5CDXA

Crystal structure of conserpin
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
366
structure length
353
Chain Sequence
QGAASSHKLAEANTDFAFSLYRELAKSSPDKNIFFSPVSISSALAMLSLGAKGDTHTQILEGLGFNSEADIHQGFQHLLQTLNRPKGLQLKTANGLFVDKSLKLLDSFLEDSKKLYQAEAFSVDFDPEEAKKQINDWVEKQTNGKIKDLLKDLDSDTVLVLVNAIYFKGKWKKPFDPENTKEEDFHVDEKTTVKVPMMSQKGKFYYYHDDELSCKVLELPYKGNASMLIILPDEGGLQHLEQSLTPETLSKWLKSLTRRSVELYLPKFKIEGTYDLKEVLSNLGITDLFSPGADLSGITEEKLYVSKAVHKAVLEVNEEGTSPPEFKADRPFLFLIRENKTGSILFMGKVVNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords Conserpin
publication title Smoothing a rugged protein folding landscape by sequence-based redesign.
pubmed doi rcsb
source organism Synthetic construct
total genus 102
structure length 353
sequence length 366
ec nomenclature
pdb deposition date 2015-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.39.10 Mainly Beta Roll Alpha-1-antitrypsin; domain 1 Alpha-1-antitrypsin, domain 1 5cdxA02
3.30.497.10 Alpha Beta 2-Layer Sandwich Antithrombin; Chain I, domain 2 Antithrombin, subunit I, domain 2 5cdxA01
2RIVA 1UHGA 1E05I 3STOA 5CDZA 2VDXA 2ACHA 1B3KA 1QMBA 1OO8A 2WY0C 4YIAA 9PAIA 3NE4A 3NDFA 2OAYA 1QMNA 4AQHA 4ZK0A 2BEHI 2CEOA 3T1PA 3OZQA 1OVAB 3DLWA 2B4XL 5CE0A 5EI0A 1YXAA 2H4PA 2PEEA 4GA7A 2WXWA 1ATHA 2ZV6A 1AS4A 1MTPA 1R1LI 1ANTI 4EB1I 5C98A 1SEKA 1SR5A 3CWMA 5CDXA 1JTIA 3B9FI 4IC0A 3DRMA 1JVQI 3PB1I 4DTEA 2R9YA 1OC0A 4EB1L 2GD4C 1LK6I 2HI9A 2XN6A 3F02A 4ROAA 3Q02A 3F5NA 4CAAA 2B5TI 1E03I 2XN5A 3ZHAA 3LW2A 1XQJA 2WY1A 4AU2A 1OVAC 1WZ9A 2DUTA 4ROBA 1HP7A 2WXZC 3CVMA 5INWA 4AU3B 1C8OA 4KDSA 4BB2A 1SNGA 2BEHL 1K9OI 2XN3A 2ZNHA 3PZFA 4Y3KA 3Q03A 1KCTA 3NDAA 9APIA 3F1SA 2ANTI 1NQ9I 4AJUA 4G8RA 4P0OA 1C5GA 1OVAA 2D26A 4ZK3A 1DB2A 1ATTA 2VDYA 1XU8A 1F0CA 2WXZA 1JJOC 4P0FA 4AFXA 2HIJI 1DZGI 1OYHI 2ARQA 4DY0A 2OL2A 3FGQA 4X30A 1JRRA 4AU4A 1DZHI 1AZXI 2XN7A 7APIA 4DY7C 1XQGA 1OPHA 2QUGA 2ARRA 4RO9A 4G8OA 1ATUA 4C41A 1IZ2A 1JMJA 3CAAA 1HLEA 3CWLA 1DZHL 1M93B 1A7CA 2B4XI 3LE2A 5HGCA 2WXYC 1D5SA 3KCGI 4IF8A 4AJTA 1DVNA 1JMOA 4R9IA 2H4RA 1DZGL 5BRRI 2RIWA 2PEFA 4AU3A 5IO1A 1BY7A 3DY0A 3H5CA 1QLPA 4RSQA 4Y40A 3UT3A 3R4LA 8APIA 1LQ8A 2WXXA 4PYWA 1PSIA 1IMVA 1TB6I 2H4QA 4C49A 1T1FA 2VH4A 3DRUA 1E04I 2V95A 1LJ5A 1DVMA 1EZXA 3EVJI 3NDDA 3EOXA 3VVJA 2HIJL 1OYHL 1BR8I
