4PYWA

1.92 angstrom crystal structure of a1at:ttai ternary complex
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
371
structure length
362
Chain Sequence
FNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTLSKAVHKAVLTIDEKGTEAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords Alpha-1-antitrypsin
publication title An integrative approach combining ion mobility mass spectrometry, X-ray crystallography and NMR spectroscopy to study the conformational dynamics of alpha 1 -antitrypsin upon ligand binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 362
sequence length 371
ec nomenclature
pdb deposition date 2014-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00079 Serpin Serpin (serine protease inhibitor)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.39.10 Mainly Beta Roll Alpha-1-antitrypsin; domain 1 Alpha-1-antitrypsin, domain 1 4pywA02
3.30.497.10 Alpha Beta 2-Layer Sandwich Antithrombin; Chain I, domain 2 Antithrombin, subunit I, domain 2 4pywA01
2RIWA 4IF8A 4C41A 2D26A 2HIJI 1E05I 2R9YA 1IZ2A 2WY0C 3VVJA 3PB1I 4ZK3A 4DY7C 1BY7A 2ZV6A 1T1FA 3EVJI 1ANTI 2WXZC 4AU3A 3NDFA 4AFXA 2OAYA 5BRRI 1R1LI 4R9IA 2B5TI 1JJOC 2ZNHA 4PYWA 4EB1L 1C8OA 1EZXA 1OYHL 9PAIA 4X30A 3CAAA 3DRMA 1E03I 3KCGI 3DLWA 4ROBA 3UT3A 4AU3B 4AJTA 4GA7A 4EB1I 4ZK0A 1KCTA 1A7CA 1OYHI 2H4PA 2DUTA 3DRUA 4P0FA 1E04I 1LJ5A 1QMBA 1OO8A 3F1SA 1XQGA 1F0CA 1JRRA 5CE0A 1WZ9A 2B4XL 2CEOA 1JMOA 2V95A 2XN3A 3NE4A 1XU8A 2B4XI 1JVQI 9APIA 1DB2A 3ZHAA 1LK6I 1D5SA 1OVAA 1DVNA 3NDDA 1DZGL 3CVMA 3LW2A 4ROAA 1C5GA 1DVMA 1JTIA 4DTEA 1PSIA 1DZGI 1ATTA 3NDAA 1K9OI 1OPHA 1ATHA 1OVAB 2ARRA 3R4LA 2PEFA 3DY0A 3F5NA 2WXYC 5IO1A 4AQHA 3H5CA 2WXXA 2WXWA 3Q03A 5C98A 3OZQA 4RSQA 3F02A 2RIVA 4BB2A 3PZFA 4AJUA 5CDXA 4AU4A 2VDXA 7APIA 3CWLA 2QUGA 1AS4A 4KDSA 4YIAA 1HLEA 3STOA 1DZHI 1SNGA 5CDZA 1TB6I 1MTPA 2XN5A 2H4QA 1QLPA 4G8RA 2BEHL 3Q02A 1OC0A 1LQ8A 1IMVA 2BEHI 3FGQA 2ARQA 1HP7A 2VDYA 2WXZA 1OVAC 3CWMA 3EOXA 1AZXI 1ATUA 5INWA 4C49A 4AU2A 3B9FI 1SR5A 4G8OA 2HI9A 8APIA 4DY0A 2OL2A 1YXAA 2ACHA 1NQ9I 1BR8I 1QMNA 1UHGA 4RO9A 5EI0A 1XQJA 1M93B 1DZHL 4Y40A 2GD4C 2XN6A 3T1PA 1JMJA 2VH4A 4P0OA 2XN7A 2H4RA 3LE2A 5HGCA 1SEKA 4Y3KA 2ANTI 2WY1A 4CAAA 2PEEA 4IC0A 2HIJL 1B3KA
