4P0OA

Cleaved serpin 42da
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
Knots found
sequence length
378
structure length
371
Chain Sequence
AAHQEFARRLALFSINVYGKLSGQKPGENIVFSPFSIQTCAAMARLGAENETATQLDQGLGLASSDPEQIAHSFHQVLAAYQDSQILRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDFSKNVQAAATINNWVEQRTNHLIKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERTVQVPMMSLKERFRYADLPALDAMALELPYKDSDLSMLIVLPNTKTGLPALEEKLRLTTLSQITQSLYETKVALKLPRFKAEFQVELSEVFQKLGMSRMFSDQAEFGKMLQSPEPLKVSAIIHKAFIEVNEEGTEAAAATGMAVRRKEPIEFFADHPFTYVLVHQKDLPLFWGSVVRLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords Serine protease inhibitor 4, isoform B
publication title High resolution structure of cleaved Serpin 42 Da from Drosophila melanogaster.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 116
structure length 371
sequence length 378
other databases KnotProt 2.0: Artifct S 41 -31 -3
ec nomenclature
pdb deposition date 2014-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00079 Serpin Serpin (serine protease inhibitor)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.39.10 Mainly Beta Roll Alpha-1-antitrypsin; domain 1 Alpha-1-antitrypsin, domain 1 4p0oA02
3.30.497.10 Alpha Beta 2-Layer Sandwich Antithrombin; Chain I, domain 2 Antithrombin, subunit I, domain 2 4p0oA01
3Q03A 4AJUA 1D5SA 3Q02A 1WZ9A 2R9YA 1DB2A 1XQJA 3B9FI 1JMJA 4AU2A 2D26A 1SR5A 2VDYA 2WXXA 3EVJI 4AFXA 3EOXA 2V95A 2WY1A 1ATUA 7APIA 4C49A 1HP7A 1DVNA 1OVAC 3DY0A 4G8RA 4YIAA 1DZHI 1QMNA 5EI0A 1OVAA 1BY7A 3STOA 3CAAA 1C5GA 2DUTA 3NDDA 2ZV6A 1SEKA 3CWMA 3DRUA 1LK6I 2VH4A 2WXZC 2H4QA 1C8OA 1BR8I 1DVMA 1UHGA 2OL2A 1AZXI 1JTIA 5INWA 3LE2A 1QLPA 2WXYC 2OAYA 2XN3A 1ANTI 2B5TI 1YXAA 4AQHA 2XN6A 1E03I 2H4RA 1ATTA 2VDXA 3CWLA 1R1LI 4RO9A 4R9IA 2XN5A 1K9OI 4CAAA 2XN7A 2WXWA 2ZNHA 8APIA 5BRRI 1LQ8A 5C98A 2CEOA 1DZGI 1DZGL 1OYHI 1OYHL 1KCTA 4KDSA 4BB2A 4ROBA 4DY0A 1JVQI 3H5CA 1JMOA 4AU3A 1F0CA 2HIJI 2HIJL 3ZHAA 1OVAB 3CVMA 3LW2A 1AS4A 3OZQA 2WXZA 4AJTA 1T1FA 5IO1A 4ZK3A 2ARQA 5CE0A 1M93B 4GA7A 4IC0A 3F02A 4ZK0A 1E05I 1QMBA 1OPHA 1A7CA 5HGCA 2RIVA 1E04I 1EZXA 1IMVA 1OO8A 2B4XL 2RIWA 1PSIA 