4AJTA

The crystal structure of mouse protein-z dependent protease inhibitor(mzpi)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
379
structure length
372
Chain Sequence
DEEYWLRASQQLSNETSSFGFNLLRKISMRHDGNVIFSPFGLSVAMVNLMLGTKGETKVQIENGLNLQALSQAGPLILPALFKKVKETFSSNRDLGLSQGSFAFIHKDFDIKETYFNLSKKYFDIEYVSINFQNSSQARGLINHCIVKETEGKIPKLFDEINPETKLILVDYVLFKGKWLTPFDPSFTEADTFHLDKYRAIKVPMMYREGNFTSTFDKKFRCHILKLPYQGNATMLVVLMEKTGDYLALEDYLTVDLVETWLQNMKTRKMEVFFPKFKLNQRYEMHELLKQMGIRRLFSTSADLSELSAMARNLQVSRVLQQSVLEVDERGTEEIIAYSMPPAIKVNRPFHFIIYEEMSRMLLFLGRVVNPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords PROTEIN Z-DEPENDENT PROTEASE INHIBITOR
publication title Structural Basis for Catalytic Activation of Protein Z-Dependent Protease Inhibitor (Zpi) by Protein Z.
pubmed doi rcsb
source organism Mus musculus
total genus 116
structure length 372
sequence length 379
ec nomenclature
pdb deposition date 2012-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00079 Serpin Serpin (serine protease inhibitor)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.39.10 Mainly Beta Roll Alpha-1-antitrypsin; domain 1 Alpha-1-antitrypsin, domain 1 4ajtA02
3.30.497.10 Alpha Beta 2-Layer Sandwich Antithrombin; Chain I, domain 2 Antithrombin, subunit I, domain 2 4ajtA01
1ATHA 2ZV6A 2ACHA 3B9FI 1DVNA 1HLEA 2HIJL 2PEEA 3EVJI 4C41A 5CDXA 1QMBA 2WY0C 1JTIA 1OYHI 2BEHI 1JMJA 2ZNHA 3H5CA 4IF8A 1R1LI 2B5TI 3CVMA 5INWA 2WY1A 3Q03A 1XQGA 3DY0A 5IO1A 7APIA 4P0OA 4Y40A 1OVAB 2XN6A 4G8RA 3CAAA 1OYHL 2BEHL 1LK6I 4AFXA 1XQJA 2OAYA 4AU3A 4CAAA 1HP7A 2HI9A 3PB1I 4BB2A 2H4RA 2XN3A 4ZK0A 3Q02A 3EOXA 1WZ9A 2XN7A 1M93B 1ATUA 1YXAA 1SR5A 2R9YA 4ROAA 4C49A 3LE2A 2D26A 4X30A 4AU2A 2V95A 3OZQA 1TB6I 9PAIA 3KCGI 1QLPA 1JVQI 4ZK3A 2PEFA 5BRRI 1DB2A 1OC0A 2QUGA 4Y3KA 2H4PA 1IZ2A 1E05I 3NE4A 4AU3B 1UHGA 3DRMA 2VDXA 3NDFA 4DY7C 1OVAC 1AS4A 2GD4C 2WXZC 4ROBA 4IC0A 1F0CA 3F02A 3VVJA 4YIAA 1OO8A 1DZHI 1EZXA 3F1SA 3NDDA 4RSQA 1SEKA 2WXYC 4EB1I 3FGQA 2ARQA 2H4QA 3F5NA 3LW2A 1E03I 1QMNA 3NDAA 4G8OA 1XU8A 1JRRA 2RIVA 2WXXA 1LQ8A 1SNGA 2B4XI 1C8OA 3PZFA 1DZHL 4RO9A 1NQ9I 3STOA 5CE0A 1MTPA 4DY0A 