chains in the Genus database with same CATH superfamily
2RIWA 4IF8A 4C41A 2D26A 2HIJI 1E05I 2R9YA 1IZ2A 2WY0C 3VVJA 3PB1I 4ZK3A 4DY7C 1BY7A 2ZV6A 1T1FA 3EVJI 1ANTI 2WXZC 4AU3A 3NDFA 4AFXA 2OAYA 5BRRI 1R1LI 4R9IA 2B5TI 1JJOC 2ZNHA 4PYWA 4EB1L 1C8OA 1EZXA 1OYHL 9PAIA 4X30A 3CAAA 3DRMA 1E03I 3KCGI 3DLWA 4ROBA 3UT3A 4AU3B 4AJTA 4GA7A 4EB1I 4ZK0A 1KCTA 1A7CA 1OYHI 2H4PA 2DUTA 3DRUA 4P0FA 1E04I 1LJ5A 1QMBA 1OO8A 3F1SA 1XQGA 1F0CA 1JRRA 5CE0A 1WZ9A 2B4XL 2CEOA 1JMOA 2V95A 2XN3A 3NE4A 1XU8A 2B4XI 1JVQI 9APIA 1DB2A 3ZHAA 1LK6I 1D5SA 1OVAA 1DVNA 3NDDA 1DZGL 3CVMA 3LW2A 4ROAA 1C5GA 1DVMA 1JTIA 4DTEA 1PSIA 1DZGI 1ATTA 3NDAA 1K9OI 1OPHA 1ATHA 1OVAB 2ARRA 3R4LA 2PEFA 3DY0A 3F5NA 2WXYC 5IO1A 4AQHA 3H5CA 2WXXA 2WXWA 3Q03A 5C98A 3OZQA 4RSQA 3F02A 2RIVA 4BB2A 3PZFA 4AJUA 5CDXA 4AU4A 2VDXA 7APIA 3CWLA 2QUGA 1AS4A 4KDSA 4YIAA 1HLEA 3STOA 1DZHI 1SNGA 5CDZA 1TB6I 1MTPA 2XN5A 2H4QA 1QLPA 4G8RA 2BEHL 3Q02A 1OC0A 1LQ8A 1IMVA 2BEHI 3FGQA 2ARQA 1HP7A 2VDYA 2WXZA 1OVAC 3CWMA 3EOXA 1AZXI 1ATUA 5INWA 4C49A 4AU2A 3B9FI 1SR5A 4G8OA 2HI9A 8APIA 4DY0A 2OL2A 1YXAA 2ACHA 1NQ9I 1BR8I 1QMNA 1UHGA 4RO9A 5EI0A 1XQJA 1M93B 1DZHL 4Y40A 2GD4C 2XN6A 3T1PA 1JMJA 2VH4A 4P0OA 2XN7A 2H4RA 3LE2A 5HGCA 1SEKA 4Y3KA 2ANTI 2WY1A 4CAAA 2PEEA 4IC0A 2HIJL 1B3KA
chains in the Genus database with same CATH topology
2RIWA 4IF8A 4C41A 2D26A 2HIJI 1E05I 2R9YA 1IZ2A 2WY0C 3VVJA 3PB1I 4ZK3A 4DY7C 1BY7A 2ZV6A 1T1FA 3EVJI 1ANTI 2WXZC 4AU3A 3NDFA 4AFXA 2OAYA 5BRRI 1R1LI 4R9IA 2B5TI 1JJOC 2ZNHA 4PYWA 4EB1L 1C8OA 1EZXA 1OYHL 9PAIA 4X30A 3CAAA 3DRMA 1E03I 3KCGI 3DLWA 4ROBA 3UT3A 4AU3B 4AJTA 4GA7A 4EB1I 4ZK0A 1KCTA 1A7CA 1OYHI 2H4PA 2DUTA 3DRUA 4P0FA 1E04I 1LJ5A 1QMBA 1OO8A 3F1SA 1XQGA 1F0CA 1JRRA 5CE0A 1WZ9A 2B4XL 2CEOA 1JMOA 2V95A 2XN3A 3NE4A 1XU8A 2B4XI 1JVQI 9APIA 1DB2A 3ZHAA 1LK6I 1D5SA 1OVAA 1DVNA 3NDDA 1DZGL 3CVMA 3LW2A 4ROAA 1C5GA 1DVMA 1JTIA 4DTEA 1PSIA 1DZGI 1ATTA 3NDAA 1K9OI 1OPHA 1ATHA 1OVAB 2ARRA 