chains in the Genus database with same CATH superfamily
2RIVA 1UHGA 1E05I 3STOA 5CDZA 2VDXA 2ACHA 1B3KA 1QMBA 1OO8A 2WY0C 4YIAA 9PAIA 3NE4A 3NDFA 2OAYA 1QMNA 4AQHA 4ZK0A 2BEHI 2CEOA 3T1PA 3OZQA 1OVAB 3DLWA 2B4XL 5CE0A 5EI0A 1YXAA 2H4PA 2PEEA 4GA7A 2WXWA 1ATHA 2ZV6A 1AS4A 1MTPA 1R1LI 1ANTI 4EB1I 5C98A 1SEKA 1SR5A 3CWMA 5CDXA 1JTIA 3B9FI 4IC0A 3DRMA 1JVQI 3PB1I 4DTEA 2R9YA 1OC0A 4EB1L 2GD4C 1LK6I 2HI9A 2XN6A 3F02A 4ROAA 3Q02A 3F5NA 4CAAA 2B5TI 1E03I 2XN5A 3ZHAA 3LW2A 1XQJA 2WY1A 4AU2A 1OVAC 1WZ9A 2DUTA 4ROBA 1HP7A 2WXZC 3CVMA 5INWA 4AU3B 1C8OA 4KDSA 4BB2A 1SNGA 2BEHL 1K9OI 2XN3A 2ZNHA 3PZFA 4Y3KA 3Q03A 1KCTA 3NDAA 9APIA 3F1SA 2ANTI 1NQ9I 4AJUA 4G8RA 4P0OA 1C5GA 1OVAA 2D26A 4ZK3A 1DB2A 1ATTA 2VDYA 1XU8A 1F0CA 2WXZA 1JJOC 4P0FA 4AFXA 2HIJI 1DZGI 1OYHI 2ARQA 4DY0A 2OL2A 3FGQA 4X30A 1JRRA 4AU4A 1DZHI 1AZXI 2XN7A 7APIA 4DY7C 1XQGA 1OPHA 2QUGA 2ARRA 4RO9A 4G8OA 1ATUA 4C41A 1IZ2A 1JMJA 3CAAA 1HLEA 3CWLA 1DZHL 1M93B 1A7CA 2B4XI 3LE2A 5HGCA 2WXYC 1D5SA 3KCGI 4IF8A 4AJTA 1DVNA 1JMOA 4R9IA 2H4RA 1DZGL 5BRRI 2RIWA 2PEFA 4AU3A 5IO1A 1BY7A 3DY0A 3H5CA 1QLPA 4RSQA 4Y40A 3UT3A 3R4LA 8APIA 1LQ8A 2WXXA 4PYWA 1PSIA 1IMVA 1TB6I 2H4QA 4C49A 1T1FA 2VH4A 3DRUA 1E04I 2V95A 1LJ5A 1DVMA 1EZXA 3EVJI 3NDDA 3EOXA 3VVJA 2HIJL 1OYHL 1BR8I
chains in the Genus database with same CATH topology
2RIVA 1UHGA 1E05I 3STOA 5CDZA 2VDXA 2ACHA 1B3KA 1QMBA 1OO8A 2WY0C 4YIAA 9PAIA 3NE4A 3NDFA 2OAYA 1QMNA 4AQHA 4ZK0A 2BEHI 2CEOA 3T1PA 3OZQA 1OVAB 3DLWA 2B4XL 5CE0A 5EI0A 1YXAA 2H4PA 2PEEA 4GA7A 2WXWA 1ATHA 2ZV6A 1AS4A 1MTPA 1R1LI 1ANTI 4EB1I 5C98A 1SEKA 1SR5A 3CWMA 5CDXA 1JTIA 3B9FI 4IC0A 3DRMA 1JVQI 3PB1I 4DTEA 2R9YA 1OC0A 4EB1L 2GD4C 1LK6I 2HI9A 2XN6A 3F02A 4ROAA 3Q02A 3F5NA 4CAAA 2B5TI 1E03I 2XN5A 3ZHAA 3LW2A 1XQJA 2WY1A 4AU2A 1OVAC 1WZ9A 2DUTA 4ROBA 1HP7A 2WXZC 3CVMA 5INWA 4AU3B 1C8OA 4KDSA 4BB2A 1SNGA 2BEHL 1K9OI 2XN3A 2ZNHA 3PZFA 4Y3KA 3Q03A 1KCTA 