4P0FA

Cleaved serpin 42da (c 2 2 21)
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
384
structure length
369
Chain Sequence
AAHQEFARRLALFSINVYGKLSGQKPGENIVFSPFSIQTCAAMARLGAENETATQLDQGLGLASSDPEQIAHSFHQVLAAYQILRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDFSKNVQAAATINNWVEQRTNHLIKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLTVQVPMMSLKERFRYADLPALDAMALELPYKDSDLSMLIVLPNTKTGLPALEEKLRLTTLSQITQSLYETKVALKLPRFKAEFQVELSEVFQKLGMSRMFSDQAEFGKMLQSPEPLKVSAIIHKAFIEVNEEGTEAAAATGMAVRRKRPIEFFADHPFTYVLVHQDLPLFWGSVVRLEENTFASS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords Serine protease inhibitor 4, isoform B
publication title High resolution structure of cleaved Serpin 42 Da from Drosophila melanogaster.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 112
structure length 369
sequence length 384
ec nomenclature
pdb deposition date 2014-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00079 Serpin Serpin (serine protease inhibitor)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.39.10 Mainly Beta Roll Alpha-1-antitrypsin; domain 1 Alpha-1-antitrypsin, domain 1 4p0fA02
3.30.497.10 Alpha Beta 2-Layer Sandwich Antithrombin; Chain I, domain 2 Antithrombin, subunit I, domain 2 4p0fA01
1DZHL 4X30A 4DTEA 4DY0A 1SR5A 5CDXA 4AQHA 5IO1A 2RIWA 4P0FA 1OVAC 3Q02A 1DZGL 2BEHI 4G8OA 2HIJI 5HGCA 1A7CA 3KCGI 1E04I 1T1FA 3LW2A 1BY7A 2H4PA 3B9FI 1ATHA 4CAAA 2WY1A 2WXYC 3PB1I 2D26A 3CVMA 5CDZA 2XN7A 1E03I 3ZHAA 3CWMA 1C5GA 1JMJA 1JMOA 2WXWA 4ZK3A 4C49A 5EI0A 1LQ8A 3UT3A 5CE0A 2VDYA 2B5TI 1M93B 3CWLA 1K9OI 3CAAA 1AS4A 1OYHL 2V95A 3H5CA 3NDDA 3T1PA 7APIA 1F0CA 4G8RA 4ZK0A 8APIA 3EOXA 2ARRA 2WXXA 1XQJA 4GA7A 1MTPA 4R9IA 4DY7C 1EZXA 1QMNA 2XN5A 2R9YA 2HI9A 5INWA 4BB2A 1NQ9I 5BRRI 3F02A 1JRRA 1TB6I 2BEHL 2HIJL 2WXZA 2WXZC 4IC0A 9APIA 3OZQA 1BR8I 3NDFA 1DVNA 3EVJI 1AZXI 3PZFA 4Y3KA 1JVQI 2VH4A 4ROBA 1XU8A 1IZ2A 3F5NA 1OPHA 3DY0A 3DRUA 1LJ5A 3LE2A 1UHGA 2XN3A 4EB1I 1C8OA 2XN6A 1JTIA 1ATTA 1HP7A 1SNGA 2GD4C 4AU3A 1DZHI 4IF8A 1OC0A 4AU3B 4C41A 4AJTA 4KDSA 4AJUA 4AU2A 4AU4A 2ARQA 1DZGI 2CEOA 3F1SA 9PAIA 1WZ9A 1B3KA 2PEFA 1JJOC 