5C98A

1.45a resolution structure of srpn18 from anopheles gambiae
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
368
structure length
359
Chain Sequence
DDAIVAANNKFTLEYFKACYDEKCNCAVSPYHVRLALSMFYPLAGAAVQEDFQVAFGLPEDVHAAIEQQQRLAQQLHDGQHLKALSFVLVEETLRLDSEFERLFHRTFQTTVEPVDLTDDIPSALAVNSFYQRANTEIEDFIGEGDVFSLPPCHKLMLFSGVSVLTPLAIRFNPADTALELFQFINAPTQRVSTMHTTAFVRRCLHNELRCKVVDMPFDAASGLSMLVLLPYDGTELRQIVNSITPAHLAQIDERLQSCWTDLKLPKFFVREKTDPKQTLGKLGYGGVFEIDDLHVFHDSGRTRLNGFIQHCYLAVSESGSSEFEFHANRPFMFLIRRTMDGNVLQVGNFSKYIDPDEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords AGAP007691-PB
publication title 1.45 angstrom resolution structure of SRPN18 from the malaria vector Anopheles gambiae.
pubmed doi rcsb
source organism Anopheles gambiae
total genus 110
structure length 359
sequence length 368
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00079 Serpin Serpin (serine protease inhibitor)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.39.10 Mainly Beta Roll Alpha-1-antitrypsin; domain 1 Alpha-1-antitrypsin, domain 1 5c98A02
3.30.497.10 Alpha Beta 2-Layer Sandwich Antithrombin; Chain I, domain 2 Antithrombin, subunit I, domain 2 5c98A01
2QUGA 1YXAA 1QMBA 2XN5A 4G8RA 1JVQI 1OYHI 2VDYA 1NQ9I 1D5SA 1E04I 3EVJI 3CWLA 2V95A 4CAAA 1ATUA 4IF8A 4DTEA 3F02A 1UHGA 3DLWA 3NDDA 3DY0A 2R9YA 2ZNHA 1JMJA 2OL2A 1E05I 3CVMA 3FGQA 3F5NA 2WY1A 3NDFA 3F1SA 4DY0A 4PYWA 2B5TI 5BRRI 5CE0A 3NE4A 2H4RA 1BY7A 1DVNA 1SR5A 2D26A 2H4PA 1MTPA 2WXXA 1QMNA 1HLEA 1HP7A 1M93B 2ANTI 2OAYA 2H4QA 4X30A 9APIA 9PAIA 4AU3A 2XN3A 1R1LI 1T1FA 1OYHL 2ARQA 2HIJI 3NDAA 5IO1A 3B9FI 4Y40A 1ATTA 1K9OI 3PB1I 2B4XI 4GA7A 1OC0A 4G8OA 3OZQA 1OVAB 4AU3B 1JRRA 1PSIA 3UT3A 1C5GA 2BEHL 3VVJA 7APIA 4Y3KA 1WZ9A 4RO9A 4AJTA 2XN6A 4C49A 5INWA 1XQGA 1DVMA 4P0OA 3PZFA 2VH4A 1DZGL 4ZK3A 3STOA 2WXYC 4AJUA 2PEEA 2ARRA 4EB1I 4AU4A 1SEKA 2WY0C 1DZHL 4AU2A 3LW2A 4BB2A 2VDXA 1OVAC 2GD4C 1JTIA 1BR8I 1AZXI 1OVAA 3KCGI 5C98A 8APIA 2RIWA 1JMOA 1OO8A 1XQJA 2WXZC 4AQHA 2WXZA 1LJ5A 2RIVA 3DRMA 1B3KA 1E03I 1QLPA 2HI9A 1AS4A 2B4XL 2WXWA 5CDXA 2CEOA 3EOXA 4ROAA 3H5CA 5CDZA 1DB2A 2XN7A 4AFXA 2DUTA 4R9IA 4ROBA 3CAAA 4ZK0A 1C8OA 1A7CA 1EZXA 1JJOC 1IZ2A 3LE2A 1TB6I 4KDSA 3Q03A 4EB1L 1LQ8A 3ZHAA 2BEHI 3R4LA 3T1PA 4IC0A 3DRUA 1OPHA 4C41A 2ACHA 4YIAA 1LK6I 5HGCA 4DY7C 2ZV6A 3CWMA 3Q02A 2HIJL 4P0FA 1XU8A 1ANTI 1ATHA 1DZGI 1SNGA 2PEFA 4RSQA 1IMVA 5EI0A 1DZHI 1KCTA 1F0CA