3R4LA 2PEFA 3DY0A 3F5NA 2WXYC 5IO1A 4AQHA 3H5CA 2WXXA 2WXWA 3Q03A 5C98A 3OZQA 4RSQA 3F02A 2RIVA 4BB2A 3PZFA 4AJUA 5CDXA 4AU4A 2VDXA 7APIA 3CWLA 2QUGA 1AS4A 4KDSA 4YIAA 1HLEA 3STOA 1DZHI 1SNGA 5CDZA 1TB6I 1MTPA 2XN5A 2H4QA 1QLPA 4G8RA 2BEHL 3Q02A 1OC0A 1LQ8A 1IMVA 2BEHI 3FGQA 2ARQA 1HP7A 2VDYA 2WXZA 1OVAC 3CWMA 3EOXA 1AZXI 1ATUA 5INWA 4C49A 4AU2A 3B9FI 1SR5A 4G8OA 2HI9A 8APIA 4DY0A 2OL2A 1YXAA 2ACHA 1NQ9I 1BR8I 1QMNA 1UHGA 4RO9A 5EI0A 1XQJA 1M93B 1DZHL 4Y40A 2GD4C 2XN6A 3T1PA 1JMJA 2VH4A 4P0OA 2XN7A 2H4RA 3LE2A 5HGCA 1SEKA 4Y3KA 2ANTI 2WY1A 4CAAA 2PEEA 4IC0A 2HIJL 1B3KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RIW A;  4IF8 A;  4C41 A;  2D26 A;  2HIJ I;  1E05 I;  2R9Y A;  1IZ2 A;  2WY0 C;  3VVJ A;  3PB1 I;  4ZK3 A;  4DY7 C;  1BY7 A;  2ZV6 A;  1T1F A;  3EVJ I;  1ANT I;  2WXZ C;  4AU3 A;  3NDF A;  4AFX A;  2OAY A;  5BRR I;  1R1L I;  4R9I A;  2B5T I;  1JJO C;  2ZNH A;  4PYW A;  4EB1 L;  1C8O A;  1EZX A;  1OYH L;  9PAI A;  4X30 A;  3CAA A;  3DRM A;  1E03 I;  3KCG I;  3DLW A;  4ROB A;  3UT3 A;  4AU3 B;  4AJT A;  4GA7 A;  4EB1 I;  4ZK0 A;  1KCT A;  1A7C A;  1OYH I;  2H4P A;  2DUT A;  3DRU A;  4P0F A;  1E04 I;  1LJ5 A;  1QMB A;  1OO8 A;  3F1S A;  1XQG A;  1F0C A;  1JRR A;  5CE0 A;  1WZ9 A;  2B4X L;  2CEO A;  1JMO A;  2V95 A;  2XN3 A;  3NE4 A;  1XU8 A;  2B4X I;  1JVQ I;  9API A;  1DB2 A;  3ZHA A;  1LK6 I;  1D5S A;  1OVA A;  1DVN A;  3NDD A;  1DZG L;  3CVM A;  3LW2 A;  4ROA A;  1C5G A;  1DVM A;  1JTI A;  4DTE A;  1PSI A;  1DZG I;  1ATT A;  3NDA A;  1K9O I;  1OPH A;  1ATH A;  1OVA B;  2ARR A;  3R4L A;  2PEF A;  3DY0 A;  3F5N A;  2WXY C;  5IO1 A;  4AQH A;  3H5C A;  2WXX A;  2WXW A;  3Q03 A;  5C98 A;  3OZQ A;  4RSQ A;  3F02 A;  2RIV A;  4BB2 A;  3PZF A;  4AJU A;  5CDX A;  4AU4 A;  2VDX A;  7API A;  3CWL A;  2QUG A;  1AS4 A;  4KDS A;  4YIA A;  1HLE A;  3STO A;  1DZH I;  1SNG A;  5CDZ A;  1TB6 I;  1MTP A;  2XN5 A;  2H4Q A;  1QLP A;  4G8R A;  2BEH L;  3Q02 A;  1OC0 A;  1LQ8 A;  1IMV A;  2BEH I;  3FGQ A;  2ARQ A;  1HP7 A;  2VDY A;  2WXZ A;  1OVA C;  3CWM A;  3EOX A;  1AZX I;  1ATU A;  5INW