3NDAA 9APIA 3F1SA 2ANTI 1NQ9I 4AJUA 4G8RA 4P0OA 1C5GA 1OVAA 2D26A 4ZK3A 1DB2A 1ATTA 2VDYA 1XU8A 1F0CA 2WXZA 1JJOC 4P0FA 4AFXA 2HIJI 1DZGI 1OYHI 2ARQA 4DY0A 2OL2A 3FGQA 4X30A 1JRRA 4AU4A 1DZHI 1AZXI 2XN7A 7APIA 4DY7C 1XQGA 1OPHA 2QUGA 2ARRA 4RO9A 4G8OA 1ATUA 4C41A 1IZ2A 1JMJA 3CAAA 1HLEA 3CWLA 1DZHL 1M93B 1A7CA 2B4XI 3LE2A 5HGCA 2WXYC 1D5SA 3KCGI 4IF8A 4AJTA 1DVNA 1JMOA 4R9IA 2H4RA 1DZGL 5BRRI 2RIWA 2PEFA 4AU3A 5IO1A 1BY7A 3DY0A 3H5CA 1QLPA 4RSQA 4Y40A 3UT3A 3R4LA 8APIA 1LQ8A 2WXXA 4PYWA 1PSIA 1IMVA 1TB6I 2H4QA 4C49A 1T1FA 2VH4A 3DRUA 1E04I 2V95A 1LJ5A 1DVMA 1EZXA 3EVJI 3NDDA 3EOXA 3VVJA 2HIJL 1OYHL 1BR8I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RIV A;  1UHG A;  1E05 I;  3STO A;  5CDZ A;  2VDX A;  2ACH A;  1B3K A;  1QMB A;  1OO8 A;  2WY0 C;  4YIA A;  9PAI A;  3NE4 A;  3NDF A;  2OAY A;  1QMN A;  4AQH A;  4ZK0 A;  2BEH I;  2CEO A;  3T1P A;  3OZQ A;  1OVA B;  3DLW A;  2B4X L;  5CE0 A;  5EI0 A;  1YXA A;  2H4P A;  2PEE A;  4GA7 A;  2WXW A;  1ATH A;  2ZV6 A;  1AS4 A;  1MTP A;  1R1L I;  1ANT I;  4EB1 I;  5C98 A;  1SEK A;  1SR5 A;  3CWM A;  5CDX A;  1JTI A;  3B9F I;  4IC0 A;  3DRM A;  1JVQ I;  3PB1 I;  4DTE A;  2R9Y A;  1OC0 A;  4EB1 L;  2GD4 C;  1LK6 I;  2HI9 A;  2XN6 A;  3F02 A;  4ROA A;  3Q02 A;  3F5N A;  4CAA A;  2B5T I;  1E03 I;  2XN5 A;  3ZHA A;  3LW2 A;  1XQJ A;  2WY1 A;  4AU2 A;  1OVA C;  1WZ9 A;  2DUT A;  4ROB A;  1HP7 A;  2WXZ C;  3CVM A;  5INW A;  4AU3 B;  1C8O A;  4KDS A;  4BB2 A;  1SNG A;  2BEH L;  1K9O I;  2XN3 A;  2ZNH A;  3PZF A;  4Y3K A;  3Q03 A;  1KCT A;  3NDA A;  9API A;  3F1S A;  2ANT I;  1NQ9 I;  4AJU A;  4G8R A;  4P0O A;  1C5G A;  1OVA A;  2D26 A;  4ZK3 A;  1DB2 A;  1ATT A;  2VDY A;  1XU8 A;  1F0C A;  2WXZ A;  1JJO C;  4P0F A;  4AFX A;  2HIJ I;  1DZG I;  1OYH I;  2ARQ A;  4DY0 A;  2OL2 A;  3FGQ A;  4X30 A;  1JRR A;  4AU4 A;  1DZH I;  1AZX I;  2XN7 A;  7API A;  4DY7 C;  1XQG A;  1OPH A;  2QUG A;  2ARR A;  4RO9 A;  4G8O A;  1ATU A;  4C41 A;  1IZ2 A;  1JMJ A;  3CAA A;  1HLE A;  3CWL A;  1DZH L;  1M93 B;  1A7C A;  2B4X I;  3LE2 A;  5HGC A;  2WXY C;  1D5S A;  3KCG I;  4IF8 A;  