chains in the Genus database with same CATH superfamily
2QUGA 1YXAA 1QMBA 2XN5A 4G8RA 1JVQI 1OYHI 2VDYA 1NQ9I 1D5SA 1E04I 3EVJI 3CWLA 2V95A 4CAAA 1ATUA 4IF8A 4DTEA 3F02A 1UHGA 3DLWA 3NDDA 3DY0A 2R9YA 2ZNHA 1JMJA 2OL2A 1E05I 3CVMA 3FGQA 3F5NA 2WY1A 3NDFA 3F1SA 4DY0A 4PYWA 2B5TI 5BRRI 5CE0A 3NE4A 2H4RA 1BY7A 1DVNA 1SR5A 2D26A 2H4PA 1MTPA 2WXXA 1QMNA 1HLEA 1HP7A 1M93B 2ANTI 2OAYA 2H4QA 4X30A 9APIA 9PAIA 4AU3A 2XN3A 1R1LI 1T1FA 1OYHL 2ARQA 2HIJI 3NDAA 5IO1A 3B9FI 4Y40A 1ATTA 1K9OI 3PB1I 2B4XI 4GA7A 1OC0A 4G8OA 3OZQA 1OVAB 4AU3B 1JRRA 1PSIA 3UT3A 1C5GA 2BEHL 3VVJA 7APIA 4Y3KA 1WZ9A 4RO9A 4AJTA 2XN6A 4C49A 5INWA 1XQGA 1DVMA 4P0OA 3PZFA 2VH4A 1DZGL 4ZK3A 3STOA 2WXYC 4AJUA 2PEEA 2ARRA 4EB1I 4AU4A 1SEKA 2WY0C 1DZHL 4AU2A 3LW2A 4BB2A 2VDXA 1OVAC 2GD4C 1JTIA 1BR8I 1AZXI 1OVAA 3KCGI 5C98A 8APIA 2RIWA 1JMOA 1OO8A 1XQJA 2WXZC 4AQHA 2WXZA 1LJ5A 2RIVA 3DRMA 1B3KA 1E03I 1QLPA 2HI9A 1AS4A 2B4XL 2WXWA 5CDXA 2CEOA 3EOXA 4ROAA 3H5CA 5CDZA 1DB2A 2XN7A 4AFXA 2DUTA 4R9IA 4ROBA 3CAAA 4ZK0A 1C8OA 1A7CA 1EZXA 1JJOC 1IZ2A 3LE2A 1TB6I 4KDSA 3Q03A 4EB1L 1LQ8A 3ZHAA 2BEHI 3R4LA 3T1PA 4IC0A 3DRUA 1OPHA 4C41A 2ACHA 4YIAA 1LK6I 5HGCA 4DY7C 2ZV6A 3CWMA 3Q02A 2HIJL 4P0FA 1XU8A 1ANTI 1ATHA 1DZGI 1SNGA 2PEFA 4RSQA 1IMVA 5EI0A 1DZHI 1KCTA 1F0CA
chains in the Genus database with same CATH topology
2QUGA 1YXAA 1QMBA 2XN5A 4G8RA 1JVQI 1OYHI 2VDYA 1NQ9I 1D5SA 1E04I 3EVJI 3CWLA 2V95A 4CAAA 1ATUA 4IF8A 4DTEA 3F02A 1UHGA 3DLWA 3NDDA 3DY0A 2R9YA 2ZNHA 1JMJA 2OL2A 1E05I 3CVMA 3FGQA 3F5NA 2WY1A 3NDFA 3F1SA 4DY0A 4PYWA 2B5TI 5BRRI 5CE0A 3NE4A 2H4RA 1BY7A 1DVNA 1SR5A 2D26A 2H4PA 1MTPA 2WXXA 1QMNA 1HLEA 1HP7A 1M93B 2ANTI 2OAYA 2H4QA 4X30A 9APIA 9PAIA 4AU3A 2XN3A 1R1LI 1T1FA 1OYHL 2ARQA 2HIJI 3NDAA 5IO1A 3B9FI 4Y40A 1ATTA 1K9OI 3PB1I 2B4XI 4GA7A 1OC0A 4G8OA 3OZQA 1OVAB 4AU3B 1JRRA 1PSIA 3UT3A 