4ZK3A

Psoriasis pathogenesis - pso p27 constitute a compact structure forming large aggregates. low ph structure
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
388
structure length
366
Chain Sequence
SLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Serpin B3
publication title Psoriasis pathogenesis - Pso p27 constitutes a compact structure forming large aggregates.
pubmed doi rcsb
source organism Homo sapiens
total genus 112
structure length 366
sequence length 388
ec nomenclature
pdb deposition date 2015-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00079 Serpin Serpin (serine protease inhibitor)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.39.10 Mainly Beta Roll Alpha-1-antitrypsin; domain 1 Alpha-1-antitrypsin, domain 1 4zk3A02
3.30.497.10 Alpha Beta 2-Layer Sandwich Antithrombin; Chain I, domain 2 Antithrombin, subunit I, domain 2 4zk3A01
3LE2A 2ARRA 1UHGA 1IZ2A 2B4XI 2VH4A 1LK6I 2BEHI 3EVJI 3T1PA 1QLPA 1QMBA 1OVAA 1DVMA 3Q03A 4IF8A 4AU4A 4RO9A 2HIJL 1DB2A 1F0CA 2DUTA 4AU3A 1JRRA 1T1FA 2HIJI 3F02A 4CAAA 4AJTA 1OVAB 1BY7A 1AZXI 1EZXA 4ZK3A 5C98A 4EB1I 2ZV6A 7APIA 2WXZC 2VDXA 2H4QA 2ZNHA 3LW2A 3NE4A 3CWLA 1XU8A 2XN5A 1E04I 4G8RA 1JVQI 2CEOA 2XN7A 4Y3KA 1JMOA 1ATUA 1E03I 1D5SA 1K9OI 2RIVA 9APIA 4GA7A 2ACHA 1SEKA 2XN3A 4IC0A 4PYWA 2QUGA 1KCTA 4AQHA 1E05I 2OAYA 2PEFA 1JJOC 4C41A 3PB1I 2WXXA 4ZK0A 1C8OA 2WY1A 3DRMA 2B5TI 1HLEA 1C5GA 8APIA 4AU2A 3F5NA 2HI9A 3Q02A 1JTIA 1BR8I 1OYHL 3UT3A 5INWA 1JMJA 1ATTA 3OZQA 1OYHI 4Y40A 1R1LI 3CAAA 1DZGL 2H4RA 1B3KA 4KDSA 5CDXA 4P0FA 2H4PA 1SNGA 1DZHL 1WZ9A 4RSQA 3CVMA 2PEEA 2D26A 1TB6I 4X30A 9PAIA 2RIWA 4ROAA 2GD4C 1YXAA 1XQJA 3NDFA 2ARQA 3NDDA 4R9IA 2WXZA 4DTEA 2OL2A 2V95A 3R4LA 2B4XL 4DY0A 2BEHL 2WXWA 4G8OA 5IO1A 3KCGI 1OVAC 1IMVA 1NQ9I 1OC0A 4P0OA 3B9FI 4AFXA 4DY7C 1DZGI 1OPHA 3STOA 4ROBA 1A7CA 3PZFA 4C49A 3DLWA 3H5CA 3CWMA 1ANTI 5EI0A 1DZHI 1QMNA 4EB1L 1ATHA 3NDAA 2VDYA 2WY0C 5CE0A 1HP7A 1DVNA 1AS4A 1LQ8A 1SR5A 3VVJA 1MTPA 2XN6A 4AU3B 3EOXA 4YIAA 4BB2A 5CDZA 1M93B 3ZHAA 3DRUA 2WXYC 3F1SA 3DY0A 2ANTI 1LJ5A 5BRRI 3FGQA 2R9YA 4AJUA 1OO8A 1PSIA 5HGCA 1XQGA
