTI A;  5EI0 A;  2H4P A;  1AZX I;  4G8O A;  2XN7 A;  1DZH I;  2XN3 A;  1ATU A;  2ARQ A;  4DY7 C;  4AJU A;  1XQJ A;  2ARR A;  9API A;  4Y40 A;  4AU3 B;  3DY0 A;  1LJ5 A;  2ACH A;  1EZX A;  2RIW A;  4P0F A;  1LK6 I;  2WXZ A;  3OZQ A;  3CWM A;  5HGC A;  2PEF A;  2ZV6 A;  1QMB A;  1DB2 A;  2B4X L;  4Y3K A;  1OPH A;  1QLP A;  4GA7 A;  1TB6 I;  1E03 I;  2WY1 A;  1BY7 A;  3DRU A;  1BR8 I;  3ZHA A;  4EB1 I;  5CE0 A;  4IF8 A;  1DZG L;  1K9O I;  4AU4 A;  1XQG A;  2HIJ L;  2QUG A;  3EOX A;  1NQ9 I;  2H4Q A;  5IO1 A;  1E04 I;  3F1S A;  1F0C A;  3DRM A;  8API A;  4G8R A;  4CAA A;  3PB1 I;  3UT3 A;  4AJT A;  1DVN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...