3F1SA 3R4LA 1B3KA 4RSQA 4X30A 1JJOC 1IZ2A 1SNGA 4PYWA 2BEHI 2BEHL 3T1PA 4Y40A 1JRRA 4IF8A 2QUGA 2PEFA 4AU4A 3NE4A 3VVJA 2WY0C 3UT3A 2GD4C 5CDZA 4Y3KA 1TB6I 3DRMA 4EB1I 1NQ9I 4EB1L 3NDFA 3NDAA 3F5NA 2ANTI 2PEEA 1XQGA 9PAIA 1OC0A 3FGQA 4P0FA 2ARRA 4DY7C 4G8OA 2H4PA 2HI9A 1MTPA 3KCGI 1HLEA 1DZHL 4ROAA 5CDXA 3DLWA 1ATHA 1XU8A 4AU3B 4P0OA 1LJ5A 3PB1I 4C41A 4DTEA 9APIA 2B4XI 2ACHA 3PZFA
chains in the Genus database with same CATH superfamily
3Q03A 4AJUA 1D5SA 3Q02A 1WZ9A 2R9YA 1DB2A 1XQJA 3B9FI 1JMJA 4AU2A 2D26A 1SR5A 2VDYA 2WXXA 3EVJI 4AFXA 3EOXA 2V95A 2WY1A 1ATUA 7APIA 4C49A 1HP7A 1DVNA 1OVAC 3DY0A 4G8RA 4YIAA 1DZHI 1QMNA 5EI0A 1OVAA 1BY7A 3STOA 3CAAA 1C5GA 2DUTA 3NDDA 2ZV6A 1SEKA 3CWMA 3DRUA 1LK6I 2VH4A 2WXZC 2H4QA 1C8OA 1BR8I 1DVMA 1UHGA 2OL2A 1AZXI 1JTIA 5INWA 3LE2A 1QLPA 2WXYC 2OAYA 2XN3A 1ANTI 2B5TI 1YXAA 4AQHA 2XN6A 1E03I 2H4RA 1ATTA 2VDXA 3CWLA 1R1LI 4RO9A 4R9IA 2XN5A 1K9OI 4CAAA 2XN7A 2WXWA 2ZNHA 8APIA 5BRRI 1LQ8A 5C98A 2CEOA 1DZGI 1DZGL 1OYHI 1OYHL 1KCTA 4KDSA 4BB2A 4ROBA 4DY0A 1JVQI 3H5CA 1JMOA 4AU3A 1F0CA 2HIJI 2HIJL 3ZHAA 1OVAB 3CVMA 3LW2A 1AS4A 3OZQA 2WXZA 4AJTA 1T1FA 5IO1A 4ZK3A 2ARQA 5CE0A 1M93B 4GA7A 4IC0A 3F02A 4ZK0A 1E05I 1QMBA 1OPHA 1A7CA 5HGCA 2RIVA 1E04I 1EZXA 1IMVA 1OO8A 2B4XL 2RIWA 1PSIA 3F1SA 3R4LA 1B3KA 4RSQA 4X30A 1JJOC 1IZ2A 1SNGA 4PYWA 2BEHI 2BEHL 3T1PA 4Y40A 1JRRA 4IF8A 2QUGA 2PEFA 4AU4A 3NE4A 3VVJA 2WY0C 3UT3A 2GD4C 5CDZA 4Y3KA 1TB6I 3DRMA 4EB1I 1NQ9I 4EB1L 3NDFA 3NDAA 3F5NA 2ANTI 2PEEA 1XQGA 9PAIA 1OC0A 3FGQA 4P0FA 2ARRA 4DY7C 4G8OA 2H4PA 2HI9A 1MTPA 3KCGI 1HLEA 1DZHL 4ROAA 5CDXA 3DLWA 1ATHA 1XU8A 4AU3B 4P0OA 1LJ5A 3PB1I 4C41A 4DTEA 9APIA 2B4XI 2ACHA 3PZFA
chains in the Genus database with same CATH topology
3Q03A 4AJUA 1D5SA 3Q02A 1WZ9A 2R9YA 1DB2A 1XQJA 3B9FI 1JMJA 4AU2A 2D26A 1SR5A 2VDYA 2WXXA 3EVJI 4AFXA 3EOXA 2V95A 2WY1A 1ATUA 7APIA 4C49A 1HP7A 1DVNA 1OVAC 3DY0A 4G8RA 4YIAA 1DZHI 1QMNA 5EI0A 1OVAA 1BY7A 3STOA 3CAAA 1C5GA 2DUTA 3NDDA 2ZV6A 1SEKA 3CWMA 3DRUA 1LK6I 2VH4A 2WXZC 2H4QA 1C8OA 1BR8I 1DVMA 1UHGA 2OL2A 1AZXI 1JTIA 5INWA 3LE2A 1QLPA 2WXYC 2OAYA 2XN3A 1ANTI 2B5TI 1YXAA 4AQHA 2XN6A 1E03I 2H4RA 1ATTA 2VDXA 