5CDZA

Crystal structure of conserpin in the latent state
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
361
structure length
361
Chain Sequence
SHKLAEANTDFAFSLYRELAKSSPDKNIFFSPVSISSALAMLSLGAKGDTHTQILEGLGFNSEADIHQGFQHLLQTLNRPKGLQLKTANGLFVDKSLKLLDSFLEDSKKLYQAEAFSVDFDPEEAKKQINDWVEKQTNGKIKDLLKDLDSDTVLVLVNAIYFKGKWKKPFDPENTKEEDFHVDEKTTVKVPMMSQKGKFYYYHDDELSCKVLELPYKGNASMLIILPDEGGLQHLEQSLTPETLSKWLKSLTRRSVELYLPKFKIEGTYDLKEVLSNLGITDLFSPGADLSGITEEKLYVSKAVHKAVLEVNEEGTEAAAATGVEIVPRSPPEFKADRPFLFLIRENKTGSILFMGKVVNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords Conserpin in the latent state
publication title Smoothing a rugged protein folding landscape by sequence-based redesign.
pubmed doi rcsb
source organism Synthetic construct
total genus 102
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2015-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.39.10 Mainly Beta Roll Alpha-1-antitrypsin; domain 1 Alpha-1-antitrypsin, domain 1 5cdzA02
3.30.497.10 Alpha Beta 2-Layer Sandwich Antithrombin; Chain I, domain 2 Antithrombin, subunit I, domain 2 5cdzA01
1OVAC 1MTPA 1JVQI 1DZGI 4ROAA 3KCGI 2WXZC 1C8OA 4ZK3A 2OL2A 3H5CA 2R9YA 3NDAA 4AFXA 1M93B 4IF8A 2ZNHA 1DZGL 1B3KA 4DTEA 3NDDA 2PEEA 4BB2A 1QLPA 1E05I 3CWLA 4AU3A 2CEOA 1JMOA 2ACHA 2B4XI 1E04I 1OC0A 1DB2A 1K9OI 1SR5A 1F0CA 1OO8A 5BRRI 9APIA 3R4LA 1TB6I 2XN7A 4ROBA 3LE2A 4P0FA 3DRUA 5INWA 2B4XL 3Q03A 1NQ9I 2WY1A 1XU8A 3FGQA 1AS4A 3VVJA 2B5TI 3PB1I 4YIAA 1JMJA 1XQGA 2HIJI 5CE0A 3DLWA 3ZHAA 2BEHI 2QUGA 1IMVA 2V95A 4C49A 3T1PA 4P0OA 3DRMA 2ARQA 1OVAA 2VDXA 2WXXA 1UHGA 9PAIA 1EZXA 5HGCA 2HIJL 2RIWA 2WXZA 1C5GA 3CVMA 1DVNA 2BEHL 8APIA 4Y40A 1PSIA 1SEKA 3OZQA 1A7CA 2D26A 2HI9A 2PEFA 3CWMA 4AU2A 1XQJA 2ANTI 3UT3A 1ATUA 4RO9A 1QMNA 2H4PA 3DY0A 4ZK0A 4AJUA 1JTIA 4AU4A 1R1LI 1WZ9A 5C98A 1OPHA 1D5SA 2H4QA 3LW2A 1JJOC 3Q02A 1LK6I 3EVJI 4AQHA 4AU3B 2H4RA 2WXWA 3NE4A 2WXYC 2ARRA 4X30A 3B9FI 1QMBA 1HP7A 2ZV6A 4KDSA 4R9IA 2WY0C 1ATHA 2GD4C 4CAAA 4AJTA 4C41A 1OYHI 1ATTA 2RIVA 1LQ8A 4GA7A 2DUTA 3NDFA 2VDYA 1ANTI 1BR8I 4DY0A 3STOA 1OYHL 1BY7A 4Y3KA 1KCTA 1T1FA 1LJ5A 4PYWA 4G8OA 3F5NA 1AZXI 2XN3A 1OVAB 1JRRA 1SNGA 3PZFA 2OAYA 1DZHI 2XN6A 5IO1A 1HLEA 3EOXA 1IZ2A 1E03I 2VH4A 4G8RA 4EB1I 3F1SA 7APIA 4DY7C 4IC0A 1DZHL 5EI0A 1DVMA 1YXAA 2XN5A 5CDXA 4RSQA 3CAAA 3F02A 4EB1L 5CDZA
