4Y40A

Structure of vaspin mutant d305c v383c
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
379
structure length
366
Chain Sequence
VQGWKQRMAAKELARQNMDLGFKLLKKLAFYNPGRNIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLHEGFHYIIHELTQKTQDLKLSIGNTLFIDQRLQPQRKFLEDAKNFYSAETILTNFQNLEMAQKQINDFISQKTHGKINNLIENIDPGTVMLLANYIFFRARWKHEFDPNVTKEEDFFLEKNSSVKVPMMFRSGIYQVGYDDKLSCTILEIPYQKNITAIFILPDEGKLKHLEKGLQVDTFSRWKTLLSRRVVCVSVPRLHMTGTFDLKKTLSYIGVSKIFEEHGDLTKIAPHRSLKVGEAVHKAELKMDERGTETPLCVKIDKPYLLLIYSEKIPSVLFLGKIVNPIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrloase inhibitor
molecule keywords Serpin A12
publication title A unique serpin P1' glutamate and a conserved beta-sheet C arginine are key residues for activity, protease recognition and stability of serpinA12 (vaspin).
pubmed doi rcsb
source organism Homo sapiens
total genus 121
structure length 366
sequence length 379
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00079 Serpin Serpin (serine protease inhibitor)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.39.10 Mainly Beta Roll Alpha-1-antitrypsin; domain 1 Alpha-1-antitrypsin, domain 1 4y40A02
3.30.497.10 Alpha Beta 2-Layer Sandwich Antithrombin; Chain I, domain 2 Antithrombin, subunit I, domain 2 4y40A01
1JJOC 2ACHA 1DZHL 2WXZA 2CEOA 4EB1L 2R9YA 1C8OA 3FGQA 1DZGI 4RO9A 4C41A 1JMOA 1SEKA 2BEHL 2XN5A 4DY0A 5IO1A 2D26A 2B4XL 2WY1A 1LJ5A 5CDXA 1YXAA 2H4PA 5CE0A 3LE2A 4ROBA 2H4QA 4AFXA 2V95A 3NDAA 3NE4A 4Y3KA 1PSIA 2ANTI 2XN3A 1BR8I 2WXXA 1XU8A 2VDXA 2XN6A 3H5CA 1OPHA 1IZ2A 4AQHA 2GD4C 4IC0A 1TB6I 3UT3A 2WXZC 1B3KA 2WXYC 4GA7A 1SNGA 4ROAA 2VH4A 4ZK3A 1NQ9I 7APIA 1OVAB 2WY0C 4KDSA 3ZHAA 2OAYA 1AS4A 1A7CA 1E04I 2OL2A 4DTEA 1AZXI 1EZXA 4AJTA 1C5GA 4R9IA 4C49A 1OVAA 1SR5A 1OO8A 4IF8A 3DRUA 1XQJA 4AU3B 4ZK0A 2RIVA 3EVJI 1BY7A 1OC0A 1DZGL 3PB1I 1R1LI 3EOXA 4G8OA 5INWA 1OYHI 2DUTA 3CWLA 1LQ8A 1JRRA 2HIJI 4AU3A 3CWMA 3STOA 1JTIA 3OZQA 2H4RA 4PYWA 3R4LA 3CVMA 2RIWA 3F02A 9APIA 4AU4A 1D5SA 1ATUA 1T1FA 1OVAC 3F5NA 3LW2A 1UHGA 2PEFA 2QUGA 2HI9A 3VVJA 1JVQI 1LK6I 4AU2A 5CDZA 1ATTA 1DZHI 4EB1I 5EI0A 5HGCA 1HLEA 1DVMA 1QMNA 