3CWLA 1R1LI 4RO9A 4R9IA 2XN5A 1K9OI 4CAAA 2XN7A 2WXWA 2ZNHA 8APIA 5BRRI 1LQ8A 5C98A 2CEOA 1DZGI 1DZGL 1OYHI 1OYHL 1KCTA 4KDSA 4BB2A 4ROBA 4DY0A 1JVQI 3H5CA 1JMOA 4AU3A 1F0CA 2HIJI 2HIJL 3ZHAA 1OVAB 3CVMA 3LW2A 1AS4A 3OZQA 2WXZA 4AJTA 1T1FA 5IO1A 4ZK3A 2ARQA 5CE0A 1M93B 4GA7A 4IC0A 3F02A 4ZK0A 1E05I 1QMBA 1OPHA 1A7CA 5HGCA 2RIVA 1E04I 1EZXA 1IMVA 1OO8A 2B4XL 2RIWA 1PSIA 3F1SA 3R4LA 1B3KA 4RSQA 4X30A 1JJOC 1IZ2A 1SNGA 4PYWA 2BEHI 2BEHL 3T1PA 4Y40A 1JRRA 4IF8A 2QUGA 2PEFA 4AU4A 3NE4A 3VVJA 2WY0C 3UT3A 2GD4C 5CDZA 4Y3KA 1TB6I 3DRMA 4EB1I 1NQ9I 4EB1L 3NDFA 3NDAA 3F5NA 2ANTI 2PEEA 1XQGA 9PAIA 1OC0A 3FGQA 4P0FA 2ARRA 4DY7C 4G8OA 2H4PA 2HI9A 1MTPA 3KCGI 1HLEA 1DZHL 4ROAA 5CDXA 3DLWA 1ATHA 1XU8A 4AU3B 4P0OA 1LJ5A 3PB1I 4C41A 4DTEA 9APIA 2B4XI 2ACHA 3PZFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q03 A;  4AJU A;  1D5S A;  3Q02 A;  1WZ9 A;  2R9Y A;  1DB2 A;  1XQJ A;  3B9F I;  1JMJ A;  4AU2 A;  2D26 A;  1SR5 A;  2VDY A;  2WXX A;  3EVJ I;  4AFX A;  3EOX A;  2V95 A;  2WY1 A;  1ATU A;  7API A;  4C49 A;  1HP7 A;  1DVN A;  1OVA C;  3DY0 A;  4G8R A;  4YIA A;  1DZH I;  1QMN A;  5EI0 A;  1OVA A;  1BY7 A;  3STO A;  3CAA A;  1C5G A;  2DUT A;  3NDD A;  2ZV6 A;  1SEK A;  3CWM A;  3DRU A;  1LK6 I;  2VH4 A;  2WXZ C;  2H4Q A;  1C8O A;  1BR8 I;  1DVM A;  1UHG A;  2OL2 A;  1AZX I;  1JTI A;  5INW A;  3LE2 A;  1QLP A;  2WXY C;  2OAY A;  2XN3 A;  1ANT I;  2B5T I;  1YXA A;  4AQH A;  2XN6 A;  1E03 I;  2H4R A;  1ATT A;  2VDX A;  3CWL A;  1R1L I;  4RO9 A;  4R9I A;  2XN5 A;  1K9O I;  4CAA A;  2XN7 A;  2WXW A;  2ZNH A;  8API A;  5BRR I;  1LQ8 A;  5C98 A;  2CEO A;  1DZG I;  1DZG L;  1OYH I;  1OYH L;  1KCT A;  4KDS A;  4BB2 A;  4ROB A;  4DY0 A;  1JVQ I;  3H5C A;  1JMO A;  4AU3 A;  1F0C A;  2HIJ I;  2HIJ L;  3ZHA A;  1OVA B;  3CVM A;  3LW2 A;  1AS4 A;  3OZQ A;  2WXZ A;  4AJT A;  1T1F A;  5IO1 A;  4ZK3 A;  2ARQ A;  5CE0 A;  1M93 B;  4GA7 A;  4IC0 A;  3F02 A;  4ZK0 A;  1E05 I;  1QMB A;  1OPH A;  1A7C A;  5HGC A;  2RIV A;  1E04 I;  1EZX A;  1IMV A;  1OO8 A;  2B4X L;  2RIW A;  1PSI A;  3F1S A;  3R4L A;  1B3K A;  4RSQ A;  4X30 A;  1JJO C;  1IZ2 A;  1SNG A;  4PYW A;  2BEH I;  2BEH