4Y3KA

Structure of vaspin mutant e379s
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
380
structure length
367
Chain Sequence
EVQGWKQRMAAKELARQNMDLGFKLLKKLAFYNPGRNIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLHEGFHYIIHELTQKTQDLKLSIGNTLFIDQRLQPQRKFLEDAKNFYSAETILTNFQNLEMAQKQINDFISQKTHGKINNLIENIDPGTVMLLANYIFFRARWKHEFDPNVTKEEDFFLEKNSSVKVPMMFRSGIYQVGYDDKLSCTILEIPYQKNITAIFILPDEGKLKHLEKGLQVDTFSRWKTLLSRRVVDVSVPRLHMTGTFDLKKTLSYIGVSKIFEEHGDLTKIAPHRSLKVGEAVHKAELKMDERGTEGPLVVKIDKPYLLLIYSEKIPSVLFLGKIVNPIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords Serpin A12
publication title A unique serpin P1' glutamate and a conserved beta-sheet C arginine are key residues for activity, protease recognition and stability of serpinA12 (vaspin).
pubmed doi rcsb
source organism Homo sapiens
total genus 113
structure length 367
sequence length 380
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00079 Serpin Serpin (serine protease inhibitor)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.39.10 Mainly Beta Roll Alpha-1-antitrypsin; domain 1 Alpha-1-antitrypsin, domain 1 4y3kA02
3.30.497.10 Alpha Beta 2-Layer Sandwich Antithrombin; Chain I, domain 2 Antithrombin, subunit I, domain 2 4y3kA01
4Y40A 9APIA 2H4PA 1JMJA 4BB2A 3CWLA 2VH4A 4RO9A 1OVAC 1MTPA 4C49A 1C8OA 3NDFA 3KCGI 3F02A 3LE2A 3CVMA 3LW2A 1JVQI 3NE4A 5EI0A 1ATUA 2ANTI 4AU4A 2GD4C 2ZV6A 9PAIA 1XQJA 1LQ8A 3OZQA 4ROAA 1DZHI 3F5NA 3VVJA 1OYHL 1QMBA 5C98A 1DZGL 1OC0A 2H4RA 1SR5A 4G8OA 4AQHA 2PEEA 3PB1I 1IMVA 3T1PA 3PZFA 1E03I 2HI9A 2VDYA 2ARQA 2XN6A 1AS4A 5CDZA 4X30A 3DRMA 2WY1A 1XU8A 3NDAA 4AJTA 1DZHL 1OYHI 3ZHAA 1R1LI 5CE0A 2H4QA 1DZGI 4ROBA 3FGQA 4AJUA 3EOXA 1DVMA 1A7CA 2PEFA 4EB1I 3UT3A 2R9YA 1OVAA 1TB6I 1ATHA 4ZK0A 3DY0A 1OPHA 1KCTA 2XN3A 4DTEA 2XN5A 3R4LA 1F0CA 1JJOC 1JTIA 2QUGA 2RIVA 1E05I 1D5SA 2WXZC 3CWMA 2VDXA 5INWA 1XQGA 4AU3A 1K9OI 4R9IA 4EB1L 4PYWA 1ANTI 2DUTA 1LJ5A 3CAAA 1NQ9I 1C5GA 4AU2A 4KDSA 1IZ2A 1OVAB 4IF8A 3H5CA 1E04I 1HLEA 2B5TI 5IO1A 2OAYA 1DB2A 2WXXA 4C41A 1M93B 7APIA 1UHGA 4ZK3A 1PSIA 2ACHA 2HIJL 4AU3B 2B4XI 2CEOA 1QMNA 2D26A 3Q02A 1YXAA 4DY7C 