3STOA 2OL2A 2ZV6A 2VDXA 4RO9A 3FGQA 2DUTA 2QUGA 2OAYA 1OVAA 2ACHA 1OVAB 1KCTA 1ATUA 2B4XI 1XQGA 4P0OA 4Y40A 3DLWA 1D5SA 1OO8A 2PEEA 2RIVA 1DVMA 3VVJA 5C98A 1HLEA 1IMVA 1DB2A 1SEKA 1PSIA 3R4LA 2WY0C 1QLPA 4RSQA 4YIAA 4PYWA 3NDAA 1YXAA 2H4RA 4ROAA 1OYHI 2B4XL 1R1LI 1QMBA 1LK6I 3Q03A 4EB1L 3DRMA 1E05I 2ANTI 4AFXA 1ANTI 3NE4A 2ZNHA 2H4QA
chains in the Genus database with same CATH superfamily
1DZHL 4X30A 4DTEA 4DY0A 1SR5A 5CDXA 4AQHA 5IO1A 2RIWA 4P0FA 1OVAC 3Q02A 1DZGL 2BEHI 4G8OA 2HIJI 5HGCA 1A7CA 3KCGI 1E04I 1T1FA 3LW2A 1BY7A 2H4PA 3B9FI 1ATHA 4CAAA 2WY1A 2WXYC 3PB1I 2D26A 3CVMA 5CDZA 2XN7A 1E03I 3ZHAA 3CWMA 1C5GA 1JMJA 1JMOA 2WXWA 4ZK3A 4C49A 5EI0A 1LQ8A 3UT3A 5CE0A 2VDYA 2B5TI 1M93B 3CWLA 1K9OI 3CAAA 1AS4A 1OYHL 2V95A 3H5CA 3NDDA 3T1PA 7APIA 1F0CA 4G8RA 4ZK0A 8APIA 3EOXA 2ARRA 2WXXA 1XQJA 4GA7A 1MTPA 4R9IA 4DY7C 1EZXA 1QMNA 2XN5A 2R9YA 2HI9A 5INWA 4BB2A 1NQ9I 5BRRI 3F02A 1JRRA 1TB6I 2BEHL 2HIJL 2WXZA 2WXZC 4IC0A 9APIA 3OZQA 1BR8I 3NDFA 1DVNA 3EVJI 1AZXI 3PZFA 4Y3KA 1JVQI 2VH4A 4ROBA 1XU8A 1IZ2A 3F5NA 1OPHA 3DY0A 3DRUA 1LJ5A 3LE2A 1UHGA 2XN3A 4EB1I 1C8OA 2XN6A 1JTIA 1ATTA 1HP7A 1SNGA 2GD4C 4AU3A 1DZHI 4IF8A 1OC0A 4AU3B 4C41A 4AJTA 4KDSA 4AJUA 4AU2A 4AU4A 2ARQA 1DZGI 2CEOA 3F1SA 9PAIA 1WZ9A 1B3KA 2PEFA 1JJOC 3STOA 2OL2A 2ZV6A 2VDXA 4RO9A 3FGQA 2DUTA 2QUGA 2OAYA 1OVAA 2ACHA 1OVAB 1KCTA 1ATUA 2B4XI 1XQGA 4P0OA 4Y40A 3DLWA 1D5SA 1OO8A 2PEEA 2RIVA 1DVMA 3VVJA 5C98A 1HLEA 1IMVA 1DB2A 1SEKA 1PSIA 3R4LA 2WY0C 1QLPA 4RSQA 4YIAA 4PYWA 3NDAA 1YXAA 2H4RA 4ROAA 1OYHI 2B4XL 1R1LI 1QMBA 1LK6I 3Q03A 4EB1L 3DRMA 1E05I 2ANTI 4AFXA 1ANTI 3NE4A 2ZNHA 2H4QA
chains in the Genus database with same CATH topology
1DZHL 4X30A 4DTEA 4DY0A 1SR5A 5CDXA 4AQHA 5IO1A 2RIWA 4P0FA 1OVAC 3Q02A 1DZGL 2BEHI 4G8OA 2HIJI 5HGCA 1A7CA 3KCGI 1E04I 1T1FA 3LW2A 1BY7A 2H4PA 3B9FI 1ATHA 4CAAA 2WY1A 2WXYC 3PB1I 2D26A 3CVMA 5CDZA 2XN7A 1E03I 3ZHAA 3CWMA 1C5GA 1JMJA 1JMOA 2WXWA 4ZK3A 4C49A 5EI0A 1LQ8A 3UT3A 5CE0A 2VDYA 2B5TI 1M93B 3CWLA 1K9OI 3CAAA 1AS4A 1OYHL 2V95A 3H5CA 3NDDA 3T1PA 7APIA 1F0CA 4G8RA 4ZK0A 8APIA 3EOXA 2ARRA 2WXXA 1XQJA 4GA7A 1MTPA 4R9IA 4DY7C 1EZXA 1QMNA 2XN5A 