chains in the Genus database with same CATH superfamily
1OVAC 1MTPA 1JVQI 1DZGI 4ROAA 3KCGI 2WXZC 1C8OA 4ZK3A 2OL2A 3H5CA 2R9YA 3NDAA 4AFXA 1M93B 4IF8A 2ZNHA 1DZGL 1B3KA 4DTEA 3NDDA 2PEEA 4BB2A 1QLPA 1E05I 3CWLA 4AU3A 2CEOA 1JMOA 2ACHA 2B4XI 1E04I 1OC0A 1DB2A 1K9OI 1SR5A 1F0CA 1OO8A 5BRRI 9APIA 3R4LA 1TB6I 2XN7A 4ROBA 3LE2A 4P0FA 3DRUA 5INWA 2B4XL 3Q03A 1NQ9I 2WY1A 1XU8A 3FGQA 1AS4A 3VVJA 2B5TI 3PB1I 4YIAA 1JMJA 1XQGA 2HIJI 5CE0A 3DLWA 3ZHAA 2BEHI 2QUGA 1IMVA 2V95A 4C49A 3T1PA 4P0OA 3DRMA 2ARQA 1OVAA 2VDXA 2WXXA 1UHGA 9PAIA 1EZXA 5HGCA 2HIJL 2RIWA 2WXZA 1C5GA 3CVMA 1DVNA 2BEHL 8APIA 4Y40A 1PSIA 1SEKA 3OZQA 1A7CA 2D26A 2HI9A 2PEFA 3CWMA 4AU2A 1XQJA 2ANTI 3UT3A 1ATUA 4RO9A 1QMNA 2H4PA 3DY0A 4ZK0A 4AJUA 1JTIA 4AU4A 1R1LI 1WZ9A 5C98A 1OPHA 1D5SA 2H4QA 3LW2A 1JJOC 3Q02A 1LK6I 3EVJI 4AQHA 4AU3B 2H4RA 2WXWA 3NE4A 2WXYC 2ARRA 4X30A 3B9FI 1QMBA 1HP7A 2ZV6A 4KDSA 4R9IA 2WY0C 1ATHA 2GD4C 4CAAA 4AJTA 4C41A 1OYHI 1ATTA 2RIVA 1LQ8A 4GA7A 2DUTA 3NDFA 2VDYA 1ANTI 1BR8I 4DY0A 3STOA 1OYHL 1BY7A 4Y3KA 1KCTA 1T1FA 1LJ5A 4PYWA 4G8OA 3F5NA 1AZXI 2XN3A 1OVAB 1JRRA 1SNGA 3PZFA 2OAYA 1DZHI 2XN6A 5IO1A 1HLEA 3EOXA 1IZ2A 1E03I 2VH4A 4G8RA 4EB1I 3F1SA 7APIA 4DY7C 4IC0A 1DZHL 5EI0A 1DVMA 1YXAA 2XN5A 5CDXA 4RSQA 3CAAA 3F02A 4EB1L 5CDZA
chains in the Genus database with same CATH topology
1OVAC 1MTPA 1JVQI 1DZGI 4ROAA 3KCGI 2WXZC 1C8OA 4ZK3A 2OL2A 3H5CA 2R9YA 3NDAA 4AFXA 1M93B 4IF8A 2ZNHA 1DZGL 1B3KA 4DTEA 3NDDA 2PEEA 4BB2A 1QLPA 1E05I 3CWLA 4AU3A 2CEOA 1JMOA 2ACHA 2B4XI 1E04I 1OC0A 1DB2A 1K9OI 1SR5A 1F0CA 1OO8A 5BRRI 9APIA 3R4LA 1TB6I 2XN7A 4ROBA 3LE2A 4P0FA 3DRUA 5INWA 2B4XL 3Q03A 1NQ9I 2WY1A 1XU8A 3FGQA 1AS4A 3VVJA 2B5TI 3PB1I 4YIAA 1JMJA 1XQGA 2HIJI 5CE0A 3DLWA 3ZHAA 2BEHI 2QUGA 1IMVA 2V95A 4C49A 3T1PA 4P0OA 3DRMA 2ARQA 1OVAA 2VDXA 2WXXA 1UHGA 9PAIA 1EZXA 5HGCA 2HIJL 2RIWA 2WXZA 1C5GA 3CVMA 1DVNA 2BEHL 8APIA 4Y40A 1PSIA 