4RSQA 2ARRA 4P0FA 4P0OA 3Q03A 2HIJI 2RIWA 4YIAA 3DLWA 4DY0A 1ATTA 2B4XL 1JRRA 2BEHI 1SEKA 2WXZA 1T1FA 2OL2A 1OO8A 1B3KA 1SNGA 3F1SA 4AFXA 2V95A 4GA7A 1BR8I 3DRUA 1AZXI 1LK6I 5BRRI 3NDDA 3STOA 1JMOA 1WZ9A 3EVJI 1DVNA 8APIA 2XN7A 1HP7A 4Y3KA 4CAAA 2BEHL 1BY7A 1QLPA 3B9FI 2WXWA 5HGCA 2ZNHA 4IC0A 1EZXA 5CDXA 2WXYC 2WY0C 4G8RA
chains in the Genus database with same CATH superfamily
4Y40A 9APIA 2H4PA 1JMJA 4BB2A 3CWLA 2VH4A 4RO9A 1OVAC 1MTPA 4C49A 1C8OA 3NDFA 3KCGI 3F02A 3LE2A 3CVMA 3LW2A 1JVQI 3NE4A 5EI0A 1ATUA 2ANTI 4AU4A 2GD4C 2ZV6A 9PAIA 1XQJA 1LQ8A 3OZQA 4ROAA 1DZHI 3F5NA 3VVJA 1OYHL 1QMBA 5C98A 1DZGL 1OC0A 2H4RA 1SR5A 4G8OA 4AQHA 2PEEA 3PB1I 1IMVA 3T1PA 3PZFA 1E03I 2HI9A 2VDYA 2ARQA 2XN6A 1AS4A 5CDZA 4X30A 3DRMA 2WY1A 1XU8A 3NDAA 4AJTA 1DZHL 1OYHI 3ZHAA 1R1LI 5CE0A 2H4QA 1DZGI 4ROBA 3FGQA 4AJUA 3EOXA 1DVMA 1A7CA 2PEFA 4EB1I 3UT3A 2R9YA 1OVAA 1TB6I 1ATHA 4ZK0A 3DY0A 1OPHA 1KCTA 2XN3A 4DTEA 2XN5A 3R4LA 1F0CA 1JJOC 1JTIA 2QUGA 2RIVA 1E05I 1D5SA 2WXZC 3CWMA 2VDXA 5INWA 1XQGA 4AU3A 1K9OI 4R9IA 4EB1L 4PYWA 1ANTI 2DUTA 1LJ5A 3CAAA 1NQ9I 1C5GA 4AU2A 4KDSA 1IZ2A 1OVAB 4IF8A 3H5CA 1E04I 1HLEA 2B5TI 5IO1A 2OAYA 1DB2A 2WXXA 4C41A 1M93B 7APIA 1UHGA 4ZK3A 1PSIA 2ACHA 2HIJL 4AU3B 2B4XI 2CEOA 1QMNA 2D26A 3Q02A 1YXAA 4DY7C 4RSQA 2ARRA 4P0FA 4P0OA 3Q03A 2HIJI 2RIWA 4YIAA 3DLWA 4DY0A 1ATTA 2B4XL 1JRRA 2BEHI 1SEKA 2WXZA 1T1FA 2OL2A 1OO8A 1B3KA 1SNGA 3F1SA 4AFXA 2V95A 4GA7A 1BR8I 3DRUA 1AZXI 1LK6I 5BRRI 3NDDA 3STOA 1JMOA 1WZ9A 3EVJI 1DVNA 8APIA 2XN7A 1HP7A 4Y3KA 4CAAA 2BEHL 1BY7A 1QLPA 3B9FI 2WXWA 5HGCA 2ZNHA 4IC0A 1EZXA 5CDXA 2WXYC 2WY0C 4G8RA
chains in the Genus database with same CATH topology
4Y40A 9APIA 2H4PA 1JMJA 4BB2A 3CWLA 2VH4A 4RO9A 1OVAC 1MTPA 4C49A 1C8OA 3NDFA 3KCGI 3F02A 3LE2A 3CVMA 3LW2A 1JVQI 3NE4A 5EI0A 1ATUA 2ANTI 4AU4A 2GD4C 2ZV6A 9PAIA 1XQJA 1LQ8A 3OZQA 4ROAA 1DZHI 3F5NA 3VVJA 1OYHL 1QMBA 5C98A 1DZGL 1OC0A 2H4RA 1SR5A 4G8OA 4AQHA 2PEEA 3PB1I 1IMVA 3T1PA 3PZFA 1E03I 2HI9A 2VDYA 2ARQA 2XN6A 1AS4A 5CDZA 4X30A 3DRMA 2WY1A 1XU8A 3NDAA 4AJTA 1DZHL 1OYHI 3ZHAA 1R1LI 5CE0A 2H4QA 1DZGI 4ROBA 3FGQA 4AJUA 3EOXA 1DVMA 1A7CA 2PEFA 4EB1I 