4EB1L 4R9IA 1JMOA 4AQHA 8APIA 5CDZA 1LJ5A 3ZHAA 5EI0A 1ANTI 1D5SA 3UT3A 1DZGI 1OPHA 1JJOC 4AJUA 2B4XL 2VDYA 3CWMA 4DTEA 4AJTA 1ATTA 2XN5A 1BY7A 2ARRA 2CEOA 2WXWA 1KCTA 1K9OI 3CWLA 2DUTA 3T1PA 1DZGL 1PSIA 2OL2A 4KDSA 3DRUA 1T1FA 1BR8I 1B3KA 4GA7A 1A7CA 2RIWA 2VH4A 3R4LA 2ANTI 5C98A 3DLWA 5HGCA 4AU4A 1AZXI 2HIJI 1OVAA 4PYWA 1E04I 1IMVA 1C5GA 2WXZA 9APIA 4P0FA 1DVMA
chains in the Genus database with same CATH superfamily
1ATHA 2ZV6A 2ACHA 3B9FI 1DVNA 1HLEA 2HIJL 2PEEA 3EVJI 4C41A 5CDXA 1QMBA 2WY0C 1JTIA 1OYHI 2BEHI 1JMJA 2ZNHA 3H5CA 4IF8A 1R1LI 2B5TI 3CVMA 5INWA 2WY1A 3Q03A 1XQGA 3DY0A 5IO1A 7APIA 4P0OA 4Y40A 1OVAB 2XN6A 4G8RA 3CAAA 1OYHL 2BEHL 1LK6I 4AFXA 1XQJA 2OAYA 4AU3A 4CAAA 1HP7A 2HI9A 3PB1I 4BB2A 2H4RA 2XN3A 4ZK0A 3Q02A 3EOXA 1WZ9A 2XN7A 1M93B 1ATUA 1YXAA 1SR5A 2R9YA 4ROAA 4C49A 3LE2A 2D26A 4X30A 4AU2A 2V95A 3OZQA 1TB6I 9PAIA 3KCGI 1QLPA 1JVQI 4ZK3A 2PEFA 5BRRI 1DB2A 1OC0A 2QUGA 4Y3KA 2H4PA 1IZ2A 1E05I 3NE4A 4AU3B 1UHGA 3DRMA 2VDXA 3NDFA 4DY7C 1OVAC 1AS4A 2GD4C 2WXZC 4ROBA 4IC0A 1F0CA 3F02A 3VVJA 4YIAA 1OO8A 1DZHI 1EZXA 3F1SA 3NDDA 4RSQA 1SEKA 2WXYC 4EB1I 3FGQA 2ARQA 2H4QA 3F5NA 3LW2A 1E03I 1QMNA 3NDAA 4G8OA 1XU8A 1JRRA 2RIVA 2WXXA 1LQ8A 1SNGA 2B4XI 1C8OA 3PZFA 1DZHL 4RO9A 1NQ9I 3STOA 5CE0A 1MTPA 4DY0A 4EB1L 4R9IA 1JMOA 4AQHA 8APIA 5CDZA 1LJ5A 3ZHAA 5EI0A 1ANTI 1D5SA 3UT3A 1DZGI 1OPHA 1JJOC 4AJUA 2B4XL 2VDYA 3CWMA 4DTEA 4AJTA 1ATTA 2XN5A 1BY7A 2ARRA 2CEOA 2WXWA 1KCTA 1K9OI 3CWLA 2DUTA 3T1PA 1DZGL 1PSIA 2OL2A 4KDSA 3DRUA 1T1FA 1BR8I 1B3KA 4GA7A 1A7CA 2RIWA 2VH4A 3R4LA 2ANTI 5C98A 3DLWA 5HGCA 4AU4A 1AZXI 2HIJI 1OVAA 4PYWA 1E04I 1IMVA 1C5GA 2WXZA 9APIA 4P0FA 1DVMA
chains in the Genus database with same CATH topology
1ATHA 2ZV6A 2ACHA 3B9FI 1DVNA 1HLEA 2HIJL 2PEEA 3EVJI 4C41A 5CDXA 1QMBA 2WY0C 1JTIA 1OYHI 2BEHI 1JMJA 2ZNHA 3H5CA 4IF8A 1R1LI 2B5TI 3CVMA 5INWA 2WY1A 3Q03A 1XQGA 3DY0A 5IO1A 7APIA 4P0OA 4Y40A 1OVAB 2XN6A 4G8RA 3CAAA 1OYHL 2BEHL 1LK6I 4AFXA 1XQJA 2OAYA 4AU3A 4CAAA 1HP7A 2HI9A 3PB1I 4BB2A 2H4RA 2XN3A 4ZK0A 3Q02A 3EOXA 1WZ9A 2XN7A 1M93B 1ATUA 1YXAA 1SR5A 2R9YA 4ROAA 4C49A 3LE2A 2D26A 4X30A 4AU2A 2V95A 3OZQA 1TB6I 9PAIA 3KCGI 