chains in the Genus database with same CATH superfamily
3LE2A 2ARRA 1UHGA 1IZ2A 2B4XI 2VH4A 1LK6I 2BEHI 3EVJI 3T1PA 1QLPA 1QMBA 1OVAA 1DVMA 3Q03A 4IF8A 4AU4A 4RO9A 2HIJL 1DB2A 1F0CA 2DUTA 4AU3A 1JRRA 1T1FA 2HIJI 3F02A 4CAAA 4AJTA 1OVAB 1BY7A 1AZXI 1EZXA 4ZK3A 5C98A 4EB1I 2ZV6A 7APIA 2WXZC 2VDXA 2H4QA 2ZNHA 3LW2A 3NE4A 3CWLA 1XU8A 2XN5A 1E04I 4G8RA 1JVQI 2CEOA 2XN7A 4Y3KA 1JMOA 1ATUA 1E03I 1D5SA 1K9OI 2RIVA 9APIA 4GA7A 2ACHA 1SEKA 2XN3A 4IC0A 4PYWA 2QUGA 1KCTA 4AQHA 1E05I 2OAYA 2PEFA 1JJOC 4C41A 3PB1I 2WXXA 4ZK0A 1C8OA 2WY1A 3DRMA 2B5TI 1HLEA 1C5GA 8APIA 4AU2A 3F5NA 2HI9A 3Q02A 1JTIA 1BR8I 1OYHL 3UT3A 5INWA 1JMJA 1ATTA 3OZQA 1OYHI 4Y40A 1R1LI 3CAAA 1DZGL 2H4RA 1B3KA 4KDSA 5CDXA 4P0FA 2H4PA 1SNGA 1DZHL 1WZ9A 4RSQA 3CVMA 2PEEA 2D26A 1TB6I 4X30A 9PAIA 2RIWA 4ROAA 2GD4C 1YXAA 1XQJA 3NDFA 2ARQA 3NDDA 4R9IA 2WXZA 4DTEA 2OL2A 2V95A 3R4LA 2B4XL 4DY0A 2BEHL 2WXWA 4G8OA 5IO1A 3KCGI 1OVAC 1IMVA 1NQ9I 1OC0A 4P0OA 3B9FI 4AFXA 4DY7C 1DZGI 1OPHA 3STOA 4ROBA 1A7CA 3PZFA 4C49A 3DLWA 3H5CA 3CWMA 1ANTI 5EI0A 1DZHI 1QMNA 4EB1L 1ATHA 3NDAA 2VDYA 2WY0C 5CE0A 1HP7A 1DVNA 1AS4A 1LQ8A 1SR5A 3VVJA 1MTPA 2XN6A 4AU3B 3EOXA 4YIAA 4BB2A 5CDZA 1M93B 3ZHAA 3DRUA 2WXYC 3F1SA 3DY0A 2ANTI 1LJ5A 5BRRI 3FGQA 2R9YA 4AJUA 1OO8A 1PSIA 5HGCA 1XQGA
chains in the Genus database with same CATH topology
3LE2A 2ARRA 1UHGA 1IZ2A 2B4XI 2VH4A 1LK6I 2BEHI 3EVJI 3T1PA 1QLPA 1QMBA 1OVAA 1DVMA 3Q03A 4IF8A 4AU4A 4RO9A 2HIJL 1DB2A 1F0CA 2DUTA 4AU3A 1JRRA 1T1FA 2HIJI 3F02A 4CAAA 4AJTA 1OVAB 1BY7A 1AZXI 1EZXA 4ZK3A 5C98A 4EB1I 2ZV6A 7APIA 2WXZC 2VDXA 2H4QA 2ZNHA 3LW2A 3NE4A 3CWLA 1XU8A 2XN5A 1E04I 4G8RA 1JVQI 2CEOA 2XN7A 4Y3KA 1JMOA 1ATUA 1E03I 1D5SA 1K9OI 2RIVA 9APIA 4GA7A 2ACHA 1SEKA 2XN3A 4IC0A 4PYWA 2QUGA 1KCTA 4AQHA 1E05I 2OAYA 2PEFA 1JJOC 4C41A 3PB1I 2WXXA 4ZK0A 1C8OA 2WY1A 3DRMA 2B5TI 1HLEA 1C5GA 8APIA 4AU2A 3F5NA 2HI9A 3Q02A 1JTIA 1BR8I 1OYHL 3UT3A 5INWA 1JMJA 1ATTA 3OZQA 1OYHI 4Y40A 1R1LI 3CAAA 1DZGL 2H4RA 1B3KA 4KDSA 5CDXA 4P0FA 2H4PA 1SNGA 1DZHL 1WZ9A 