3UT3A 2R9YA 1OVAA 1TB6I 1ATHA 4ZK0A 3DY0A 1OPHA 1KCTA 2XN3A 4DTEA 2XN5A 3R4LA 1F0CA 1JJOC 1JTIA 2QUGA 2RIVA 1E05I 1D5SA 2WXZC 3CWMA 2VDXA 5INWA 1XQGA 4AU3A 1K9OI 4R9IA 4EB1L 4PYWA 1ANTI 2DUTA 1LJ5A 3CAAA 1NQ9I 1C5GA 4AU2A 4KDSA 1IZ2A 1OVAB 4IF8A 3H5CA 1E04I 1HLEA 2B5TI 5IO1A 2OAYA 1DB2A 2WXXA 4C41A 1M93B 7APIA 1UHGA 4ZK3A 1PSIA 2ACHA 2HIJL 4AU3B 2B4XI 2CEOA 1QMNA 2D26A 3Q02A 1YXAA 4DY7C 4RSQA 2ARRA 4P0FA 4P0OA 3Q03A 2HIJI 2RIWA 4YIAA 3DLWA 4DY0A 1ATTA 2B4XL 1JRRA 2BEHI 1SEKA 2WXZA 1T1FA 2OL2A 1OO8A 1B3KA 1SNGA 3F1SA 4AFXA 2V95A 4GA7A 1BR8I 3DRUA 1AZXI 1LK6I 5BRRI 3NDDA 3STOA 1JMOA 1WZ9A 3EVJI 1DVNA 8APIA 2XN7A 1HP7A 4Y3KA 4CAAA 2BEHL 1BY7A 1QLPA 3B9FI 2WXWA 5HGCA 2ZNHA 4IC0A 1EZXA 5CDXA 2WXYC 2WY0C 4G8RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y40 A;  9API A;  2H4P A;  1JMJ A;  4BB2 A;  3CWL A;  2VH4 A;  4RO9 A;  1OVA C;  1MTP A;  4C49 A;  1C8O A;  3NDF A;  3KCG I;  3F02 A;  3LE2 A;  3CVM A;  3LW2 A;  1JVQ I;  3NE4 A;  5EI0 A;  1ATU A;  2ANT I;  4AU4 A;  2GD4 C;  2ZV6 A;  9PAI A;  1XQJ A;  1LQ8 A;  3OZQ A;  4ROA A;  1DZH I;  3F5N A;  3VVJ A;  1OYH L;  1QMB A;  5C98 A;  1DZG L;  1OC0 A;  2H4R A;  1SR5 A;  4G8O A;  4AQH A;  2PEE A;  3PB1 I;  1IMV A;  3T1P A;  3PZF A;  1E03 I;  2HI9 A;  2VDY A;  2ARQ A;  2XN6 A;  1AS4 A;  5CDZ A;  4X30 A;  3DRM A;  2WY1 A;  1XU8 A;  3NDA A;  4AJT A;  1DZH L;  1OYH I;  3ZHA A;  1R1L I;  5CE0 A;  2H4Q A;  1DZG I;  4ROB A;  3FGQ A;  4AJU A;  3EOX A;  1DVM A;  1A7C A;  2PEF A;  4EB1 I;  3UT3 A;  2R9Y A;  1OVA A;  1TB6 I;  1ATH A;  4ZK0 A;  3DY0 A;  1OPH A;  1KCT A;  2XN3 A;  4DTE A;  2XN5 A;  3R4L A;  1F0C A;  1JJO C;  1JTI A;  2QUG A;  2RIV A;  1E05 I;  1D5S A;  2WXZ C;  3CWM A;  2VDX A;  5INW A;  1XQG A;  4AU3 A;  1K9O I;  4R9I A;  4EB1 L;  4PYW A;  1ANT I;  2DUT A;  1LJ5 A;  3CAA A;  1NQ9 I;  1C5G A;  4AU2 A;  4KDS A;  1IZ2 A;  1OVA B;  4IF8 A;  3H5C A;  1E04 I;  1HLE A;  2B5T I;  5IO1 A;  2OAY A;  1DB2 A;  2WXX A;  4C41 A;  1M93 B;  7API A;  1UHG A;  4ZK3 A;  1PSI A;  2ACH A;  2HIJ L;  4AU3 B;  2B4X I;  2CEO A;  1QMN A;  2D26 A;  3Q02 A;  1YXA A;  4DY7 C;  4RSQ A;  2ARR A;  4P0F A;  4P0O