1C5GA 2BEHL 3VVJA 7APIA 4Y3KA 1WZ9A 4RO9A 4AJTA 2XN6A 4C49A 5INWA 1XQGA 1DVMA 4P0OA 3PZFA 2VH4A 1DZGL 4ZK3A 3STOA 2WXYC 4AJUA 2PEEA 2ARRA 4EB1I 4AU4A 1SEKA 2WY0C 1DZHL 4AU2A 3LW2A 4BB2A 2VDXA 1OVAC 2GD4C 1JTIA 1BR8I 1AZXI 1OVAA 3KCGI 5C98A 8APIA 2RIWA 1JMOA 1OO8A 1XQJA 2WXZC 4AQHA 2WXZA 1LJ5A 2RIVA 3DRMA 1B3KA 1E03I 1QLPA 2HI9A 1AS4A 2B4XL 2WXWA 5CDXA 2CEOA 3EOXA 4ROAA 3H5CA 5CDZA 1DB2A 2XN7A 4AFXA 2DUTA 4R9IA 4ROBA 3CAAA 4ZK0A 1C8OA 1A7CA 1EZXA 1JJOC 1IZ2A 3LE2A 1TB6I 4KDSA 3Q03A 4EB1L 1LQ8A 3ZHAA 2BEHI 3R4LA 3T1PA 4IC0A 3DRUA 1OPHA 4C41A 2ACHA 4YIAA 1LK6I 5HGCA 4DY7C 2ZV6A 3CWMA 3Q02A 2HIJL 4P0FA 1XU8A 1ANTI 1ATHA 1DZGI 1SNGA 2PEFA 4RSQA 1IMVA 5EI0A 1DZHI 1KCTA 1F0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QUG A;  1YXA A;  1QMB A;  2XN5 A;  4G8R A;  1JVQ I;  1OYH I;  2VDY A;  1NQ9 I;  1D5S A;  1E04 I;  3EVJ I;  3CWL A;  2V95 A;  4CAA A;  1ATU A;  4IF8 A;  4DTE A;  3F02 A;  1UHG A;  3DLW A;  3NDD A;  3DY0 A;  2R9Y A;  2ZNH A;  1JMJ A;  2OL2 A;  1E05 I;  3CVM A;  3FGQ A;  3F5N A;  2WY1 A;  3NDF A;  3F1S A;  4DY0 A;  4PYW A;  2B5T I;  5BRR I;  5CE0 A;  3NE4 A;  2H4R A;  1BY7 A;  1DVN A;  1SR5 A;  2D26 A;  2H4P A;  1MTP A;  2WXX A;  1QMN A;  1HLE A;  1HP7 A;  1M93 B;  2ANT I;  2OAY A;  2H4Q A;  4X30 A;  9API A;  9PAI A;  4AU3 A;  2XN3 A;  1R1L I;  1T1F A;  1OYH L;  2ARQ A;  2HIJ I;  3NDA A;  5IO1 A;  3B9F I;  4Y40 A;  1ATT A;  1K9O I;  3PB1 I;  2B4X I;  4GA7 A;  1OC0 A;  4G8O A;  3OZQ A;  1OVA B;  4AU3 B;  1JRR A;  1PSI A;  3UT3 A;  1C5G A;  2BEH L;  3VVJ A;  7API A;  4Y3K A;  1WZ9 A;  4RO9 A;  4AJT A;  2XN6 A;  4C49 A;  5INW A;  1XQG A;  1DVM A;  4P0O A;  3PZF A;  2VH4 A;  1DZG L;  4ZK3 A;  3STO A;  2WXY C;  4AJU A;  2PEE A;  2ARR A;  4EB1 I;  4AU4 A;  1SEK A;  2WY0 C;  1DZH L;  4AU2 A;  3LW2 A;  4BB2 A;  2VDX A;  1OVA C;  2GD4 C;  1JTI A;  1BR8 I;  1AZX I;  1OVA A;  3KCG I;  5C98 A;  8API A;  2RIW A;  1JMO A;  1OO8 A;  1XQJ A;  2WXZ C;  4AQH A;  2WXZ A;  1LJ5 A;  2RIV A;  3DRM A;  1B3K A;  1E03 I;  1QLP A;  2HI9 A;  1AS4 A;  2B4X L;  2WXW A;  5CDX A;  2CEO A;  3EOX A;  4ROA A;  3H5C A;  5CDZ A;  1DB2 A;  