4ZK0A

Psoriasis pathogenesis - pso p27 constitute a compact structure forming large aggregates. high ph structure
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
388
structure length
367
Chain Sequence
SLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTEGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Serpin B4
publication title Psoriasis pathogenesis - Pso p27 constitutes a compact structure forming large aggregates.
pubmed doi rcsb
source organism Homo sapiens
total genus 113
structure length 367
sequence length 388
ec nomenclature
pdb deposition date 2015-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00079 Serpin Serpin (serine protease inhibitor)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.39.10 Mainly Beta Roll Alpha-1-antitrypsin; domain 1 Alpha-1-antitrypsin, domain 1 4zk0A02
3.30.497.10 Alpha Beta 2-Layer Sandwich Antithrombin; Chain I, domain 2 Antithrombin, subunit I, domain 2 4zk0A01
2OL2A 2RIVA 4X30A 2GD4C 4AU2A 1SR5A 1QMNA 4AQHA 3DRUA 1M93B 4ZK3A 1HLEA 4DY0A 1E03I 1SNGA 2BEHI 4IC0A 4AJTA 5CE0A 3CWLA 2VDYA 4GA7A 4C49A 2HIJL 5EI0A 2RIWA 2PEEA 4RO9A 1AZXI 1NQ9I 1XU8A 1AS4A 1TB6I 4EB1L 9PAIA 3B9FI 3R4LA 2H4PA 1DVMA 1DB2A 1ATUA 1D5SA 2CEOA 1LJ5A 1LQ8A 1OYHL 1OC0A 1JMJA 3DLWA 4G8OA 2WXYC 5CDXA 4AFXA 2XN6A 1IZ2A 3CVMA 1HP7A 3Q02A 1OVAA 4EB1I 1DVNA 8APIA 1E04I 1YXAA 2WXWA 3T1PA 2B5TI 5IO1A 1ATTA 2ARRA 4Y3KA 3ZHAA 1OVAB 1KCTA 1OYHI 4AJUA 7APIA 4YIAA 3EOXA 1T1FA 2PEFA 3F5NA 1E05I 1R1LI 3VVJA 1JJOC 1DZHL 3NE4A 4DY7C 3KCGI 4AU3A 1JVQI 3F1SA 2XN5A 2WXZC 3LE2A 9APIA 5BRRI 3STOA 1JTIA 5C98A 1EZXA 1XQJA 1ATHA 1C8OA 1BY7A 1LK6I 2H4QA 2HIJI 2DUTA 3H5CA 1ANTI 1DZGL 4AU4A 3OZQA 1A7CA 2H4RA 2QUGA 2WXXA 2WXZA 2HI9A 1OO8A 3NDFA 1MTPA 2V95A 4ROAA 4Y40A 3UT3A 4P0FA 1JRRA 1B3KA 3CWMA 1UHGA 3DRMA 2WY0C 2XN7A 2VDXA 2OAYA 3DY0A 5CDZA 4IF8A 2ACHA 4P0OA 3PB1I 2B4XL 1DZGI 3F02A 3Q03A 3LW2A 4AU3B 1XQGA 3FGQA 4BB2A 4DTEA 2ZV6A 2D26A 3PZFA 1SEKA 2XN3A 4R9IA 4KDSA 4ZK0A 1PSIA 2R9YA 4CAAA 2VH4A 4C41A 1C5GA 1F0CA 5INWA 2BEHL 4ROBA 2WY1A 1WZ9A 4RSQA 1DZHI 2ARQA 4PYWA 3EVJI 1K9OI 1QMBA 2B4XI 1OVAC 2ZNHA 4G8RA 1IMVA 1OPHA 2ANTI 3CAAA 3NDAA 3NDDA 1JMOA 1QLPA 1BR8I 5HGCA