L;  3T1P A;  4Y40 A;  1JRR A;  4IF8 A;  2QUG A;  2PEF A;  4AU4 A;  3NE4 A;  3VVJ A;  2WY0 C;  3UT3 A;  2GD4 C;  5CDZ A;  4Y3K A;  1TB6 I;  3DRM A;  4EB1 I;  1NQ9 I;  4EB1 L;  3NDF A;  3NDA A;  3F5N A;  2ANT I;  2PEE A;  1XQG A;  9PAI A;  1OC0 A;  3FGQ A;  4P0F A;  2ARR A;  4DY7 C;  4G8O A;  2H4P A;  2HI9 A;  1MTP A;  3KCG I;  1HLE A;  1DZH L;  4ROA A;  5CDX A;  3DLW A;  1ATH A;  1XU8 A;  4AU3 B;  4P0O A;  1LJ5 A;  3PB1 I;  4C41 A;  4DTE A;  9API A;  2B4X I;  2ACH A;  3PZF A; 
#chains in the Genus database with same CATH topology
 3Q03 A;  4AJU A;  1D5S A;  3Q02 A;  1WZ9 A;  2R9Y A;  1DB2 A;  1XQJ A;  3B9F I;  1JMJ A;  4AU2 A;  2D26 A;  1SR5 A;  2VDY A;  2WXX A;  3EVJ I;  4AFX A;  3EOX A;  2V95 A;  2WY1 A;  1ATU A;  7API A;  4C49 A;  1HP7 A;  1DVN A;  1OVA C;  3DY0 A;  4G8R A;  4YIA A;  1DZH I;  1QMN A;  5EI0 A;  1OVA A;  1BY7 A;  3STO A;  3CAA A;  1C5G A;  2DUT A;  3NDD A;  2ZV6 A;  1SEK A;  3CWM A;  3DRU A;  1LK6 I;  2VH4 A;  2WXZ C;  2H4Q A;  1C8O A;  1BR8 I;  1DVM A;  1UHG A;  2OL2 A;  1AZX I;  1JTI A;  5INW A;  3LE2 A;  1QLP A;  2WXY C;  2OAY A;  2XN3 A;  1ANT I;  2B5T I;  1YXA A;  4AQH A;  2XN6 A;  1E03 I;  2H4R A;  1ATT A;  2VDX A;  3CWL A;  1R1L I;  4RO9 A;  4R9I A;  2XN5 A;  1K9O I;  4CAA A;  2XN7 A;  2WXW A;  2ZNH A;  8API A;  5BRR I;  1LQ8 A;  5C98 A;  2CEO A;  1DZG I;  1DZG L;  1OYH I;  1OYH L;  1KCT A;  4KDS A;  4BB2 A;  4ROB A;  4DY0 A;  1JVQ I;  3H5C A;  1JMO A;  4AU3 A;  1F0C A;  2HIJ I;  2HIJ L;  3ZHA A;  1OVA B;  3CVM A;  3LW2 A;  1AS4 A;  3OZQ A;  2WXZ A;  4AJT A;  1T1F A;  5IO1 A;  4ZK3 A;  2ARQ A;  5CE0 A;  1M93 B;  4GA7 A;  4IC0 A;  3F02 A;  4ZK0 A;  1E05 I;  1QMB A;  1OPH A;  1A7C A;  5HGC A;  2RIV A;  1E04 I;  1EZX A;  1IMV A;  1OO8 A;  2B4X L;  2RIW A;  1PSI A;  3F1S A;  3R4L A;  1B3K A;  4RSQ A;  4X30 A;  1JJO C;  1IZ2 A;  1SNG A;  4PYW A;  2BEH I;  2BEH L;  3T1P A;  4Y40 A;  1JRR A;  4IF8 A;  2QUG A;  2PEF A;  4AU4 A;  3NE4 A;  3VVJ A;  2WY0 C;  3UT3 A;  2GD4 C;  5CDZ A;  4Y3K A;  1TB6 I;  3DRM A;  4EB1 I;  1NQ9 I;  4EB1 L;  3NDF A;  3NDA A;  3F5N A;  2ANT I;  2PEE A;  1XQG A;  9PAI A;  1OC0 A;  3FGQ A;  4P0F A;  2ARR A;  4DY7 C;  4G8O A;  2H4P A;  2HI9 A;  1MTP A;  3KCG I;  1HLE A;  1DZH L;  4ROA A;  5CDX A;  3DLW A;  1ATH A;  1XU8 A;  4AU3 B;  4P0O A;  1LJ5 A;  3PB1 I;  4C41 A;  4DTE A;  9API A;  2B4X I;  2ACH A;  3PZF A; 