1SEKA 3OZQA 1A7CA 2D26A 2HI9A 2PEFA 3CWMA 4AU2A 1XQJA 2ANTI 3UT3A 1ATUA 4RO9A 1QMNA 2H4PA 3DY0A 4ZK0A 4AJUA 1JTIA 4AU4A 1R1LI 1WZ9A 5C98A 1OPHA 1D5SA 2H4QA 3LW2A 1JJOC 3Q02A 1LK6I 3EVJI 4AQHA 4AU3B 2H4RA 2WXWA 3NE4A 2WXYC 2ARRA 4X30A 3B9FI 1QMBA 1HP7A 2ZV6A 4KDSA 4R9IA 2WY0C 1ATHA 2GD4C 4CAAA 4AJTA 4C41A 1OYHI 1ATTA 2RIVA 1LQ8A 4GA7A 2DUTA 3NDFA 2VDYA 1ANTI 1BR8I 4DY0A 3STOA 1OYHL 1BY7A 4Y3KA 1KCTA 1T1FA 1LJ5A 4PYWA 4G8OA 3F5NA 1AZXI 2XN3A 1OVAB 1JRRA 1SNGA 3PZFA 2OAYA 1DZHI 2XN6A 5IO1A 1HLEA 3EOXA 1IZ2A 1E03I 2VH4A 4G8RA 4EB1I 3F1SA 7APIA 4DY7C 4IC0A 1DZHL 5EI0A 1DVMA 1YXAA 2XN5A 5CDXA 4RSQA 3CAAA 3F02A 4EB1L 5CDZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OVA C;  1MTP A;  1JVQ I;  1DZG I;  4ROA A;  3KCG I;  2WXZ C;  1C8O A;  4ZK3 A;  2OL2 A;  3H5C A;  2R9Y A;  3NDA A;  4AFX A;  1M93 B;  4IF8 A;  2ZNH A;  1DZG L;  1B3K A;  4DTE A;  3NDD A;  2PEE A;  4BB2 A;  1QLP A;  1E05 I;  3CWL A;  4AU3 A;  2CEO A;  1JMO A;  2ACH A;  2B4X I;  1E04 I;  1OC0 A;  1DB2 A;  1K9O I;  1SR5 A;  1F0C A;  1OO8 A;  5BRR I;  9API A;  3R4L A;  1TB6 I;  2XN7 A;  4ROB A;  3LE2 A;  4P0F A;  3DRU A;  5INW A;  2B4X L;  3Q03 A;  1NQ9 I;  2WY1 A;  1XU8 A;  3FGQ A;  1AS4 A;  3VVJ A;  2B5T I;  3PB1 I;  4YIA A;  1JMJ A;  1XQG A;  2HIJ I;  5CE0 A;  3DLW A;  3ZHA A;  2BEH I;  2QUG A;  1IMV A;  2V95 A;  4C49 A;  3T1P A;  4P0O A;  3DRM A;  2ARQ A;  1OVA A;  2VDX A;  2WXX A;  1UHG A;  9PAI A;  1EZX A;  5HGC A;  2HIJ L;  2RIW A;  2WXZ A;  1C5G A;  3CVM A;  1DVN A;  2BEH L;  8API A;  4Y40 A;  1PSI A;  1SEK A;  3OZQ A;  1A7C A;  2D26 A;  2HI9 A;  2PEF A;  3CWM A;  4AU2 A;  1XQJ A;  2ANT I;  3UT3 A;  1ATU A;  4RO9 A;  1QMN A;  2H4P A;  3DY0 A;  4ZK0 A;  4AJU A;  1JTI A;  4AU4 A;  1R1L I;  1WZ9 A;  5C98 A;  1OPH A;  1D5S A;  2H4Q A;  3LW2 A;  1JJO C;  3Q02 A;  1LK6 I;  3EVJ I;  4AQH A;  4AU3 B;  2H4R A;  2WXW A;  3NE4 A;  2WXY C;  2ARR A;  4X30 A;  3B9F I;  1QMB A;  1HP7 A;  2ZV6 A;  4KDS A;  4R9I A;  2WY0 C;  1ATH A;  2GD4 C;  4CAA A;  4AJT A;  4C41 A;  1OYH I;  1ATT A;  2RIV A;  1LQ8 A;  4GA7 A;  2DUT A;  3NDF A;  2VDY A;  1ANT I;  