A;  3Q03 A;  2HIJ I;  2RIW A;  4YIA A;  3DLW A;  4DY0 A;  1ATT A;  2B4X L;  1JRR A;  2BEH I;  1SEK A;  2WXZ A;  1T1F A;  2OL2 A;  1OO8 A;  1B3K A;  1SNG A;  3F1S A;  4AFX A;  2V95 A;  4GA7 A;  1BR8 I;  3DRU A;  1AZX I;  1LK6 I;  5BRR I;  3NDD A;  3STO A;  1JMO A;  1WZ9 A;  3EVJ I;  1DVN A;  8API A;  2XN7 A;  1HP7 A;  4Y3K A;  4CAA A;  2BEH L;  1BY7 A;  1QLP A;  3B9F I;  2WXW A;  5HGC A;  2ZNH A;  4IC0 A;  1EZX A;  5CDX A;  2WXY C;  2WY0 C;  4G8R A; 
#chains in the Genus database with same CATH topology
 4Y40 A;  9API A;  2H4P A;  1JMJ A;  4BB2 A;  3CWL A;  2VH4 A;  4RO9 A;  1OVA C;  1MTP A;  4C49 A;  1C8O A;  3NDF A;  3KCG I;  3F02 A;  3LE2 A;  3CVM A;  3LW2 A;  1JVQ I;  3NE4 A;  5EI0 A;  1ATU A;  2ANT I;  4AU4 A;  2GD4 C;  2ZV6 A;  9PAI A;  1XQJ A;  1LQ8 A;  3OZQ A;  4ROA A;  1DZH I;  3F5N A;  3VVJ A;  1OYH L;  1QMB A;  5C98 A;  1DZG L;  1OC0 A;  2H4R A;  1SR5 A;  4G8O A;  4AQH A;  2PEE A;  3PB1 I;  1IMV A;  3T1P A;  3PZF A;  1E03 I;  2HI9 A;  2VDY A;  2ARQ A;  2XN6 A;  1AS4 A;  5CDZ A;  4X30 A;  3DRM A;  2WY1 A;  1XU8 A;  3NDA A;  4AJT A;  1DZH L;  1OYH I;  3ZHA A;  1R1L I;  5CE0 A;  2H4Q A;  1DZG I;  4ROB A;  3FGQ A;  4AJU A;  3EOX A;  1DVM A;  1A7C A;  2PEF A;  4EB1 I;  3UT3 A;  2R9Y A;  1OVA A;  1TB6 I;  1ATH A;  4ZK0 A;  3DY0 A;  1OPH A;  1KCT A;  2XN3 A;  4DTE A;  2XN5 A;  3R4L A;  1F0C A;  1JJO C;  1JTI A;  2QUG A;  2RIV A;  1E05 I;  1D5S A;  2WXZ C;  3CWM A;  2VDX A;  5INW A;  1XQG A;  4AU3 A;  1K9O I;  4R9I A;  4EB1 L;  4PYW A;  1ANT I;  2DUT A;  1LJ5 A;  3CAA A;  1NQ9 I;  1C5G A;  4AU2 A;  4KDS A;  1IZ2 A;  1OVA B;  4IF8 A;  3H5C A;  1E04 I;  1HLE A;  2B5T I;  5IO1 A;  2OAY A;  1DB2 A;  2WXX A;  4C41 A;  1M93 B;  7API A;  1UHG A;  4ZK3 A;  1PSI A;  2ACH A;  2HIJ L;  4AU3 B;  2B4X I;  2CEO A;  1QMN A;  2D26 A;  3Q02 A;  1YXA A;  4DY7 C;  4RSQ A;  2ARR A;  4P0F A;  4P0O A;  3Q03 A;  2HIJ I;  2RIW A;  4YIA A;  3DLW A;  4DY0 A;  1ATT A;  2B4X L;  1JRR A;  2BEH I;  1SEK A;  2WXZ A;  1T1F A;  2OL2 A;  1OO8 A;  1B3K A;  1SNG A;  3F1S A;  4AFX A;  2V95 A;  4GA7 A;  1BR8 I;  3DRU A;  1AZX I;  1LK6 I;  5BRR I;  3NDD A;  3STO A;  1JMO A;  1WZ9 A;  3EVJ I;  1DVN A;  8API A;  2XN7 A;  1HP7 A;  4Y3K A;  4CAA A;  2BEH L;  1BY7 A;  1QLP A;  3B9F I;  2WXW A;  5HGC A;  2ZNH A;  4IC0 A;  1EZX A;  5CDX A;  2WXY C;  2WY0 C;  4G8R A; 