2BEHI 3DLWA 3DY0A 8APIA 1HP7A 2ZNHA 2B4XI 1K9OI 1M93B 1F0CA 4Y40A 1ATHA 1E05I 2ZV6A 2ARRA 2XN7A 1QMBA 4P0FA 4CAAA 5C98A 4X30A 1DVNA 1ANTI 4YIAA 1KCTA 1OYHL 3NDFA 3CAAA 3Q02A 3Q03A 4G8RA 9PAIA 1XQGA 2WXWA 3DRMA 4RSQA 2HIJL 4DY7C 3PZFA 4AJUA 2B5TI 2PEEA 1E03I 4P0OA 3NDDA 5BRRI 3B9FI 1DB2A 1IMVA 1MTPA 1WZ9A 3T1PA 4BB2A 2VDYA 1JMJA 2ARQA 3F1SA 3KCGI 1QLPA
chains in the Genus database with same CATH superfamily
1JJOC 2ACHA 1DZHL 2WXZA 2CEOA 4EB1L 2R9YA 1C8OA 3FGQA 1DZGI 4RO9A 4C41A 1JMOA 1SEKA 2BEHL 2XN5A 4DY0A 5IO1A 2D26A 2B4XL 2WY1A 1LJ5A 5CDXA 1YXAA 2H4PA 5CE0A 3LE2A 4ROBA 2H4QA 4AFXA 2V95A 3NDAA 3NE4A 4Y3KA 1PSIA 2ANTI 2XN3A 1BR8I 2WXXA 1XU8A 2VDXA 2XN6A 3H5CA 1OPHA 1IZ2A 4AQHA 2GD4C 4IC0A 1TB6I 3UT3A 2WXZC 1B3KA 2WXYC 4GA7A 1SNGA 4ROAA 2VH4A 4ZK3A 1NQ9I 7APIA 1OVAB 2WY0C 4KDSA 3ZHAA 2OAYA 1AS4A 1A7CA 1E04I 2OL2A 4DTEA 1AZXI 1EZXA 4AJTA 1C5GA 4R9IA 4C49A 1OVAA 1SR5A 1OO8A 4IF8A 3DRUA 1XQJA 4AU3B 4ZK0A 2RIVA 3EVJI 1BY7A 1OC0A 1DZGL 3PB1I 1R1LI 3EOXA 4G8OA 5INWA 1OYHI 2DUTA 3CWLA 1LQ8A 1JRRA 2HIJI 4AU3A 3CWMA 3STOA 1JTIA 3OZQA 2H4RA 4PYWA 3R4LA 3CVMA 2RIWA 3F02A 9APIA 4AU4A 1D5SA 1ATUA 1T1FA 1OVAC 3F5NA 3LW2A 1UHGA 2PEFA 2QUGA 2HI9A 3VVJA 1JVQI 1LK6I 4AU2A 5CDZA 1ATTA 1DZHI 4EB1I 5EI0A 5HGCA 1HLEA 1DVMA 1QMNA 2BEHI 3DLWA 3DY0A 8APIA 1HP7A 2ZNHA 2B4XI 1K9OI 1M93B 1F0CA 4Y40A 1ATHA 1E05I 2ZV6A 2ARRA 2XN7A 1QMBA 4P0FA 4CAAA 5C98A 4X30A 1DVNA 1ANTI 4YIAA 1KCTA 1OYHL 3NDFA 3CAAA 3Q02A 3Q03A 4G8RA 9PAIA 1XQGA 2WXWA 3DRMA 4RSQA 2HIJL 4DY7C 3PZFA 4AJUA 2B5TI 2PEEA 1E03I 4P0OA 3NDDA 5BRRI 3B9FI 1DB2A 1IMVA 1MTPA 1WZ9A 3T1PA 4BB2A 2VDYA 1JMJA 2ARQA 3F1SA 3KCGI 1QLPA
chains in the Genus database with same CATH topology
1JJOC 2ACHA 1DZHL 2WXZA 2CEOA 4EB1L 2R9YA 1C8OA 3FGQA 1DZGI 4RO9A 4C41A 1JMOA 1SEKA 2BEHL 2XN5A 4DY0A 5IO1A 2D26A 2B4XL 2WY1A 1LJ5A 5CDXA 1YXAA 2H4PA 5CE0A 3LE2A 4ROBA 2H4QA 4AFXA 2V95A 3NDAA 3NE4A 4Y3KA 1PSIA 2ANTI 2XN3A 1BR8I 2WXXA 1XU8A 2VDXA 2XN6A 3H5CA 1OPHA 1IZ2A 4AQHA 2GD4C 4IC0A 1TB6I 3UT3A 2WXZC 1B3KA 2WXYC 4GA7A 1SNGA 4ROAA 2VH4A 4ZK3A 1NQ9I 7APIA 1OVAB 2WY0C 4KDSA 3ZHAA 2OAYA 1AS4A 1A7CA 1E04I 2OL2A 4DTEA 1AZXI 1EZXA 4AJTA 