#chains in the Genus database with same CATH homology
 3Q03 A;  4AJU A;  1D5S A;  3Q02 A;  1WZ9 A;  2R9Y A;  1DB2 A;  1XQJ A;  3B9F I;  1JMJ A;  4AU2 A;  2D26 A;  1SR5 A;  2VDY A;  2WXX A;  3EVJ I;  4AFX A;  3EOX A;  2V95 A;  2WY1 A;  1ATU A;  7API A;  4C49 A;  1HP7 A;  1DVN A;  1OVA C;  3DY0 A;  4G8R A;  4YIA A;  1DZH I;  1QMN A;  5EI0 A;  1OVA A;  1BY7 A;  3STO A;  3CAA A;  1C5G A;  2DUT A;  3NDD A;  2ZV6 A;  1SEK A;  3CWM A;  3DRU A;  1LK6 I;  2VH4 A;  2WXZ C;  2H4Q A;  1C8O A;  1BR8 I;  1DVM A;  1UHG A;  2OL2 A;  1AZX I;  1JTI A;  5INW A;  3LE2 A;  1QLP A;  2WXY C;  2OAY A;  2XN3 A;  1ANT I;  2B5T I;  1YXA A;  4AQH A;  2XN6 A;  1E03 I;  2H4R A;  1ATT A;  2VDX A;  3CWL A;  1R1L I;  4RO9 A;  4R9I A;  2XN5 A;  1K9O I;  4CAA A;  2XN7 A;  2WXW A;  2ZNH A;  8API A;  5BRR I;  1LQ8 A;  5C98 A;  2CEO A;  1DZG I;  1DZG L;  1OYH I;  1OYH L;  1KCT A;  4KDS A;  4BB2 A;  4ROB A;  4DY0 A;  1JVQ I;  3H5C A;  1JMO A;  4AU3 A;  1F0C A;  2HIJ I;  2HIJ L;  3ZHA A;  1OVA B;  3CVM A;  3LW2 A;  1AS4 A;  3OZQ A;  2WXZ A;  4AJT A;  1T1F A;  5IO1 A;  4ZK3 A;  2ARQ A;  5CE0 A;  1M93 B;  4GA7 A;  4IC0 A;  3F02 A;  4ZK0 A;  1E05 I;  1QMB A;  1OPH A;  1A7C A;  5HGC A;  2RIV A;  1E04 I;  1EZX A;  1IMV A;  1OO8 A;  2B4X L;  2RIW A;  1PSI A;  3F1S A;  3R4L A;  1B3K A;  4RSQ A;  4X30 A;  1JJO C;  1IZ2 A;  1SNG A;  4PYW A;  2BEH I;  2BEH L;  3T1P A;  4Y40 A;  1JRR A;  4IF8 A;  2QUG A;  2PEF A;  4AU4 A;  3NE4 A;  3VVJ A;  2WY0 C;  3UT3 A;  2GD4 C;  5CDZ A;  4Y3K A;  1TB6 I;  3DRM A;  4EB1 I;  1NQ9 I;  4EB1 L;  3NDF A;  3NDA A;  3F5N A;  2ANT I;  2PEE A;  1XQG A;  9PAI A;  1OC0 A;  3FGQ A;  4P0F A;  2ARR A;  4DY7 C;  4G8O A;  2H4P A;  2HI9 A;  1MTP A;  3KCG I;  1HLE A;  1DZH L;  4ROA A;  5CDX A;  3DLW A;  1ATH A;  1XU8 A;  4AU3 B;  4P0O A;  1LJ5 A;  3PB1 I;  4C41 A;  4DTE A;  9API A;  2B4X I;  2ACH A;  3PZF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...