2XN7 A;  4AFX A;  2DUT A;  4R9I A;  4ROB A;  3CAA A;  4ZK0 A;  1C8O A;  1A7C A;  1EZX A;  1JJO C;  1IZ2 A;  3LE2 A;  1TB6 I;  4KDS A;  3Q03 A;  4EB1 L;  1LQ8 A;  3ZHA A;  2BEH I;  3R4L A;  3T1P A;  4IC0 A;  3DRU A;  1OPH A;  4C41 A;  2ACH A;  4YIA A;  1LK6 I;  5HGC A;  4DY7 C;  2ZV6 A;  3CWM A;  3Q02 A;  2HIJ L;  4P0F A;  1XU8 A;  1ANT I;  1ATH A;  1DZG I;  1SNG A;  2PEF A;  4RSQ A;  1IMV A;  5EI0 A;  1DZH I;  1KCT A;  1F0C A; 
#chains in the Genus database with same CATH topology
 2QUG A;  1YXA A;  1QMB A;  2XN5 A;  4G8R A;  1JVQ I;  1OYH I;  2VDY A;  1NQ9 I;  1D5S A;  1E04 I;  3EVJ I;  3CWL A;  2V95 A;  4CAA A;  1ATU A;  4IF8 A;  4DTE A;  3F02 A;  1UHG A;  3DLW A;  3NDD A;  3DY0 A;  2R9Y A;  2ZNH A;  1JMJ A;  2OL2 A;  1E05 I;  3CVM A;  3FGQ A;  3F5N A;  2WY1 A;  3NDF A;  3F1S A;  4DY0 A;  4PYW A;  2B5T I;  5BRR I;  5CE0 A;  3NE4 A;  2H4R A;  1BY7 A;  1DVN A;  1SR5 A;  2D26 A;  2H4P A;  1MTP A;  2WXX A;  1QMN A;  1HLE A;  1HP7 A;  1M93 B;  2ANT I;  2OAY A;  2H4Q A;  4X30 A;  9API A;  9PAI A;  4AU3 A;  2XN3 A;  1R1L I;  1T1F A;  1OYH L;  2ARQ A;  2HIJ I;  3NDA A;  5IO1 A;  3B9F I;  4Y40 A;  1ATT A;  1K9O I;  3PB1 I;  2B4X I;  4GA7 A;  1OC0 A;  4G8O A;  3OZQ A;  1OVA B;  4AU3 B;  1JRR A;  1PSI A;  3UT3 A;  1C5G A;  2BEH L;  3VVJ A;  7API A;  4Y3K A;  1WZ9 A;  4RO9 A;  4AJT A;  2XN6 A;  4C49 A;  5INW A;  1XQG A;  1DVM A;  4P0O A;  3PZF A;  2VH4 A;  1DZG L;  4ZK3 A;  3STO A;  2WXY C;  4AJU A;  2PEE A;  2ARR A;  4EB1 I;  4AU4 A;  1SEK A;  2WY0 C;  1DZH L;  4AU2 A;  3LW2 A;  4BB2 A;  2VDX A;  1OVA C;  2GD4 C;  1JTI A;  1BR8 I;  1AZX I;  1OVA A;  3KCG I;  5C98 A;  8API A;  2RIW A;  1JMO A;  1OO8 A;  1XQJ A;  2WXZ C;  4AQH A;  2WXZ A;  1LJ5 A;  2RIV A;  3DRM A;  1B3K A;  1E03 I;  1QLP A;  2HI9 A;  1AS4 A;  2B4X L;  2WXW A;  5CDX A;  2CEO A;  3EOX A;  4ROA A;  3H5C A;  5CDZ A;  1DB2 A;  2XN7 A;  4AFX A;  2DUT A;  4R9I A;  4ROB A;  3CAA A;  4ZK0 A;  1C8O A;  1A7C A;  1EZX A;  1JJO C;  1IZ2 A;  3LE2 A;  1TB6 I;  4KDS A;  3Q03 A;  4EB1 L;  1LQ8 A;  3ZHA A;  2BEH I;  3R4L A;  3T1P A;  4IC0 A;  3DRU A;  1OPH A;  4C41 A;  2ACH A;  4YIA A;  1LK6 I;  5HGC A;  4DY7 C;  2ZV6 A;  3CWM A;  3Q02 A;  2HIJ L;  4P0F A;  1XU8 A;  1ANT I;  1ATH A;  1DZG I;  1SNG A;  2PEF A;  4RSQ A;  1IMV A;  5EI0 A;  1DZH I;  1KCT A;  1F0C A; 