1C5GA 4R9IA 4C49A 1OVAA 1SR5A 1OO8A 4IF8A 3DRUA 1XQJA 4AU3B 4ZK0A 2RIVA 3EVJI 1BY7A 1OC0A 1DZGL 3PB1I 1R1LI 3EOXA 4G8OA 5INWA 1OYHI 2DUTA 3CWLA 1LQ8A 1JRRA 2HIJI 4AU3A 3CWMA 3STOA 1JTIA 3OZQA 2H4RA 4PYWA 3R4LA 3CVMA 2RIWA 3F02A 9APIA 4AU4A 1D5SA 1ATUA 1T1FA 1OVAC 3F5NA 3LW2A 1UHGA 2PEFA 2QUGA 2HI9A 3VVJA 1JVQI 1LK6I 4AU2A 5CDZA 1ATTA 1DZHI 4EB1I 5EI0A 5HGCA 1HLEA 1DVMA 1QMNA 2BEHI 3DLWA 3DY0A 8APIA 1HP7A 2ZNHA 2B4XI 1K9OI 1M93B 1F0CA 4Y40A 1ATHA 1E05I 2ZV6A 2ARRA 2XN7A 1QMBA 4P0FA 4CAAA 5C98A 4X30A 1DVNA 1ANTI 4YIAA 1KCTA 1OYHL 3NDFA 3CAAA 3Q02A 3Q03A 4G8RA 9PAIA 1XQGA 2WXWA 3DRMA 4RSQA 2HIJL 4DY7C 3PZFA 4AJUA 2B5TI 2PEEA 1E03I 4P0OA 3NDDA 5BRRI 3B9FI 1DB2A 1IMVA 1MTPA 1WZ9A 3T1PA 4BB2A 2VDYA 1JMJA 2ARQA 3F1SA 3KCGI 1QLPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JJO C;  2ACH A;  1DZH L;  2WXZ A;  2CEO A;  4EB1 L;  2R9Y A;  1C8O A;  3FGQ A;  1DZG I;  4RO9 A;  4C41 A;  1JMO A;  1SEK A;  2BEH L;  2XN5 A;  4DY0 A;  5IO1 A;  2D26 A;  2B4X L;  2WY1 A;  1LJ5 A;  5CDX A;  1YXA A;  2H4P A;  5CE0 A;  3LE2 A;  4ROB A;  2H4Q A;  4AFX A;  2V95 A;  3NDA A;  3NE4 A;  4Y3K A;  1PSI A;  2ANT I;  2XN3 A;  1BR8 I;  2WXX A;  1XU8 A;  2VDX A;  2XN6 A;  3H5C A;  1OPH A;  1IZ2 A;  4AQH A;  2GD4 C;  4IC0 A;  1TB6 I;  3UT3 A;  2WXZ C;  1B3K A;  2WXY C;  4GA7 A;  1SNG A;  4ROA A;  2VH4 A;  4ZK3 A;  1NQ9 I;  7API A;  1OVA B;  2WY0 C;  4KDS A;  3ZHA A;  2OAY A;  1AS4 A;  1A7C A;  1E04 I;  2OL2 A;  4DTE A;  1AZX I;  1EZX A;  4AJT A;  1C5G A;  4R9I A;  4C49 A;  1OVA A;  1SR5 A;  1OO8 A;  4IF8 A;  3DRU A;  1XQJ A;  4AU3 B;  4ZK0 A;  2RIV A;  3EVJ I;  1BY7 A;  1OC0 A;  1DZG L;  3PB1 I;  1R1L I;  3EOX A;  4G8O A;  5INW A;  1OYH I;  2DUT A;  3CWL A;  1LQ8 A;  1JRR A;  2HIJ I;  4AU3 A;  3CWM A;  3STO A;  1JTI A;  3OZQ A;  2H4R A;  4PYW A;  3R4L A;  3CVM A;  2RIW A;  3F02 A;  9API A;  4AU4 A;  1D5S A;  1ATU A;  1T1F A;  1OVA C;  3F5N A;  3LW2 A;  1UHG A;  2PEF A;  2QUG A;  2HI9 A;  3VVJ A;  1JVQ I;  1LK6 I;  4AU2 A;  5CDZ A;  1ATT A;  1DZH I;  4EB1 I;  5EI0 A;  5HGC A;  1HLE A;  1DVM A;  1QMN A;  2BEH I;  3DLW A;  3DY0 A;  8API A;  1HP7 A;  2ZNH A;  2B4X I;  