A;  4C49 A;  4AU2 A;  3B9F I;  1SR5 A;  4G8O A;  2HI9 A;  8API A;  4DY0 A;  2OL2 A;  1YXA A;  2ACH A;  1NQ9 I;  1BR8 I;  1QMN A;  1UHG A;  4RO9 A;  5EI0 A;  1XQJ A;  1M93 B;  1DZH L;  4Y40 A;  2GD4 C;  2XN6 A;  3T1P A;  1JMJ A;  2VH4 A;  4P0O A;  2XN7 A;  2H4R A;  3LE2 A;  5HGC A;  1SEK A;  4Y3K A;  2ANT I;  2WY1 A;  4CAA A;  2PEE A;  4IC0 A;  2HIJ L;  1B3K A; 
#chains in the Genus database with same CATH topology
 2RIW A;  4IF8 A;  4C41 A;  2D26 A;  2HIJ I;  1E05 I;  2R9Y A;  1IZ2 A;  2WY0 C;  3VVJ A;  3PB1 I;  4ZK3 A;  4DY7 C;  1BY7 A;  2ZV6 A;  1T1F A;  3EVJ I;  1ANT I;  2WXZ C;  4AU3 A;  3NDF A;  4AFX A;  2OAY A;  5BRR I;  1R1L I;  4R9I A;  2B5T I;  1JJO C;  2ZNH A;  4PYW A;  4EB1 L;  1C8O A;  1EZX A;  1OYH L;  9PAI A;  4X30 A;  3CAA A;  3DRM A;  1E03 I;  3KCG I;  3DLW A;  4ROB A;  3UT3 A;  4AU3 B;  4AJT A;  4GA7 A;  4EB1 I;  4ZK0 A;  1KCT A;  1A7C A;  1OYH I;  2H4P A;  2DUT A;  3DRU A;  4P0F A;  1E04 I;  1LJ5 A;  1QMB A;  1OO8 A;  3F1S A;  1XQG A;  1F0C A;  1JRR A;  5CE0 A;  1WZ9 A;  2B4X L;  2CEO A;  1JMO A;  2V95 A;  2XN3 A;  3NE4 A;  1XU8 A;  2B4X I;  1JVQ I;  9API A;  1DB2 A;  3ZHA A;  1LK6 I;  1D5S A;  1OVA A;  1DVN A;  3NDD A;  1DZG L;  3CVM A;  3LW2 A;  4ROA A;  1C5G A;  1DVM A;  1JTI A;  4DTE A;  1PSI A;  1DZG I;  1ATT A;  3NDA A;  1K9O I;  1OPH A;  1ATH A;  1OVA B;  2ARR A;  3R4L A;  2PEF A;  3DY0 A;  3F5N A;  2WXY C;  5IO1 A;  4AQH A;  3H5C A;  2WXX A;  2WXW A;  3Q03 A;  5C98 A;  3OZQ A;  4RSQ A;  3F02 A;  2RIV A;  4BB2 A;  3PZF A;  4AJU A;  5CDX A;  4AU4 A;  2VDX A;  7API A;  3CWL A;  2QUG A;  1AS4 A;  4KDS A;  4YIA A;  1HLE A;  3STO A;  1DZH I;  1SNG A;  5CDZ A;  1TB6 I;  1MTP A;  2XN5 A;  2H4Q A;  1QLP A;  4G8R A;  2BEH L;  3Q02 A;  1OC0 A;  1LQ8 A;  1IMV A;  2BEH I;  3FGQ A;  2ARQ A;  1HP7 A;  2VDY A;  2WXZ A;  1OVA C;  3CWM A;  3EOX A;  1AZX I;  1ATU A;  5INW A;  4C49 A;  4AU2 A;  3B9F I;  1SR5 A;  4G8O A;  2HI9 A;  8API A;  4DY0 A;  2OL2 A;  1YXA A;  2ACH A;  1NQ9 I;  1BR8 I;  1QMN A;  1UHG A;  4RO9 A;  5EI0 A;  1XQJ A;  1M93 B;  1DZH L;  4Y40 A;  2GD4 C;  2XN6 A;  3T1P A;  1JMJ A;  2VH4 A;  4P0O A;  2XN7 A;  2H4R A;  3LE2 A;  5HGC A;  1SEK A;  4Y3K A;  2ANT I;  2WY1 A;  4CAA A;  2PEE A;  4IC0 A;  2HIJ L;  1B3K A; 