chains in the Genus database with same CATH superfamily
2OL2A 2RIVA 4X30A 2GD4C 4AU2A 1SR5A 1QMNA 4AQHA 3DRUA 1M93B 4ZK3A 1HLEA 4DY0A 1E03I 1SNGA 2BEHI 4IC0A 4AJTA 5CE0A 3CWLA 2VDYA 4GA7A 4C49A 2HIJL 5EI0A 2RIWA 2PEEA 4RO9A 1AZXI 1NQ9I 1XU8A 1AS4A 1TB6I 4EB1L 9PAIA 3B9FI 3R4LA 2H4PA 1DVMA 1DB2A 1ATUA 1D5SA 2CEOA 1LJ5A 1LQ8A 1OYHL 1OC0A 1JMJA 3DLWA 4G8OA 2WXYC 5CDXA 4AFXA 2XN6A 1IZ2A 3CVMA 1HP7A 3Q02A 1OVAA 4EB1I 1DVNA 8APIA 1E04I 1YXAA 2WXWA 3T1PA 2B5TI 5IO1A 1ATTA 2ARRA 4Y3KA 3ZHAA 1OVAB 1KCTA 1OYHI 4AJUA 7APIA 4YIAA 3EOXA 1T1FA 2PEFA 3F5NA 1E05I 1R1LI 3VVJA 1JJOC 1DZHL 3NE4A 4DY7C 3KCGI 4AU3A 1JVQI 3F1SA 2XN5A 2WXZC 3LE2A 9APIA 5BRRI 3STOA 1JTIA 5C98A 1EZXA 1XQJA 1ATHA 1C8OA 1BY7A 1LK6I 2H4QA 2HIJI 2DUTA 3H5CA 1ANTI 1DZGL 4AU4A 3OZQA 1A7CA 2H4RA 2QUGA 2WXXA 2WXZA 2HI9A 1OO8A 3NDFA 1MTPA 2V95A 4ROAA 4Y40A 3UT3A 4P0FA 1JRRA 1B3KA 3CWMA 1UHGA 3DRMA 2WY0C 2XN7A 2VDXA 2OAYA 3DY0A 5CDZA 4IF8A 2ACHA 4P0OA 3PB1I 2B4XL 1DZGI 3F02A 3Q03A 3LW2A 4AU3B 1XQGA 3FGQA 4BB2A 4DTEA 2ZV6A 2D26A 3PZFA 1SEKA 2XN3A 4R9IA 4KDSA 4ZK0A 1PSIA 2R9YA 4CAAA 2VH4A 4C41A 1C5GA 1F0CA 5INWA 2BEHL 4ROBA 2WY1A 1WZ9A 4RSQA 1DZHI 2ARQA 4PYWA 3EVJI 1K9OI 1QMBA 2B4XI 1OVAC 2ZNHA 4G8RA 1IMVA 1OPHA 2ANTI 3CAAA 3NDAA 3NDDA 1JMOA 1QLPA 1BR8I 5HGCA
chains in the Genus database with same CATH topology
2OL2A 2RIVA 4X30A 2GD4C 4AU2A 1SR5A 1QMNA 4AQHA 3DRUA 1M93B 4ZK3A 1HLEA 4DY0A 1E03I 1SNGA 2BEHI 4IC0A 4AJTA 5CE0A 3CWLA 2VDYA 4GA7A 4C49A 2HIJL 5EI0A 2RIWA 2PEEA 4RO9A 1AZXI 1NQ9I 1XU8A 1AS4A 1TB6I 4EB1L 9PAIA 3B9FI 3R4LA 2H4PA 1DVMA 1DB2A 1ATUA 1D5SA 2CEOA 1LJ5A 1LQ8A 1OYHL 1OC0A 1JMJA 3DLWA 4G8OA 2WXYC 5CDXA 4AFXA 2XN6A 1IZ2A 3CVMA 1HP7A 3Q02A 1OVAA 4EB1I 1DVNA 8APIA 1E04I 1YXAA 2WXWA 3T1PA 2B5TI 5IO1A 1ATTA 2ARRA 4Y3KA 3ZHAA 1OVAB 1KCTA 1OYHI 4AJUA 7APIA 4YIAA 3EOXA 1T1FA 2PEFA 3F5NA 1E05I 1R1LI 3VVJA 1JJOC 1DZHL 3NE4A 4DY7C 3KCGI 4AU3A 1JVQI 3F1SA 2XN5A 2WXZC 3LE2A 9APIA 5BRRI 3STOA 1JTIA 5C98A 1EZXA 1XQJA 1ATHA 