4RSQA 3CVMA 2PEEA 2D26A 1TB6I 4X30A 9PAIA 2RIWA 4ROAA 2GD4C 1YXAA 1XQJA 3NDFA 2ARQA 3NDDA 4R9IA 2WXZA 4DTEA 2OL2A 2V95A 3R4LA 2B4XL 4DY0A 2BEHL 2WXWA 4G8OA 5IO1A 3KCGI 1OVAC 1IMVA 1NQ9I 1OC0A 4P0OA 3B9FI 4AFXA 4DY7C 1DZGI 1OPHA 3STOA 4ROBA 1A7CA 3PZFA 4C49A 3DLWA 3H5CA 3CWMA 1ANTI 5EI0A 1DZHI 1QMNA 4EB1L 1ATHA 3NDAA 2VDYA 2WY0C 5CE0A 1HP7A 1DVNA 1AS4A 1LQ8A 1SR5A 3VVJA 1MTPA 2XN6A 4AU3B 3EOXA 4YIAA 4BB2A 5CDZA 1M93B 3ZHAA 3DRUA 2WXYC 3F1SA 3DY0A 2ANTI 1LJ5A 5BRRI 3FGQA 2R9YA 4AJUA 1OO8A 1PSIA 5HGCA 1XQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LE2 A;  2ARR A;  1UHG A;  1IZ2 A;  2B4X I;  2VH4 A;  1LK6 I;  2BEH I;  3EVJ I;  3T1P A;  1QLP A;  1QMB A;  1OVA A;  1DVM A;  3Q03 A;  4IF8 A;  4AU4 A;  4RO9 A;  2HIJ L;  1DB2 A;  1F0C A;  2DUT A;  4AU3 A;  1JRR A;  1T1F A;  2HIJ I;  3F02 A;  4CAA A;  4AJT A;  1OVA B;  1BY7 A;  1AZX I;  1EZX A;  4ZK3 A;  5C98 A;  4EB1 I;  2ZV6 A;  7API A;  2WXZ C;  2VDX A;  2H4Q A;  2ZNH A;  3LW2 A;  3NE4 A;  3CWL A;  1XU8 A;  2XN5 A;  1E04 I;  4G8R A;  1JVQ I;  2CEO A;  2XN7 A;  4Y3K A;  1JMO A;  1ATU A;  1E03 I;  1D5S A;  1K9O I;  2RIV A;  9API A;  4GA7 A;  2ACH A;  1SEK A;  2XN3 A;  4IC0 A;  4PYW A;  2QUG A;  1KCT A;  4AQH A;  1E05 I;  2OAY A;  2PEF A;  1JJO C;  4C41 A;  3PB1 I;  2WXX A;  4ZK0 A;  1C8O A;  2WY1 A;  3DRM A;  2B5T I;  1HLE A;  1C5G A;  8API A;  4AU2 A;  3F5N A;  2HI9 A;  3Q02 A;  1JTI A;  1BR8 I;  1OYH L;  3UT3 A;  5INW A;  1JMJ A;  1ATT A;  3OZQ A;  1OYH I;  4Y40 A;  1R1L I;  3CAA A;  1DZG L;  2H4R A;  1B3K A;  4KDS A;  5CDX A;  4P0F A;  2H4P A;  1SNG A;  1DZH L;  1WZ9 A;  4RSQ A;  3CVM A;  2PEE A;  2D26 A;  1TB6 I;  4X30 A;  9PAI A;  2RIW A;  4ROA A;  2GD4 C;  1YXA A;  1XQJ A;  3NDF A;  2ARQ A;  3NDD A;  4R9I A;  2WXZ A;  4DTE A;  2OL2 A;  2V95 A;  3R4L A;  2B4X L;  4DY0 A;  2BEH L;  2WXW A;  4G8O A;  5IO1 A;  3KCG I;  1OVA C;  1IMV A;  1NQ9 I;  1OC0 A;  4P0O A;  3B9F I;  4AFX A;  4DY7 C;  1DZG I;  1OPH A;  3STO A;  4ROB A;  1A7C A;  3PZF A;  4C49 A;  3DLW A;  3H5C A;  3CWM A;  1ANT I;  5EI0 A;  1DZH I;  1QMN