1QLPA 1JVQI 4ZK3A 2PEFA 5BRRI 1DB2A 1OC0A 2QUGA 4Y3KA 2H4PA 1IZ2A 1E05I 3NE4A 4AU3B 1UHGA 3DRMA 2VDXA 3NDFA 4DY7C 1OVAC 1AS4A 2GD4C 2WXZC 4ROBA 4IC0A 1F0CA 3F02A 3VVJA 4YIAA 1OO8A 1DZHI 1EZXA 3F1SA 3NDDA 4RSQA 1SEKA 2WXYC 4EB1I 3FGQA 2ARQA 2H4QA 3F5NA 3LW2A 1E03I 1QMNA 3NDAA 4G8OA 1XU8A 1JRRA 2RIVA 2WXXA 1LQ8A 1SNGA 2B4XI 1C8OA 3PZFA 1DZHL 4RO9A 1NQ9I 3STOA 5CE0A 1MTPA 4DY0A 4EB1L 4R9IA 1JMOA 4AQHA 8APIA 5CDZA 1LJ5A 3ZHAA 5EI0A 1ANTI 1D5SA 3UT3A 1DZGI 1OPHA 1JJOC 4AJUA 2B4XL 2VDYA 3CWMA 4DTEA 4AJTA 1ATTA 2XN5A 1BY7A 2ARRA 2CEOA 2WXWA 1KCTA 1K9OI 3CWLA 2DUTA 3T1PA 1DZGL 1PSIA 2OL2A 4KDSA 3DRUA 1T1FA 1BR8I 1B3KA 4GA7A 1A7CA 2RIWA 2VH4A 3R4LA 2ANTI 5C98A 3DLWA 5HGCA 4AU4A 1AZXI 2HIJI 1OVAA 4PYWA 1E04I 1IMVA 1C5GA 2WXZA 9APIA 4P0FA 1DVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ATH A;  2ZV6 A;  2ACH A;  3B9F I;  1DVN A;  1HLE A;  2HIJ L;  2PEE A;  3EVJ I;  4C41 A;  5CDX A;  1QMB A;  2WY0 C;  1JTI A;  1OYH I;  2BEH I;  1JMJ A;  2ZNH A;  3H5C A;  4IF8 A;  1R1L I;  2B5T I;  3CVM A;  5INW A;  2WY1 A;  3Q03 A;  1XQG A;  3DY0 A;  5IO1 A;  7API A;  4P0O A;  4Y40 A;  1OVA B;  2XN6 A;  4G8R A;  3CAA A;  1OYH L;  2BEH L;  1LK6 I;  4AFX A;  1XQJ A;  2OAY A;  4AU3 A;  4CAA A;  1HP7 A;  2HI9 A;  3PB1 I;  4BB2 A;  2H4R A;  2XN3 A;  4ZK0 A;  3Q02 A;  3EOX A;  1WZ9 A;  2XN7 A;  1M93 B;  1ATU A;  1YXA A;  1SR5 A;  2R9Y A;  4ROA A;  4C49 A;  3LE2 A;  2D26 A;  4X30 A;  4AU2 A;  2V95 A;  3OZQ A;  1TB6 I;  9PAI A;  3KCG I;  1QLP A;  1JVQ I;  4ZK3 A;  2PEF A;  5BRR I;  1DB2 A;  1OC0 A;  2QUG A;  4Y3K A;  2H4P A;  1IZ2 A;  1E05 I;  3NE4 A;  4AU3 B;  1UHG A;  3DRM A;  2VDX A;  3NDF A;  4DY7 C;  1OVA C;  1AS4 A;  2GD4 C;  2WXZ C;  4ROB A;  4IC0 A;  1F0C A;  3F02 A;  3VVJ A;  4YIA A;  1OO8 A;  1DZH I;  1EZX A;  3F1S A;  3NDD A;  4RSQ A;  1SEK A;  2WXY C;  4EB1 I;  3FGQ A;  2ARQ A;  2H4Q A;  3F5N A;  3LW2 A;  1E03 I;  1QMN A;  3NDA A;  4G8O A;  1XU8 A;  1JRR A;  2RIV A;  2WXX A;  1LQ8 A;  1SNG A;  2B4X I;  1C8O A;  3PZF A;  1DZH L;  4RO9 A;  1NQ9 I;  3STO A;  5CE0 A;  1MTP A;  4DY0 A;  4EB1 L;  4R9I A;  1JMO A;  4AQH A;  8API A;  5CDZ A;  1LJ5 A;  3ZHA A;  5EI0 