4AJT A;  1DVN A;  1JMO A;  4R9I A;  2H4R A;  1DZG L;  5BRR I;  2RIW A;  2PEF A;  4AU3 A;  5IO1 A;  1BY7 A;  3DY0 A;  3H5C A;  1QLP A;  4RSQ A;  4Y40 A;  3UT3 A;  3R4L A;  8API A;  1LQ8 A;  2WXX A;  4PYW A;  1PSI A;  1IMV A;  1TB6 I;  2H4Q A;  4C49 A;  1T1F A;  2VH4 A;  3DRU A;  1E04 I;  2V95 A;  1LJ5 A;  1DVM A;  1EZX A;  3EVJ I;  3NDD A;  3EOX A;  3VVJ A;  2HIJ L;  1OYH L;  1BR8 I; 
#chains in the Genus database with same CATH topology
 2RIV A;  1UHG A;  1E05 I;  3STO A;  5CDZ A;  2VDX A;  2ACH A;  1B3K A;  1QMB A;  1OO8 A;  2WY0 C;  4YIA A;  9PAI A;  3NE4 A;  3NDF A;  2OAY A;  1QMN A;  4AQH A;  4ZK0 A;  2BEH I;  2CEO A;  3T1P A;  3OZQ A;  1OVA B;  3DLW A;  2B4X L;  5CE0 A;  5EI0 A;  1YXA A;  2H4P A;  2PEE A;  4GA7 A;  2WXW A;  1ATH A;  2ZV6 A;  1AS4 A;  1MTP A;  1R1L I;  1ANT I;  4EB1 I;  5C98 A;  1SEK A;  1SR5 A;  3CWM A;  5CDX A;  1JTI A;  3B9F I;  4IC0 A;  3DRM A;  1JVQ I;  3PB1 I;  4DTE A;  2R9Y A;  1OC0 A;  4EB1 L;  2GD4 C;  1LK6 I;  2HI9 A;  2XN6 A;  3F02 A;  4ROA A;  3Q02 A;  3F5N A;  4CAA A;  2B5T I;  1E03 I;  2XN5 A;  3ZHA A;  3LW2 A;  1XQJ A;  2WY1 A;  4AU2 A;  1OVA C;  1WZ9 A;  2DUT A;  4ROB A;  1HP7 A;  2WXZ C;  3CVM A;  5INW A;  4AU3 B;  1C8O A;  4KDS A;  4BB2 A;  1SNG A;  2BEH L;  1K9O I;  2XN3 A;  2ZNH A;  3PZF A;  4Y3K A;  3Q03 A;  1KCT A;  3NDA A;  9API A;  3F1S A;  2ANT I;  1NQ9 I;  4AJU A;  4G8R A;  4P0O A;  1C5G A;  1OVA A;  2D26 A;  4ZK3 A;  1DB2 A;  1ATT A;  2VDY A;  1XU8 A;  1F0C A;  2WXZ A;  1JJO C;  4P0F A;  4AFX A;  2HIJ I;  1DZG I;  1OYH I;  2ARQ A;  4DY0 A;  2OL2 A;  3FGQ A;  4X30 A;  1JRR A;  4AU4 A;  1DZH I;  1AZX I;  2XN7 A;  7API A;  4DY7 C;  1XQG A;  1OPH A;  2QUG A;  2ARR A;  4RO9 A;  4G8O A;  1ATU A;  4C41 A;  1IZ2 A;  1JMJ A;  3CAA A;  1HLE A;  3CWL A;  1DZH L;  1M93 B;  1A7C A;  2B4X I;  3LE2 A;  5HGC A;  2WXY C;  1D5S A;  3KCG I;  4IF8 A;  4AJT A;  1DVN A;  1JMO A;  4R9I A;  2H4R A;  1DZG L;  5BRR I;  2RIW A;  2PEF A;  4AU3 A;  5IO1 A;  1BY7 A;  3DY0 A;  3H5C A;  1QLP A;  4RSQ A;  4Y40 A;  3UT3 A;  3R4L A;  8API A;  1LQ8 A;  2WXX A;  4PYW A;  1PSI A;  1IMV A;  1TB6 I;  2H4Q A;  4C49 A;  1T1F A;  2VH4 A;  3DRU A;  1E04 I;  2V95 A;  1LJ5 A;  1DVM A;  1EZX A;  3EVJ I;  3NDD A;  3EOX A;  3VVJ A;  2HIJ L;  1OYH L;  1BR8 I; 