2R9YA 2HI9A 5INWA 4BB2A 1NQ9I 5BRRI 3F02A 1JRRA 1TB6I 2BEHL 2HIJL 2WXZA 2WXZC 4IC0A 9APIA 3OZQA 1BR8I 3NDFA 1DVNA 3EVJI 1AZXI 3PZFA 4Y3KA 1JVQI 2VH4A 4ROBA 1XU8A 1IZ2A 3F5NA 1OPHA 3DY0A 3DRUA 1LJ5A 3LE2A 1UHGA 2XN3A 4EB1I 1C8OA 2XN6A 1JTIA 1ATTA 1HP7A 1SNGA 2GD4C 4AU3A 1DZHI 4IF8A 1OC0A 4AU3B 4C41A 4AJTA 4KDSA 4AJUA 4AU2A 4AU4A 2ARQA 1DZGI 2CEOA 3F1SA 9PAIA 1WZ9A 1B3KA 2PEFA 1JJOC 3STOA 2OL2A 2ZV6A 2VDXA 4RO9A 3FGQA 2DUTA 2QUGA 2OAYA 1OVAA 2ACHA 1OVAB 1KCTA 1ATUA 2B4XI 1XQGA 4P0OA 4Y40A 3DLWA 1D5SA 1OO8A 2PEEA 2RIVA 1DVMA 3VVJA 5C98A 1HLEA 1IMVA 1DB2A 1SEKA 1PSIA 3R4LA 2WY0C 1QLPA 4RSQA 4YIAA 4PYWA 3NDAA 1YXAA 2H4RA 4ROAA 1OYHI 2B4XL 1R1LI 1QMBA 1LK6I 3Q03A 4EB1L 3DRMA 1E05I 2ANTI 4AFXA 1ANTI 3NE4A 2ZNHA 2H4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DZH L;  4X30 A;  4DTE A;  4DY0 A;  1SR5 A;  5CDX A;  4AQH A;  5IO1 A;  2RIW A;  4P0F A;  1OVA C;  3Q02 A;  1DZG L;  2BEH I;  4G8O A;  2HIJ I;  5HGC A;  1A7C A;  3KCG I;  1E04 I;  1T1F A;  3LW2 A;  1BY7 A;  2H4P A;  3B9F I;  1ATH A;  4CAA A;  2WY1 A;  2WXY C;  3PB1 I;  2D26 A;  3CVM A;  5CDZ A;  2XN7 A;  1E03 I;  3ZHA A;  3CWM A;  1C5G A;  1JMJ A;  1JMO A;  2WXW A;  4ZK3 A;  4C49 A;  5EI0 A;  1LQ8 A;  3UT3 A;  5CE0 A;  2VDY A;  2B5T I;  1M93 B;  3CWL A;  1K9O I;  3CAA A;  1AS4 A;  1OYH L;  2V95 A;  3H5C A;  3NDD A;  3T1P A;  7API A;  1F0C A;  4G8R A;  4ZK0 A;  8API A;  3EOX A;  2ARR A;  2WXX A;  1XQJ A;  4GA7 A;  1MTP A;  4R9I A;  4DY7 C;  1EZX A;  1QMN A;  2XN5 A;  2R9Y A;  2HI9 A;  5INW A;  4BB2 A;  1NQ9 I;  5BRR I;  3F02 A;  1JRR A;  1TB6 I;  2BEH L;  2HIJ L;  2WXZ A;  2WXZ C;  4IC0 A;  9API A;  3OZQ A;  1BR8 I;  3NDF A;  1DVN A;  3EVJ I;  1AZX I;  3PZF A;  4Y3K A;  1JVQ I;  2VH4 A;  4ROB A;  1XU8 A;  1IZ2 A;  3F5N A;  1OPH A;  3DY0 A;  3DRU A;  1LJ5 A;  3LE2 A;  1UHG A;  2XN3 A;  4EB1 I;  1C8O A;  2XN6 A;  1JTI A;  1ATT A;  1HP7 A;  1SNG A;  2GD4 C;  4AU3 A;  1DZH I;  4IF8 A;  1OC0 A;  4AU3 B;  4C41 A;  4AJT A;  4KDS A;  4AJU A;  4AU2 A;  4AU4 A;  2ARQ A;  1DZG I;  2CEO A;  3F1S A;  9PAI A;  1WZ9 A;  1B3K A;  2PEF A;  1JJO C;  3STO A;  2OL2 A;  2ZV6 A;  2VDX A;  4RO9 A;  