1BR8 I;  4DY0 A;  3STO A;  1OYH L;  1BY7 A;  4Y3K A;  1KCT A;  1T1F A;  1LJ5 A;  4PYW A;  4G8O A;  3F5N A;  1AZX I;  2XN3 A;  1OVA B;  1JRR A;  1SNG A;  3PZF A;  2OAY A;  1DZH I;  2XN6 A;  5IO1 A;  1HLE A;  3EOX A;  1IZ2 A;  1E03 I;  2VH4 A;  4G8R A;  4EB1 I;  3F1S A;  7API A;  4DY7 C;  4IC0 A;  1DZH L;  5EI0 A;  1DVM A;  1YXA A;  2XN5 A;  5CDX A;  4RSQ A;  3CAA A;  3F02 A;  4EB1 L;  5CDZ A; 
#chains in the Genus database with same CATH topology
 1OVA C;  1MTP A;  1JVQ I;  1DZG I;  4ROA A;  3KCG I;  2WXZ C;  1C8O A;  4ZK3 A;  2OL2 A;  3H5C A;  2R9Y A;  3NDA A;  4AFX A;  1M93 B;  4IF8 A;  2ZNH A;  1DZG L;  1B3K A;  4DTE A;  3NDD A;  2PEE A;  4BB2 A;  1QLP A;  1E05 I;  3CWL A;  4AU3 A;  2CEO A;  1JMO A;  2ACH A;  2B4X I;  1E04 I;  1OC0 A;  1DB2 A;  1K9O I;  1SR5 A;  1F0C A;  1OO8 A;  5BRR I;  9API A;  3R4L A;  1TB6 I;  2XN7 A;  4ROB A;  3LE2 A;  4P0F A;  3DRU A;  5INW A;  2B4X L;  3Q03 A;  1NQ9 I;  2WY1 A;  1XU8 A;  3FGQ A;  1AS4 A;  3VVJ A;  2B5T I;  3PB1 I;  4YIA A;  1JMJ A;  1XQG A;  2HIJ I;  5CE0 A;  3DLW A;  3ZHA A;  2BEH I;  2QUG A;  1IMV A;  2V95 A;  4C49 A;  3T1P A;  4P0O A;  3DRM A;  2ARQ A;  1OVA A;  2VDX A;  2WXX A;  1UHG A;  9PAI A;  1EZX A;  5HGC A;  2HIJ L;  2RIW A;  2WXZ A;  1C5G A;  3CVM A;  1DVN A;  2BEH L;  8API A;  4Y40 A;  1PSI A;  1SEK A;  3OZQ A;  1A7C A;  2D26 A;  2HI9 A;  2PEF A;  3CWM A;  4AU2 A;  1XQJ A;  2ANT I;  3UT3 A;  1ATU A;  4RO9 A;  1QMN A;  2H4P A;  3DY0 A;  4ZK0 A;  4AJU A;  1JTI A;  4AU4 A;  1R1L I;  1WZ9 A;  5C98 A;  1OPH A;  1D5S A;  2H4Q A;  3LW2 A;  1JJO C;  3Q02 A;  1LK6 I;  3EVJ I;  4AQH A;  4AU3 B;  2H4R A;  2WXW A;  3NE4 A;  2WXY C;  2ARR A;  4X30 A;  3B9F I;  1QMB A;  1HP7 A;  2ZV6 A;  4KDS A;  4R9I A;  2WY0 C;  1ATH A;  2GD4 C;  4CAA A;  4AJT A;  4C41 A;  1OYH I;  1ATT A;  2RIV A;  1LQ8 A;  4GA7 A;  2DUT A;  3NDF A;  2VDY A;  1ANT I;  1BR8 I;  4DY0 A;  3STO A;  1OYH L;  1BY7 A;  4Y3K A;  1KCT A;  1T1F A;  1LJ5 A;  4PYW A;  4G8O A;  3F5N A;  1AZX I;  2XN3 A;  1OVA B;  1JRR A;  1SNG A;  3PZF A;  2OAY A;  1DZH I;  2XN6 A;  5IO1 A;  1HLE A;  3EOX A;  1IZ2 A;  1E03 I;  2VH4 A;  4G8R A;  4EB1 I;  3F1S A;  7API A;  4DY7 C;  4IC0 A;  1DZH L;  5EI0 A;  1DVM A;  1YXA A;  2XN5 A;  5CDX A;  4RSQ A;  3CAA A;  3F02 A;  4EB1 L;  5CDZ A; 