1C8OA 1BY7A 1LK6I 2H4QA 2HIJI 2DUTA 3H5CA 1ANTI 1DZGL 4AU4A 3OZQA 1A7CA 2H4RA 2QUGA 2WXXA 2WXZA 2HI9A 1OO8A 3NDFA 1MTPA 2V95A 4ROAA 4Y40A 3UT3A 4P0FA 1JRRA 1B3KA 3CWMA 1UHGA 3DRMA 2WY0C 2XN7A 2VDXA 2OAYA 3DY0A 5CDZA 4IF8A 2ACHA 4P0OA 3PB1I 2B4XL 1DZGI 3F02A 3Q03A 3LW2A 4AU3B 1XQGA 3FGQA 4BB2A 4DTEA 2ZV6A 2D26A 3PZFA 1SEKA 2XN3A 4R9IA 4KDSA 4ZK0A 1PSIA 2R9YA 4CAAA 2VH4A 4C41A 1C5GA 1F0CA 5INWA 2BEHL 4ROBA 2WY1A 1WZ9A 4RSQA 1DZHI 2ARQA 4PYWA 3EVJI 1K9OI 1QMBA 2B4XI 1OVAC 2ZNHA 4G8RA 1IMVA 1OPHA 2ANTI 3CAAA 3NDAA 3NDDA 1JMOA 1QLPA 1BR8I 5HGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OL2 A;  2RIV A;  4X30 A;  2GD4 C;  4AU2 A;  1SR5 A;  1QMN A;  4AQH A;  3DRU A;  1M93 B;  4ZK3 A;  1HLE A;  4DY0 A;  1E03 I;  1SNG A;  2BEH I;  4IC0 A;  4AJT A;  5CE0 A;  3CWL A;  2VDY A;  4GA7 A;  4C49 A;  2HIJ L;  5EI0 A;  2RIW A;  2PEE A;  4RO9 A;  1AZX I;  1NQ9 I;  1XU8 A;  1AS4 A;  1TB6 I;  4EB1 L;  9PAI A;  3B9F I;  3R4L A;  2H4P A;  1DVM A;  1DB2 A;  1ATU A;  1D5S A;  2CEO A;  1LJ5 A;  1LQ8 A;  1OYH L;  1OC0 A;  1JMJ A;  3DLW A;  4G8O A;  2WXY C;  5CDX A;  4AFX A;  2XN6 A;  1IZ2 A;  3CVM A;  1HP7 A;  3Q02 A;  1OVA A;  4EB1 I;  1DVN A;  8API A;  1E04 I;  1YXA A;  2WXW A;  3T1P A;  2B5T I;  5IO1 A;  1ATT A;  2ARR A;  4Y3K A;  3ZHA A;  1OVA B;  1KCT A;  1OYH I;  4AJU A;  7API A;  4YIA A;  3EOX A;  1T1F A;  2PEF A;  3F5N A;  1E05 I;  1R1L I;  3VVJ A;  1JJO C;  1DZH L;  3NE4 A;  4DY7 C;  3KCG I;  4AU3 A;  1JVQ I;  3F1S A;  2XN5 A;  2WXZ C;  3LE2 A;  9API A;  5BRR I;  3STO A;  1JTI A;  5C98 A;  1EZX A;  1XQJ A;  1ATH A;  1C8O A;  1BY7 A;  1LK6 I;  2H4Q A;  2HIJ I;  2DUT A;  3H5C A;  1ANT I;  1DZG L;  4AU4 A;  3OZQ A;  1A7C A;  2H4R A;  2QUG A;  2WXX A;  2WXZ A;  2HI9 A;  1OO8 A;  3NDF A;  1MTP A;  2V95 A;  4ROA A;  4Y40 A;  3UT3 A;  4P0F A;  1JRR A;  1B3K A;  3CWM A;  1UHG A;  3DRM A;  2WY0 C;  2XN7 A;  2VDX A;  2OAY A;  3DY0 A;  5CDZ A;  4IF8 A;  2ACH A;  4P0O A;  3PB1 I;  2B4X L;  1DZG I;  3F02 A;  3Q03 A;  3LW2 A;  4AU3 B;  1XQG A;  3FGQ A;  4BB2 A;  4DTE A;  2ZV6 A;  2D26 A;  3PZF A;  