#chains in the Genus database with same CATH homology
 4Y40 A;  9API A;  2H4P A;  1JMJ A;  4BB2 A;  3CWL A;  2VH4 A;  4RO9 A;  1OVA C;  1MTP A;  4C49 A;  1C8O A;  3NDF A;  3KCG I;  3F02 A;  3LE2 A;  3CVM A;  3LW2 A;  1JVQ I;  3NE4 A;  5EI0 A;  1ATU A;  2ANT I;  4AU4 A;  2GD4 C;  2ZV6 A;  9PAI A;  1XQJ A;  1LQ8 A;  3OZQ A;  4ROA A;  1DZH I;  3F5N A;  3VVJ A;  1OYH L;  1QMB A;  5C98 A;  1DZG L;  1OC0 A;  2H4R A;  1SR5 A;  4G8O A;  4AQH A;  2PEE A;  3PB1 I;  1IMV A;  3T1P A;  3PZF A;  1E03 I;  2HI9 A;  2VDY A;  2ARQ A;  2XN6 A;  1AS4 A;  5CDZ A;  4X30 A;  3DRM A;  2WY1 A;  1XU8 A;  3NDA A;  4AJT A;  1DZH L;  1OYH I;  3ZHA A;  1R1L I;  5CE0 A;  2H4Q A;  1DZG I;  4ROB A;  3FGQ A;  4AJU A;  3EOX A;  1DVM A;  1A7C A;  2PEF A;  4EB1 I;  3UT3 A;  2R9Y A;  1OVA A;  1TB6 I;  1ATH A;  4ZK0 A;  3DY0 A;  1OPH A;  1KCT A;  2XN3 A;  4DTE A;  2XN5 A;  3R4L A;  1F0C A;  1JJO C;  1JTI A;  2QUG A;  2RIV A;  1E05 I;  1D5S A;  2WXZ C;  3CWM A;  2VDX A;  5INW A;  1XQG A;  4AU3 A;  1K9O I;  4R9I A;  4EB1 L;  4PYW A;  1ANT I;  2DUT A;  1LJ5 A;  3CAA A;  1NQ9 I;  1C5G A;  4AU2 A;  4KDS A;  1IZ2 A;  1OVA B;  4IF8 A;  3H5C A;  1E04 I;  1HLE A;  2B5T I;  5IO1 A;  2OAY A;  1DB2 A;  2WXX A;  4C41 A;  1M93 B;  7API A;  1UHG A;  4ZK3 A;  1PSI A;  2ACH A;  2HIJ L;  4AU3 B;  2B4X I;  2CEO A;  1QMN A;  2D26 A;  3Q02 A;  1YXA A;  4DY7 C;  4RSQ A;  2ARR A;  4P0F A;  4P0O A;  3Q03 A;  2HIJ I;  2RIW A;  4YIA A;  3DLW A;  4DY0 A;  1ATT A;  2B4X L;  1JRR A;  2BEH I;  1SEK A;  2WXZ A;  1T1F A;  2OL2 A;  1OO8 A;  1B3K A;  1SNG A;  3F1S A;  4AFX A;  2V95 A;  4GA7 A;  1BR8 I;  3DRU A;  1AZX I;  1LK6 I;  5BRR I;  3NDD A;  3STO A;  1JMO A;  1WZ9 A;  3EVJ I;  1DVN A;  8API A;  2XN7 A;  1HP7 A;  4Y3K A;  4CAA A;  2BEH L;  1BY7 A;  1QLP A;  3B9F I;  2WXW A;  5HGC A;  2ZNH A;  4IC0 A;  1EZX A;  5CDX A;  2WXY C;  2WY0 C;  4G8R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...