A;  1ANT I;  1D5S A;  3UT3 A;  1DZG I;  1OPH A;  1JJO C;  4AJU A;  2B4X L;  2VDY A;  3CWM A;  4DTE A;  4AJT A;  1ATT A;  2XN5 A;  1BY7 A;  2ARR A;  2CEO A;  2WXW A;  1KCT A;  1K9O I;  3CWL A;  2DUT A;  3T1P A;  1DZG L;  1PSI A;  2OL2 A;  4KDS A;  3DRU A;  1T1F A;  1BR8 I;  1B3K A;  4GA7 A;  1A7C A;  2RIW A;  2VH4 A;  3R4L A;  2ANT I;  5C98 A;  3DLW A;  5HGC A;  4AU4 A;  1AZX I;  2HIJ I;  1OVA A;  4PYW A;  1E04 I;  1IMV A;  1C5G A;  2WXZ A;  9API A;  4P0F A;  1DVM A; 
#chains in the Genus database with same CATH topology
 1ATH A;  2ZV6 A;  2ACH A;  3B9F I;  1DVN A;  1HLE A;  2HIJ L;  2PEE A;  3EVJ I;  4C41 A;  5CDX A;  1QMB A;  2WY0 C;  1JTI A;  1OYH I;  2BEH I;  1JMJ A;  2ZNH A;  3H5C A;  4IF8 A;  1R1L I;  2B5T I;  3CVM A;  5INW A;  2WY1 A;  3Q03 A;  1XQG A;  3DY0 A;  5IO1 A;  7API A;  4P0O A;  4Y40 A;  1OVA B;  2XN6 A;  4G8R A;  3CAA A;  1OYH L;  2BEH L;  1LK6 I;  4AFX A;  1XQJ A;  2OAY A;  4AU3 A;  4CAA A;  1HP7 A;  2HI9 A;  3PB1 I;  4BB2 A;  2H4R A;  2XN3 A;  4ZK0 A;  3Q02 A;  3EOX A;  1WZ9 A;  2XN7 A;  1M93 B;  1ATU A;  1YXA A;  1SR5 A;  2R9Y A;  4ROA A;  4C49 A;  3LE2 A;  2D26 A;  4X30 A;  4AU2 A;  2V95 A;  3OZQ A;  1TB6 I;  9PAI A;  3KCG I;  1QLP A;  1JVQ I;  4ZK3 A;  2PEF A;  5BRR I;  1DB2 A;  1OC0 A;  2QUG A;  4Y3K A;  2H4P A;  1IZ2 A;  1E05 I;  3NE4 A;  4AU3 B;  1UHG A;  3DRM A;  2VDX A;  3NDF A;  4DY7 C;  1OVA C;  1AS4 A;  2GD4 C;  2WXZ C;  4ROB A;  4IC0 A;  1F0C A;  3F02 A;  3VVJ A;  4YIA A;  1OO8 A;  1DZH I;  1EZX A;  3F1S A;  3NDD A;  4RSQ A;  1SEK A;  2WXY C;  4EB1 I;  3FGQ A;  2ARQ A;  2H4Q A;  3F5N A;  3LW2 A;  1E03 I;  1QMN A;  3NDA A;  4G8O A;  1XU8 A;  1JRR A;  2RIV A;  2WXX A;  1LQ8 A;  1SNG A;  2B4X I;  1C8O A;  3PZF A;  1DZH L;  4RO9 A;  1NQ9 I;  3STO A;  5CE0 A;  1MTP A;  4DY0 A;  4EB1 L;  4R9I A;  1JMO A;  4AQH A;  8API A;  5CDZ A;  1LJ5 A;  3ZHA A;  5EI0 A;  1ANT I;  1D5S A;  3UT3 A;  1DZG I;  1OPH A;  1JJO C;  4AJU A;  2B4X L;  2VDY A;  3CWM A;  4DTE A;  4AJT A;  1ATT A;  2XN5 A;  1BY7 A;  2ARR A;  2CEO A;  2WXW A;  1KCT A;  1K9O I;  3CWL A;  2DUT A;  3T1P A;  1DZG L;  1PSI A;  2OL2 A;  4KDS A;  3DRU A;  1T1F A;  1BR8 I;  1B3K A;  4GA7 A;  1A7C A;  2RIW A;  2VH4 A;  3R4L A;  2ANT I;  5C98 A;  3DLW A;  5HGC A;  4AU4 A;  1AZX I;  2HIJ I;  1OVA A;  4PYW A;  1E04 I;  1IMV A;  1C5G A;  2WXZ A;  9API A;  4P0F A;  1DVM A; 