1SEK A;  2XN3 A;  4R9I A;  4KDS A;  4ZK0 A;  1PSI A;  2R9Y A;  4CAA A;  2VH4 A;  4C41 A;  1C5G A;  1F0C A;  5INW A;  2BEH L;  4ROB A;  2WY1 A;  1WZ9 A;  4RSQ A;  1DZH I;  2ARQ A;  4PYW A;  3EVJ I;  1K9O I;  1QMB A;  2B4X I;  1OVA C;  2ZNH A;  4G8R A;  1IMV A;  1OPH A;  2ANT I;  3CAA A;  3NDA A;  3NDD A;  1JMO A;  1QLP A;  1BR8 I;  5HGC A; 
#chains in the Genus database with same CATH topology
 2OL2 A;  2RIV A;  4X30 A;  2GD4 C;  4AU2 A;  1SR5 A;  1QMN A;  4AQH A;  3DRU A;  1M93 B;  4ZK3 A;  1HLE A;  4DY0 A;  1E03 I;  1SNG A;  2BEH I;  4IC0 A;  4AJT A;  5CE0 A;  3CWL A;  2VDY A;  4GA7 A;  4C49 A;  2HIJ L;  5EI0 A;  2RIW A;  2PEE A;  4RO9 A;  1AZX I;  1NQ9 I;  1XU8 A;  1AS4 A;  1TB6 I;  4EB1 L;  9PAI A;  3B9F I;  3R4L A;  2H4P A;  1DVM A;  1DB2 A;  1ATU A;  1D5S A;  2CEO A;  1LJ5 A;  1LQ8 A;  1OYH L;  1OC0 A;  1JMJ A;  3DLW A;  4G8O A;  2WXY C;  5CDX A;  4AFX A;  2XN6 A;  1IZ2 A;  3CVM A;  1HP7 A;  3Q02 A;  1OVA A;  4EB1 I;  1DVN A;  8API A;  1E04 I;  1YXA A;  2WXW A;  3T1P A;  2B5T I;  5IO1 A;  1ATT A;  2ARR A;  4Y3K A;  3ZHA A;  1OVA B;  1KCT A;  1OYH I;  4AJU A;  7API A;  4YIA A;  3EOX A;  1T1F A;  2PEF A;  3F5N A;  1E05 I;  1R1L I;  3VVJ A;  1JJO C;  1DZH L;  3NE4 A;  4DY7 C;  3KCG I;  4AU3 A;  1JVQ I;  3F1S A;  2XN5 A;  2WXZ C;  3LE2 A;  9API A;  5BRR I;  3STO A;  1JTI A;  5C98 A;  1EZX A;  1XQJ A;  1ATH A;  1C8O A;  1BY7 A;  1LK6 I;  2H4Q A;  2HIJ I;  2DUT A;  3H5C A;  1ANT I;  1DZG L;  4AU4 A;  3OZQ A;  1A7C A;  2H4R A;  2QUG A;  2WXX A;  2WXZ A;  2HI9 A;  1OO8 A;  3NDF A;  1MTP A;  2V95 A;  4ROA A;  4Y40 A;  3UT3 A;  4P0F A;  1JRR A;  1B3K A;  3CWM A;  1UHG A;  3DRM A;  2WY0 C;  2XN7 A;  2VDX A;  2OAY A;  3DY0 A;  5CDZ A;  4IF8 A;  2ACH A;  4P0O A;  3PB1 I;  2B4X L;  1DZG I;  3F02 A;  3Q03 A;  3LW2 A;  4AU3 B;  1XQG A;  3FGQ A;  4BB2 A;  4DTE A;  2ZV6 A;  2D26 A;  3PZF A;  1SEK A;  2XN3 A;  4R9I A;  4KDS A;  4ZK0 A;  1PSI A;  2R9Y A;  4CAA A;  2VH4 A;  4C41 A;  1C5G A;  1F0C A;  5INW A;  2BEH L;  4ROB A;  2WY1 A;  1WZ9 A;  4RSQ A;  1DZH I;  2ARQ A;  4PYW A;  3EVJ I;  1K9O I;  1QMB A;  2B4X I;  1OVA C;  2ZNH A;  4G8R A;  1IMV A;  1OPH A;  2ANT I;  3CAA A;  3NDA A;  3NDD A;  1JMO A;  1QLP A;  1BR8 I;  5HGC A; 