#chains in the Genus database with same CATH homology
 2RIW A;  4IF8 A;  4C41 A;  2D26 A;  2HIJ I;  1E05 I;  2R9Y A;  1IZ2 A;  2WY0 C;  3VVJ A;  3PB1 I;  4ZK3 A;  4DY7 C;  1BY7 A;  2ZV6 A;  1T1F A;  3EVJ I;  1ANT I;  2WXZ C;  4AU3 A;  3NDF A;  4AFX A;  2OAY A;  5BRR I;  1R1L I;  4R9I A;  2B5T I;  1JJO C;  2ZNH A;  4PYW A;  4EB1 L;  1C8O A;  1EZX A;  1OYH L;  9PAI A;  4X30 A;  3CAA A;  3DRM A;  1E03 I;  3KCG I;  3DLW A;  4ROB A;  3UT3 A;  4AU3 B;  4AJT A;  4GA7 A;  4EB1 I;  4ZK0 A;  1KCT A;  1A7C A;  1OYH I;  2H4P A;  2DUT A;  3DRU A;  4P0F A;  1E04 I;  1LJ5 A;  1QMB A;  1OO8 A;  3F1S A;  1XQG A;  1F0C A;  1JRR A;  5CE0 A;  1WZ9 A;  2B4X L;  2CEO A;  1JMO A;  2V95 A;  2XN3 A;  3NE4 A;  1XU8 A;  2B4X I;  1JVQ I;  9API A;  1DB2 A;  3ZHA A;  1LK6 I;  1D5S A;  1OVA A;  1DVN A;  3NDD A;  1DZG L;  3CVM A;  3LW2 A;  4ROA A;  1C5G A;  1DVM A;  1JTI A;  4DTE A;  1PSI A;  1DZG I;  1ATT A;  3NDA A;  1K9O I;  1OPH A;  1ATH A;  1OVA B;  2ARR A;  3R4L A;  2PEF A;  3DY0 A;  3F5N A;  2WXY C;  5IO1 A;  4AQH A;  3H5C A;  2WXX A;  2WXW A;  3Q03 A;  5C98 A;  3OZQ A;  4RSQ A;  3F02 A;  2RIV A;  4BB2 A;  3PZF A;  4AJU A;  5CDX A;  4AU4 A;  2VDX A;  7API A;  3CWL A;  2QUG A;  1AS4 A;  4KDS A;  4YIA A;  1HLE A;  3STO A;  1DZH I;  1SNG A;  5CDZ A;  1TB6 I;  1MTP A;  2XN5 A;  2H4Q A;  1QLP A;  4G8R A;  2BEH L;  3Q02 A;  1OC0 A;  1LQ8 A;  1IMV A;  2BEH I;  3FGQ A;  2ARQ A;  1HP7 A;  2VDY A;  2WXZ A;  1OVA C;  3CWM A;  3EOX A;  1AZX I;  1ATU A;  5INW A;  4C49 A;  4AU2 A;  3B9F I;  1SR5 A;  4G8O A;  2HI9 A;  8API A;  4DY0 A;  2OL2 A;  1YXA A;  2ACH A;  1NQ9 I;  1BR8 I;  1QMN A;  1UHG A;  4RO9 A;  5EI0 A;  1XQJ A;  1M93 B;  1DZH L;  4Y40 A;  2GD4 C;  2XN6 A;  3T1P A;  1JMJ A;  2VH4 A;  4P0O A;  2XN7 A;  2H4R A;  3LE2 A;  5HGC A;  1SEK A;  4Y3K A;  2ANT I;  2WY1 A;  4CAA A;  2PEE A;  4IC0 A;  2HIJ L;  1B3K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...