1K9O I;  1M93 B;  1F0C A;  4Y40 A;  1ATH A;  1E05 I;  2ZV6 A;  2ARR A;  2XN7 A;  1QMB A;  4P0F A;  4CAA A;  5C98 A;  4X30 A;  1DVN A;  1ANT I;  4YIA A;  1KCT A;  1OYH L;  3NDF A;  3CAA A;  3Q02 A;  3Q03 A;  4G8R A;  9PAI A;  1XQG A;  2WXW A;  3DRM A;  4RSQ A;  2HIJ L;  4DY7 C;  3PZF A;  4AJU A;  2B5T I;  2PEE A;  1E03 I;  4P0O A;  3NDD A;  5BRR I;  3B9F I;  1DB2 A;  1IMV A;  1MTP A;  1WZ9 A;  3T1P A;  4BB2 A;  2VDY A;  1JMJ A;  2ARQ A;  3F1S A;  3KCG I;  1QLP A; 
#chains in the Genus database with same CATH topology
 1JJO C;  2ACH A;  1DZH L;  2WXZ A;  2CEO A;  4EB1 L;  2R9Y A;  1C8O A;  3FGQ A;  1DZG I;  4RO9 A;  4C41 A;  1JMO A;  1SEK A;  2BEH L;  2XN5 A;  4DY0 A;  5IO1 A;  2D26 A;  2B4X L;  2WY1 A;  1LJ5 A;  5CDX A;  1YXA A;  2H4P A;  5CE0 A;  3LE2 A;  4ROB A;  2H4Q A;  4AFX A;  2V95 A;  3NDA A;  3NE4 A;  4Y3K A;  1PSI A;  2ANT I;  2XN3 A;  1BR8 I;  2WXX A;  1XU8 A;  2VDX A;  2XN6 A;  3H5C A;  1OPH A;  1IZ2 A;  4AQH A;  2GD4 C;  4IC0 A;  1TB6 I;  3UT3 A;  2WXZ C;  1B3K A;  2WXY C;  4GA7 A;  1SNG A;  4ROA A;  2VH4 A;  4ZK3 A;  1NQ9 I;  7API A;  1OVA B;  2WY0 C;  4KDS A;  3ZHA A;  2OAY A;  1AS4 A;  1A7C A;  1E04 I;  2OL2 A;  4DTE A;  1AZX I;  1EZX A;  4AJT A;  1C5G A;  4R9I A;  4C49 A;  1OVA A;  1SR5 A;  1OO8 A;  4IF8 A;  3DRU A;  1XQJ A;  4AU3 B;  4ZK0 A;  2RIV A;  3EVJ I;  1BY7 A;  1OC0 A;  1DZG L;  3PB1 I;  1R1L I;  3EOX A;  4G8O A;  5INW A;  1OYH I;  2DUT A;  3CWL A;  1LQ8 A;  1JRR A;  2HIJ I;  4AU3 A;  3CWM A;  3STO A;  1JTI A;  3OZQ A;  2H4R A;  4PYW A;  3R4L A;  3CVM A;  2RIW A;  3F02 A;  9API A;  4AU4 A;  1D5S A;  1ATU A;  1T1F A;  1OVA C;  3F5N A;  3LW2 A;  1UHG A;  2PEF A;  2QUG A;  2HI9 A;  3VVJ A;  1JVQ I;  1LK6 I;  4AU2 A;  5CDZ A;  1ATT A;  1DZH I;  4EB1 I;  5EI0 A;  5HGC A;  1HLE A;  1DVM A;  1QMN A;  2BEH I;  3DLW A;  3DY0 A;  8API A;  1HP7 A;  2ZNH A;  2B4X I;  1K9O I;  1M93 B;  1F0C A;  4Y40 A;  1ATH A;  1E05 I;  2ZV6 A;  2ARR A;  2XN7 A;  1QMB A;  4P0F A;  4CAA A;  5C98 A;  4X30 A;  1DVN A;  1ANT I;  4YIA A;  1KCT A;  1OYH L;  3NDF A;  3CAA A;  3Q02 A;  3Q03 A;  4G8R A;  9PAI A;  1XQG A;  2WXW A;  3DRM A;  4RSQ A;  2HIJ L;  4DY7 C;  3PZF A;  4AJU A;  2B5T I;  2PEE A;  1E03 I;  4P0O A;  3NDD A;  5BRR I;  3B9F I;  1DB2 A;  1IMV A;  1MTP A;  1WZ9 A;  3T1P A;  4BB2 A;  2VDY A;  1JMJ A;  2ARQ A;  3F1S A;  3KCG I;  1QLP A; 