#chains in the Genus database with same CATH homology
 2OL2 A;  2RIV A;  4X30 A;  2GD4 C;  4AU2 A;  1SR5 A;  1QMN A;  4AQH A;  3DRU A;  1M93 B;  4ZK3 A;  1HLE A;  4DY0 A;  1E03 I;  1SNG A;  2BEH I;  4IC0 A;  4AJT A;  5CE0 A;  3CWL A;  2VDY A;  4GA7 A;  4C49 A;  2HIJ L;  5EI0 A;  2RIW A;  2PEE A;  4RO9 A;  1AZX I;  1NQ9 I;  1XU8 A;  1AS4 A;  1TB6 I;  4EB1 L;  9PAI A;  3B9F I;  3R4L A;  2H4P A;  1DVM A;  1DB2 A;  1ATU A;  1D5S A;  2CEO A;  1LJ5 A;  1LQ8 A;  1OYH L;  1OC0 A;  1JMJ A;  3DLW A;  4G8O A;  2WXY C;  5CDX A;  4AFX A;  2XN6 A;  1IZ2 A;  3CVM A;  1HP7 A;  3Q02 A;  1OVA A;  4EB1 I;  1DVN A;  8API A;  1E04 I;  1YXA A;  2WXW A;  3T1P A;  2B5T I;  5IO1 A;  1ATT A;  2ARR A;  4Y3K A;  3ZHA A;  1OVA B;  1KCT A;  1OYH I;  4AJU A;  7API A;  4YIA A;  3EOX A;  1T1F A;  2PEF A;  3F5N A;  1E05 I;  1R1L I;  3VVJ A;  1JJO C;  1DZH L;  3NE4 A;  4DY7 C;  3KCG I;  4AU3 A;  1JVQ I;  3F1S A;  2XN5 A;  2WXZ C;  3LE2 A;  9API A;  5BRR I;  3STO A;  1JTI A;  5C98 A;  1EZX A;  1XQJ A;  1ATH A;  1C8O A;  1BY7 A;  1LK6 I;  2H4Q A;  2HIJ I;  2DUT A;  3H5C A;  1ANT I;  1DZG L;  4AU4 A;  3OZQ A;  1A7C A;  2H4R A;  2QUG A;  2WXX A;  2WXZ A;  2HI9 A;  1OO8 A;  3NDF A;  1MTP A;  2V95 A;  4ROA A;  4Y40 A;  3UT3 A;  4P0F A;  1JRR A;  1B3K A;  3CWM A;  1UHG A;  3DRM A;  2WY0 C;  2XN7 A;  2VDX A;  2OAY A;  3DY0 A;  5CDZ A;  4IF8 A;  2ACH A;  4P0O A;  3PB1 I;  2B4X L;  1DZG I;  3F02 A;  3Q03 A;  3LW2 A;  4AU3 B;  1XQG A;  3FGQ A;  4BB2 A;  4DTE A;  2ZV6 A;  2D26 A;  3PZF A;  1SEK A;  2XN3 A;  4R9I A;  4KDS A;  4ZK0 A;  1PSI A;  2R9Y A;  4CAA A;  2VH4 A;  4C41 A;  1C5G A;  1F0C A;  5INW A;  2BEH L;  4ROB A;  2WY1 A;  1WZ9 A;  4RSQ A;  1DZH I;  2ARQ A;  4PYW A;  3EVJ I;  1K9O I;  1QMB A;  2B4X I;  1OVA C;  2ZNH A;  4G8R A;  1IMV A;  1OPH A;  2ANT I;  3CAA A;  3NDA A;  3NDD A;  1JMO A;  1QLP A;  1BR8 I;  5HGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...