#chains in the Genus database with same CATH homology
 1ATH A;  2ZV6 A;  2ACH A;  3B9F I;  1DVN A;  1HLE A;  2HIJ L;  2PEE A;  3EVJ I;  4C41 A;  5CDX A;  1QMB A;  2WY0 C;  1JTI A;  1OYH I;  2BEH I;  1JMJ A;  2ZNH A;  3H5C A;  4IF8 A;  1R1L I;  2B5T I;  3CVM A;  5INW A;  2WY1 A;  3Q03 A;  1XQG A;  3DY0 A;  5IO1 A;  7API A;  4P0O A;  4Y40 A;  1OVA B;  2XN6 A;  4G8R A;  3CAA A;  1OYH L;  2BEH L;  1LK6 I;  4AFX A;  1XQJ A;  2OAY A;  4AU3 A;  4CAA A;  1HP7 A;  2HI9 A;  3PB1 I;  4BB2 A;  2H4R A;  2XN3 A;  4ZK0 A;  3Q02 A;  3EOX A;  1WZ9 A;  2XN7 A;  1M93 B;  1ATU A;  1YXA A;  1SR5 A;  2R9Y A;  4ROA A;  4C49 A;  3LE2 A;  2D26 A;  4X30 A;  4AU2 A;  2V95 A;  3OZQ A;  1TB6 I;  9PAI A;  3KCG I;  1QLP A;  1JVQ I;  4ZK3 A;  2PEF A;  5BRR I;  1DB2 A;  1OC0 A;  2QUG A;  4Y3K A;  2H4P A;  1IZ2 A;  1E05 I;  3NE4 A;  4AU3 B;  1UHG A;  3DRM A;  2VDX A;  3NDF A;  4DY7 C;  1OVA C;  1AS4 A;  2GD4 C;  2WXZ C;  4ROB A;  4IC0 A;  1F0C A;  3F02 A;  3VVJ A;  4YIA A;  1OO8 A;  1DZH I;  1EZX A;  3F1S A;  3NDD A;  4RSQ A;  1SEK A;  2WXY C;  4EB1 I;  3FGQ A;  2ARQ A;  2H4Q A;  3F5N A;  3LW2 A;  1E03 I;  1QMN A;  3NDA A;  4G8O A;  1XU8 A;  1JRR A;  2RIV A;  2WXX A;  1LQ8 A;  1SNG A;  2B4X I;  1C8O A;  3PZF A;  1DZH L;  4RO9 A;  1NQ9 I;  3STO A;  5CE0 A;  1MTP A;  4DY0 A;  4EB1 L;  4R9I A;  1JMO A;  4AQH A;  8API A;  5CDZ A;  1LJ5 A;  3ZHA A;  5EI0 A;  1ANT I;  1D5S A;  3UT3 A;  1DZG I;  1OPH A;  1JJO C;  4AJU A;  2B4X L;  2VDY A;  3CWM A;  4DTE A;  4AJT A;  1ATT A;  2XN5 A;  1BY7 A;  2ARR A;  2CEO A;  2WXW A;  1KCT A;  1K9O I;  3CWL A;  2DUT A;  3T1P A;  1DZG L;  1PSI A;  2OL2 A;  4KDS A;  3DRU A;  1T1F A;  1BR8 I;  1B3K A;  4GA7 A;  1A7C A;  2RIW A;  2VH4 A;  3R4L A;  2ANT I;  5C98 A;  3DLW A;  5HGC A;  4AU4 A;  1AZX I;  2HIJ I;  1OVA A;  4PYW A;  1E04 I;  1IMV A;  1C5G A;  2WXZ A;  9API A;  4P0F A;  1DVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...