A;  4EB1 L;  1ATH A;  3NDA A;  2VDY A;  2WY0 C;  5CE0 A;  1HP7 A;  1DVN A;  1AS4 A;  1LQ8 A;  1SR5 A;  3VVJ A;  1MTP A;  2XN6 A;  4AU3 B;  3EOX A;  4YIA A;  4BB2 A;  5CDZ A;  1M93 B;  3ZHA A;  3DRU A;  2WXY C;  3F1S A;  3DY0 A;  2ANT I;  1LJ5 A;  5BRR I;  3FGQ A;  2R9Y A;  4AJU A;  1OO8 A;  1PSI A;  5HGC A;  1XQG A; 
#chains in the Genus database with same CATH topology
 3LE2 A;  2ARR A;  1UHG A;  1IZ2 A;  2B4X I;  2VH4 A;  1LK6 I;  2BEH I;  3EVJ I;  3T1P A;  1QLP A;  1QMB A;  1OVA A;  1DVM A;  3Q03 A;  4IF8 A;  4AU4 A;  4RO9 A;  2HIJ L;  1DB2 A;  1F0C A;  2DUT A;  4AU3 A;  1JRR A;  1T1F A;  2HIJ I;  3F02 A;  4CAA A;  4AJT A;  1OVA B;  1BY7 A;  1AZX I;  1EZX A;  4ZK3 A;  5C98 A;  4EB1 I;  2ZV6 A;  7API A;  2WXZ C;  2VDX A;  2H4Q A;  2ZNH A;  3LW2 A;  3NE4 A;  3CWL A;  1XU8 A;  2XN5 A;  1E04 I;  4G8R A;  1JVQ I;  2CEO A;  2XN7 A;  4Y3K A;  1JMO A;  1ATU A;  1E03 I;  1D5S A;  1K9O I;  2RIV A;  9API A;  4GA7 A;  2ACH A;  1SEK A;  2XN3 A;  4IC0 A;  4PYW A;  2QUG A;  1KCT A;  4AQH A;  1E05 I;  2OAY A;  2PEF A;  1JJO C;  4C41 A;  3PB1 I;  2WXX A;  4ZK0 A;  1C8O A;  2WY1 A;  3DRM A;  2B5T I;  1HLE A;  1C5G A;  8API A;  4AU2 A;  3F5N A;  2HI9 A;  3Q02 A;  1JTI A;  1BR8 I;  1OYH L;  3UT3 A;  5INW A;  1JMJ A;  1ATT A;  3OZQ A;  1OYH I;  4Y40 A;  1R1L I;  3CAA A;  1DZG L;  2H4R A;  1B3K A;  4KDS A;  5CDX A;  4P0F A;  2H4P A;  1SNG A;  1DZH L;  1WZ9 A;  4RSQ A;  3CVM A;  2PEE A;  2D26 A;  1TB6 I;  4X30 A;  9PAI A;  2RIW A;  4ROA A;  2GD4 C;  1YXA A;  1XQJ A;  3NDF A;  2ARQ A;  3NDD A;  4R9I A;  2WXZ A;  4DTE A;  2OL2 A;  2V95 A;  3R4L A;  2B4X L;  4DY0 A;  2BEH L;  2WXW A;  4G8O A;  5IO1 A;  3KCG I;  1OVA C;  1IMV A;  1NQ9 I;  1OC0 A;  4P0O A;  3B9F I;  4AFX A;  4DY7 C;  1DZG I;  1OPH A;  3STO A;  4ROB A;  1A7C A;  3PZF A;  4C49 A;  3DLW A;  3H5C A;  3CWM A;  1ANT I;  5EI0 A;  1DZH I;  1QMN A;  4EB1 L;  1ATH A;  3NDA A;  2VDY A;  2WY0 C;  5CE0 A;  1HP7 A;  1DVN A;  1AS4 A;  1LQ8 A;  1SR5 A;  3VVJ A;  1MTP A;  2XN6 A;  4AU3 B;  3EOX A;  4YIA A;  4BB2 A;  5CDZ A;  1M93 B;  3ZHA A;  3DRU A;  2WXY C;  3F1S A;  3DY0 A;  2ANT I;  1LJ5 A;  5BRR I;  3FGQ A;  2R9Y A;  4AJU A;  1OO8 A;  1PSI A;  5HGC A;  1XQG A; 