#chains in the Genus database with same CATH homology
 2QUG A;  1YXA A;  1QMB A;  2XN5 A;  4G8R A;  1JVQ I;  1OYH I;  2VDY A;  1NQ9 I;  1D5S A;  1E04 I;  3EVJ I;  3CWL A;  2V95 A;  4CAA A;  1ATU A;  4IF8 A;  4DTE A;  3F02 A;  1UHG A;  3DLW A;  3NDD A;  3DY0 A;  2R9Y A;  2ZNH A;  1JMJ A;  2OL2 A;  1E05 I;  3CVM A;  3FGQ A;  3F5N A;  2WY1 A;  3NDF A;  3F1S A;  4DY0 A;  4PYW A;  2B5T I;  5BRR I;  5CE0 A;  3NE4 A;  2H4R A;  1BY7 A;  1DVN A;  1SR5 A;  2D26 A;  2H4P A;  1MTP A;  2WXX A;  1QMN A;  1HLE A;  1HP7 A;  1M93 B;  2ANT I;  2OAY A;  2H4Q A;  4X30 A;  9API A;  9PAI A;  4AU3 A;  2XN3 A;  1R1L I;  1T1F A;  1OYH L;  2ARQ A;  2HIJ I;  3NDA A;  5IO1 A;  3B9F I;  4Y40 A;  1ATT A;  1K9O I;  3PB1 I;  2B4X I;  4GA7 A;  1OC0 A;  4G8O A;  3OZQ A;  1OVA B;  4AU3 B;  1JRR A;  1PSI A;  3UT3 A;  1C5G A;  2BEH L;  3VVJ A;  7API A;  4Y3K A;  1WZ9 A;  4RO9 A;  4AJT A;  2XN6 A;  4C49 A;  5INW A;  1XQG A;  1DVM A;  4P0O A;  3PZF A;  2VH4 A;  1DZG L;  4ZK3 A;  3STO A;  2WXY C;  4AJU A;  2PEE A;  2ARR A;  4EB1 I;  4AU4 A;  1SEK A;  2WY0 C;  1DZH L;  4AU2 A;  3LW2 A;  4BB2 A;  2VDX A;  1OVA C;  2GD4 C;  1JTI A;  1BR8 I;  1AZX I;  1OVA A;  3KCG I;  5C98 A;  8API A;  2RIW A;  1JMO A;  1OO8 A;  1XQJ A;  2WXZ C;  4AQH A;  2WXZ A;  1LJ5 A;  2RIV A;  3DRM A;  1B3K A;  1E03 I;  1QLP A;  2HI9 A;  1AS4 A;  2B4X L;  2WXW A;  5CDX A;  2CEO A;  3EOX A;  4ROA A;  3H5C A;  5CDZ A;  1DB2 A;  2XN7 A;  4AFX A;  2DUT A;  4R9I A;  4ROB A;  3CAA A;  4ZK0 A;  1C8O A;  1A7C A;  1EZX A;  1JJO C;  1IZ2 A;  3LE2 A;  1TB6 I;  4KDS A;  3Q03 A;  4EB1 L;  1LQ8 A;  3ZHA A;  2BEH I;  3R4L A;  3T1P A;  4IC0 A;  3DRU A;  1OPH A;  4C41 A;  2ACH A;  4YIA A;  1LK6 I;  5HGC A;  4DY7 C;  2ZV6 A;  3CWM A;  3Q02 A;  2HIJ L;  4P0F A;  1XU8 A;  1ANT I;  1ATH A;  1DZG I;  1SNG A;  2PEF A;  4RSQ A;  1IMV A;  5EI0 A;  1DZH I;  1KCT A;  1F0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...