3FGQ A;  2DUT A;  2QUG A;  2OAY A;  1OVA A;  2ACH A;  1OVA B;  1KCT A;  1ATU A;  2B4X I;  1XQG A;  4P0O A;  4Y40 A;  3DLW A;  1D5S A;  1OO8 A;  2PEE A;  2RIV A;  1DVM A;  3VVJ A;  5C98 A;  1HLE A;  1IMV A;  1DB2 A;  1SEK A;  1PSI A;  3R4L A;  2WY0 C;  1QLP A;  4RSQ A;  4YIA A;  4PYW A;  3NDA A;  1YXA A;  2H4R A;  4ROA A;  1OYH I;  2B4X L;  1R1L I;  1QMB A;  1LK6 I;  3Q03 A;  4EB1 L;  3DRM A;  1E05 I;  2ANT I;  4AFX A;  1ANT I;  3NE4 A;  2ZNH A;  2H4Q A; 
#chains in the Genus database with same CATH topology
 1DZH L;  4X30 A;  4DTE A;  4DY0 A;  1SR5 A;  5CDX A;  4AQH A;  5IO1 A;  2RIW A;  4P0F A;  1OVA C;  3Q02 A;  1DZG L;  2BEH I;  4G8O A;  2HIJ I;  5HGC A;  1A7C A;  3KCG I;  1E04 I;  1T1F A;  3LW2 A;  1BY7 A;  2H4P A;  3B9F I;  1ATH A;  4CAA A;  2WY1 A;  2WXY C;  3PB1 I;  2D26 A;  3CVM A;  5CDZ A;  2XN7 A;  1E03 I;  3ZHA A;  3CWM A;  1C5G A;  1JMJ A;  1JMO A;  2WXW A;  4ZK3 A;  4C49 A;  5EI0 A;  1LQ8 A;  3UT3 A;  5CE0 A;  2VDY A;  2B5T I;  1M93 B;  3CWL A;  1K9O I;  3CAA A;  1AS4 A;  1OYH L;  2V95 A;  3H5C A;  3NDD A;  3T1P A;  7API A;  1F0C A;  4G8R A;  4ZK0 A;  8API A;  3EOX A;  2ARR A;  2WXX A;  1XQJ A;  4GA7 A;  1MTP A;  4R9I A;  4DY7 C;  1EZX A;  1QMN A;  2XN5 A;  2R9Y A;  2HI9 A;  5INW A;  4BB2 A;  1NQ9 I;  5BRR I;  3F02 A;  1JRR A;  1TB6 I;  2BEH L;  2HIJ L;  2WXZ A;  2WXZ C;  4IC0 A;  9API A;  3OZQ A;  1BR8 I;  3NDF A;  1DVN A;  3EVJ I;  1AZX I;  3PZF A;  4Y3K A;  1JVQ I;  2VH4 A;  4ROB A;  1XU8 A;  1IZ2 A;  3F5N A;  1OPH A;  3DY0 A;  3DRU A;  1LJ5 A;  3LE2 A;  1UHG A;  2XN3 A;  4EB1 I;  1C8O A;  2XN6 A;  1JTI A;  1ATT A;  1HP7 A;  1SNG A;  2GD4 C;  4AU3 A;  1DZH I;  4IF8 A;  1OC0 A;  4AU3 B;  4C41 A;  4AJT A;  4KDS A;  4AJU A;  4AU2 A;  4AU4 A;  2ARQ A;  1DZG I;  2CEO A;  3F1S A;  9PAI A;  1WZ9 A;  1B3K A;  2PEF A;  1JJO C;  3STO A;  2OL2 A;  2ZV6 A;  2VDX A;  4RO9 A;  3FGQ A;  2DUT A;  2QUG A;  2OAY A;  1OVA A;  2ACH A;  1OVA B;  1KCT A;  1ATU A;  2B4X I;  1XQG A;  4P0O A;  4Y40 A;  3DLW A;  1D5S A;  1OO8 A;  2PEE A;  2RIV A;  1DVM A;  3VVJ A;  5C98 A;  1HLE A;  1IMV A;  1DB2 A;  1SEK A;  1PSI A;  3R4L A;  2WY0 C;  1QLP A;  4RSQ A;  4YIA A;  4PYW A;  3NDA A;  1YXA A;  2H4R A;  4ROA A;  1OYH I;  2B4X L;  1R1L I;  1QMB A;  1LK6 I;  3Q03 A;  4EB1 L;  3DRM A;  1E05 I;  2ANT I;  4AFX A;  1ANT I;  3NE4 A;  2ZNH A;  2H4Q A; 