#chains in the Genus database with same CATH homology
 1JJO C;  2ACH A;  1DZH L;  2WXZ A;  2CEO A;  4EB1 L;  2R9Y A;  1C8O A;  3FGQ A;  1DZG I;  4RO9 A;  4C41 A;  1JMO A;  1SEK A;  2BEH L;  2XN5 A;  4DY0 A;  5IO1 A;  2D26 A;  2B4X L;  2WY1 A;  1LJ5 A;  5CDX A;  1YXA A;  2H4P A;  5CE0 A;  3LE2 A;  4ROB A;  2H4Q A;  4AFX A;  2V95 A;  3NDA A;  3NE4 A;  4Y3K A;  1PSI A;  2ANT I;  2XN3 A;  1BR8 I;  2WXX A;  1XU8 A;  2VDX A;  2XN6 A;  3H5C A;  1OPH A;  1IZ2 A;  4AQH A;  2GD4 C;  4IC0 A;  1TB6 I;  3UT3 A;  2WXZ C;  1B3K A;  2WXY C;  4GA7 A;  1SNG A;  4ROA A;  2VH4 A;  4ZK3 A;  1NQ9 I;  7API A;  1OVA B;  2WY0 C;  4KDS A;  3ZHA A;  2OAY A;  1AS4 A;  1A7C A;  1E04 I;  2OL2 A;  4DTE A;  1AZX I;  1EZX A;  4AJT A;  1C5G A;  4R9I A;  4C49 A;  1OVA A;  1SR5 A;  1OO8 A;  4IF8 A;  3DRU A;  1XQJ A;  4AU3 B;  4ZK0 A;  2RIV A;  3EVJ I;  1BY7 A;  1OC0 A;  1DZG L;  3PB1 I;  1R1L I;  3EOX A;  4G8O A;  5INW A;  1OYH I;  2DUT A;  3CWL A;  1LQ8 A;  1JRR A;  2HIJ I;  4AU3 A;  3CWM A;  3STO A;  1JTI A;  3OZQ A;  2H4R A;  4PYW A;  3R4L A;  3CVM A;  2RIW A;  3F02 A;  9API A;  4AU4 A;  1D5S A;  1ATU A;  1T1F A;  1OVA C;  3F5N A;  3LW2 A;  1UHG A;  2PEF A;  2QUG A;  2HI9 A;  3VVJ A;  1JVQ I;  1LK6 I;  4AU2 A;  5CDZ A;  1ATT A;  1DZH I;  4EB1 I;  5EI0 A;  5HGC A;  1HLE A;  1DVM A;  1QMN A;  2BEH I;  3DLW A;  3DY0 A;  8API A;  1HP7 A;  2ZNH A;  2B4X I;  1K9O I;  1M93 B;  1F0C A;  4Y40 A;  1ATH A;  1E05 I;  2ZV6 A;  2ARR A;  2XN7 A;  1QMB A;  4P0F A;  4CAA A;  5C98 A;  4X30 A;  1DVN A;  1ANT I;  4YIA A;  1KCT A;  1OYH L;  3NDF A;  3CAA A;  3Q02 A;  3Q03 A;  4G8R A;  9PAI A;  1XQG A;  2WXW A;  3DRM A;  4RSQ A;  2HIJ L;  4DY7 C;  3PZF A;  4AJU A;  2B5T I;  2PEE A;  1E03 I;  4P0O A;  3NDD A;  5BRR I;  3B9F I;  1DB2 A;  1IMV A;  1MTP A;  1WZ9 A;  3T1P A;  4BB2 A;  2VDY A;  1JMJ A;  2ARQ A;  3F1S A;  3KCG I;  1QLP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...