#chains in the Genus database with same CATH homology
 1OVA C;  1MTP A;  1JVQ I;  1DZG I;  4ROA A;  3KCG I;  2WXZ C;  1C8O A;  4ZK3 A;  2OL2 A;  3H5C A;  2R9Y A;  3NDA A;  4AFX A;  1M93 B;  4IF8 A;  2ZNH A;  1DZG L;  1B3K A;  4DTE A;  3NDD A;  2PEE A;  4BB2 A;  1QLP A;  1E05 I;  3CWL A;  4AU3 A;  2CEO A;  1JMO A;  2ACH A;  2B4X I;  1E04 I;  1OC0 A;  1DB2 A;  1K9O I;  1SR5 A;  1F0C A;  1OO8 A;  5BRR I;  9API A;  3R4L A;  1TB6 I;  2XN7 A;  4ROB A;  3LE2 A;  4P0F A;  3DRU A;  5INW A;  2B4X L;  3Q03 A;  1NQ9 I;  2WY1 A;  1XU8 A;  3FGQ A;  1AS4 A;  3VVJ A;  2B5T I;  3PB1 I;  4YIA A;  1JMJ A;  1XQG A;  2HIJ I;  5CE0 A;  3DLW A;  3ZHA A;  2BEH I;  2QUG A;  1IMV A;  2V95 A;  4C49 A;  3T1P A;  4P0O A;  3DRM A;  2ARQ A;  1OVA A;  2VDX A;  2WXX A;  1UHG A;  9PAI A;  1EZX A;  5HGC A;  2HIJ L;  2RIW A;  2WXZ A;  1C5G A;  3CVM A;  1DVN A;  2BEH L;  8API A;  4Y40 A;  1PSI A;  1SEK A;  3OZQ A;  1A7C A;  2D26 A;  2HI9 A;  2PEF A;  3CWM A;  4AU2 A;  1XQJ A;  2ANT I;  3UT3 A;  1ATU A;  4RO9 A;  1QMN A;  2H4P A;  3DY0 A;  4ZK0 A;  4AJU A;  1JTI A;  4AU4 A;  1R1L I;  1WZ9 A;  5C98 A;  1OPH A;  1D5S A;  2H4Q A;  3LW2 A;  1JJO C;  3Q02 A;  1LK6 I;  3EVJ I;  4AQH A;  4AU3 B;  2H4R A;  2WXW A;  3NE4 A;  2WXY C;  2ARR A;  4X30 A;  3B9F I;  1QMB A;  1HP7 A;  2ZV6 A;  4KDS A;  4R9I A;  2WY0 C;  1ATH A;  2GD4 C;  4CAA A;  4AJT A;  4C41 A;  1OYH I;  1ATT A;  2RIV A;  1LQ8 A;  4GA7 A;  2DUT A;  3NDF A;  2VDY A;  1ANT I;  1BR8 I;  4DY0 A;  3STO A;  1OYH L;  1BY7 A;  4Y3K A;  1KCT A;  1T1F A;  1LJ5 A;  4PYW A;  4G8O A;  3F5N A;  1AZX I;  2XN3 A;  1OVA B;  1JRR A;  1SNG A;  3PZF A;  2OAY A;  1DZH I;  2XN6 A;  5IO1 A;  1HLE A;  3EOX A;  1IZ2 A;  1E03 I;  2VH4 A;  4G8R A;  4EB1 I;  3F1S A;  7API A;  4DY7 C;  4IC0 A;  1DZH L;  5EI0 A;  1DVM A;  1YXA A;  2XN5 A;  5CDX A;  4RSQ A;  3CAA A;  3F02 A;  4EB1 L;  5CDZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...