#chains in the Genus database with same CATH homology
 1DZH L;  4X30 A;  4DTE A;  4DY0 A;  1SR5 A;  5CDX A;  4AQH A;  5IO1 A;  2RIW A;  4P0F A;  1OVA C;  3Q02 A;  1DZG L;  2BEH I;  4G8O A;  2HIJ I;  5HGC A;  1A7C A;  3KCG I;  1E04 I;  1T1F A;  3LW2 A;  1BY7 A;  2H4P A;  3B9F I;  1ATH A;  4CAA A;  2WY1 A;  2WXY C;  3PB1 I;  2D26 A;  3CVM A;  5CDZ A;  2XN7 A;  1E03 I;  3ZHA A;  3CWM A;  1C5G A;  1JMJ A;  1JMO A;  2WXW A;  4ZK3 A;  4C49 A;  5EI0 A;  1LQ8 A;  3UT3 A;  5CE0 A;  2VDY A;  2B5T I;  1M93 B;  3CWL A;  1K9O I;  3CAA A;  1AS4 A;  1OYH L;  2V95 A;  3H5C A;  3NDD A;  3T1P A;  7API A;  1F0C A;  4G8R A;  4ZK0 A;  8API A;  3EOX A;  2ARR A;  2WXX A;  1XQJ A;  4GA7 A;  1MTP A;  4R9I A;  4DY7 C;  1EZX A;  1QMN A;  2XN5 A;  2R9Y A;  2HI9 A;  5INW A;  4BB2 A;  1NQ9 I;  5BRR I;  3F02 A;  1JRR A;  1TB6 I;  2BEH L;  2HIJ L;  2WXZ A;  2WXZ C;  4IC0 A;  9API A;  3OZQ A;  1BR8 I;  3NDF A;  1DVN A;  3EVJ I;  1AZX I;  3PZF A;  4Y3K A;  1JVQ I;  2VH4 A;  4ROB A;  1XU8 A;  1IZ2 A;  3F5N A;  1OPH A;  3DY0 A;  3DRU A;  1LJ5 A;  3LE2 A;  1UHG A;  2XN3 A;  4EB1 I;  1C8O A;  2XN6 A;  1JTI A;  1ATT A;  1HP7 A;  1SNG A;  2GD4 C;  4AU3 A;  1DZH I;  4IF8 A;  1OC0 A;  4AU3 B;  4C41 A;  4AJT A;  4KDS A;  4AJU A;  4AU2 A;  4AU4 A;  2ARQ A;  1DZG I;  2CEO A;  3F1S A;  9PAI A;  1WZ9 A;  1B3K A;  2PEF A;  1JJO C;  3STO A;  2OL2 A;  2ZV6 A;  2VDX A;  4RO9 A;  3FGQ A;  2DUT A;  2QUG A;  2OAY A;  1OVA A;  2ACH A;  1OVA B;  1KCT A;  1ATU A;  2B4X I;  1XQG A;  4P0O A;  4Y40 A;  3DLW A;  1D5S A;  1OO8 A;  2PEE A;  2RIV A;  1DVM A;  3VVJ A;  5C98 A;  1HLE A;  1IMV A;  1DB2 A;  1SEK A;  1PSI A;  3R4L A;  2WY0 C;  1QLP A;  4RSQ A;  4YIA A;  4PYW A;  3NDA A;  1YXA A;  2H4R A;  4ROA A;  1OYH I;  2B4X L;  1R1L I;  1QMB A;  1LK6 I;  3Q03 A;  4EB1 L;  3DRM A;  1E05 I;  2ANT I;  4AFX A;  1ANT I;  3NE4 A;  2ZNH A;  2H4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...