#chains in the Genus database with same CATH homology
 2RIV A;  1UHG A;  1E05 I;  3STO A;  5CDZ A;  2VDX A;  2ACH A;  1B3K A;  1QMB A;  1OO8 A;  2WY0 C;  4YIA A;  9PAI A;  3NE4 A;  3NDF A;  2OAY A;  1QMN A;  4AQH A;  4ZK0 A;  2BEH I;  2CEO A;  3T1P A;  3OZQ A;  1OVA B;  3DLW A;  2B4X L;  5CE0 A;  5EI0 A;  1YXA A;  2H4P A;  2PEE A;  4GA7 A;  2WXW A;  1ATH A;  2ZV6 A;  1AS4 A;  1MTP A;  1R1L I;  1ANT I;  4EB1 I;  5C98 A;  1SEK A;  1SR5 A;  3CWM A;  5CDX A;  1JTI A;  3B9F I;  4IC0 A;  3DRM A;  1JVQ I;  3PB1 I;  4DTE A;  2R9Y A;  1OC0 A;  4EB1 L;  2GD4 C;  1LK6 I;  2HI9 A;  2XN6 A;  3F02 A;  4ROA A;  3Q02 A;  3F5N A;  4CAA A;  2B5T I;  1E03 I;  2XN5 A;  3ZHA A;  3LW2 A;  1XQJ A;  2WY1 A;  4AU2 A;  1OVA C;  1WZ9 A;  2DUT A;  4ROB A;  1HP7 A;  2WXZ C;  3CVM A;  5INW A;  4AU3 B;  1C8O A;  4KDS A;  4BB2 A;  1SNG A;  2BEH L;  1K9O I;  2XN3 A;  2ZNH A;  3PZF A;  4Y3K A;  3Q03 A;  1KCT A;  3NDA A;  9API A;  3F1S A;  2ANT I;  1NQ9 I;  4AJU A;  4G8R A;  4P0O A;  1C5G A;  1OVA A;  2D26 A;  4ZK3 A;  1DB2 A;  1ATT A;  2VDY A;  1XU8 A;  1F0C A;  2WXZ A;  1JJO C;  4P0F A;  4AFX A;  2HIJ I;  1DZG I;  1OYH I;  2ARQ A;  4DY0 A;  2OL2 A;  3FGQ A;  4X30 A;  1JRR A;  4AU4 A;  1DZH I;  1AZX I;  2XN7 A;  7API A;  4DY7 C;  1XQG A;  1OPH A;  2QUG A;  2ARR A;  4RO9 A;  4G8O A;  1ATU A;  4C41 A;  1IZ2 A;  1JMJ A;  3CAA A;  1HLE A;  3CWL A;  1DZH L;  1M93 B;  1A7C A;  2B4X I;  3LE2 A;  5HGC A;  2WXY C;  1D5S A;  3KCG I;  4IF8 A;  4AJT A;  1DVN A;  1JMO A;  4R9I A;  2H4R A;  1DZG L;  5BRR I;  2RIW A;  2PEF A;  4AU3 A;  5IO1 A;  1BY7 A;  3DY0 A;  3H5C A;  1QLP A;  4RSQ A;  4Y40 A;  3UT3 A;  3R4L A;  8API A;  1LQ8 A;  2WXX A;  4PYW A;  1PSI A;  1IMV A;  1TB6 I;  2H4Q A;  4C49 A;  1T1F A;  2VH4 A;  3DRU A;  1E04 I;  2V95 A;  1LJ5 A;  1DVM A;  1EZX A;  3EVJ I;  3NDD A;  3EOX A;  3VVJ A;  2HIJ L;  1OYH L;  1BR8 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...