#chains in the Genus database with same CATH homology
 3LE2 A;  2ARR A;  1UHG A;  1IZ2 A;  2B4X I;  2VH4 A;  1LK6 I;  2BEH I;  3EVJ I;  3T1P A;  1QLP A;  1QMB A;  1OVA A;  1DVM A;  3Q03 A;  4IF8 A;  4AU4 A;  4RO9 A;  2HIJ L;  1DB2 A;  1F0C A;  2DUT A;  4AU3 A;  1JRR A;  1T1F A;  2HIJ I;  3F02 A;  4CAA A;  4AJT A;  1OVA B;  1BY7 A;  1AZX I;  1EZX A;  4ZK3 A;  5C98 A;  4EB1 I;  2ZV6 A;  7API A;  2WXZ C;  2VDX A;  2H4Q A;  2ZNH A;  3LW2 A;  3NE4 A;  3CWL A;  1XU8 A;  2XN5 A;  1E04 I;  4G8R A;  1JVQ I;  2CEO A;  2XN7 A;  4Y3K A;  1JMO A;  1ATU A;  1E03 I;  1D5S A;  1K9O I;  2RIV A;  9API A;  4GA7 A;  2ACH A;  1SEK A;  2XN3 A;  4IC0 A;  4PYW A;  2QUG A;  1KCT A;  4AQH A;  1E05 I;  2OAY A;  2PEF A;  1JJO C;  4C41 A;  3PB1 I;  2WXX A;  4ZK0 A;  1C8O A;  2WY1 A;  3DRM A;  2B5T I;  1HLE A;  1C5G A;  8API A;  4AU2 A;  3F5N A;  2HI9 A;  3Q02 A;  1JTI A;  1BR8 I;  1OYH L;  3UT3 A;  5INW A;  1JMJ A;  1ATT A;  3OZQ A;  1OYH I;  4Y40 A;  1R1L I;  3CAA A;  1DZG L;  2H4R A;  1B3K A;  4KDS A;  5CDX A;  4P0F A;  2H4P A;  1SNG A;  1DZH L;  1WZ9 A;  4RSQ A;  3CVM A;  2PEE A;  2D26 A;  1TB6 I;  4X30 A;  9PAI A;  2RIW A;  4ROA A;  2GD4 C;  1YXA A;  1XQJ A;  3NDF A;  2ARQ A;  3NDD A;  4R9I A;  2WXZ A;  4DTE A;  2OL2 A;  2V95 A;  3R4L A;  2B4X L;  4DY0 A;  2BEH L;  2WXW A;  4G8O A;  5IO1 A;  3KCG I;  1OVA C;  1IMV A;  1NQ9 I;  1OC0 A;  4P0O A;  3B9F I;  4AFX A;  4DY7 C;  1DZG I;  1OPH A;  3STO A;  4ROB A;  1A7C A;  3PZF A;  4C49 A;  3DLW A;  3H5C A;  3CWM A;  1ANT I;  5EI0 A;  1DZH I;  1QMN A;  4EB1 L;  1ATH A;  3NDA A;  2VDY A;  2WY0 C;  5CE0 A;  1HP7 A;  1DVN A;  1AS4 A;  1LQ8 A;  1SR5 A;  3VVJ A;  1MTP A;  2XN6 A;  4AU3 B;  3EOX A;  4YIA A;  4BB2 A;  5CDZ A;  1M93 B;  3ZHA A;  3DRU A;  2WXY C;  3F1S A;  3DY0 A;  2ANT I;  1LJ5 A;  5BRR I;  3FGQ A;  2R9Y A;  4AJU A;  1OO8 A;  1PSI A;  5HGC A;  1XQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...