5CE0A

Crystal structure of conserpin with z-mutation
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
367
structure length
352
Chain Sequence
FQGAASSHKLAEANTDFAFSLYRELAKSSPDKNIFFSPVSISSALAMLSLGAKGDTHTQILEGLGFNSEADIHQGFQHLLQTLNRPKGLQLKTANGLFVDKSLKLLDSFLEDSKKLYQAEAFSVDFDPEEAKKQINDWVEKQTNGKIKDLLKDLDSDTVLVLVNAIYFKGKWKKPFDPENTKEEDFHVDEKTTVKVPMMSQKGKFYYYHDDELSCKVLELPYKGNASMLIILPDEGGLQHLEQSLTPETLSKWLKSLTRRSVELYLPKFKIEGTYDLKEVLSNLGITDLFSPGADLSGITEEKLYVSKAVHKAVLEVNPRSPPEFKADRPFLFLIRENKTGSILFMGKVVNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords Native conserpin with Z-variant (E342K)
publication title Smoothing a rugged protein folding landscape by sequence-based redesign.
pubmed doi rcsb
source organism Synthetic construct
total genus 100
structure length 352
sequence length 367
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.39.10 Mainly Beta Roll Alpha-1-antitrypsin; domain 1 Alpha-1-antitrypsin, domain 1 5ce0A02
3.30.497.10 Alpha Beta 2-Layer Sandwich Antithrombin; Chain I, domain 2 Antithrombin, subunit I, domain 2 5ce0A01
1E03I 2WXWA 4BB2A 5HGCA 4ROAA 1OC0A 4AU2A 1HLEA 4Y40A 1JTIA 4AU3A 4C41A 2R9YA 4RSQA 2VDYA 1C5GA 1E05I 3EOXA 3CVMA 4G8RA 1OVAB 1NQ9I 4CAAA 2ARRA 1F0CA 2HIJI 2ZNHA 3R4LA 3CWLA 1YXAA 4C49A 4DY7C 3Q02A 7APIA 5IO1A 2WXYC 4R9IA 5C98A 2ANTI 3B9FI 1OVAA 3PZFA 2V95A 5BRRI 3VVJA 1T1FA 1ANTI 4GA7A 1JMOA 4AJTA 3F5NA 1B3KA 2OL2A 2WXZC 3DRUA 4RO9A 2BEHL 3UT3A 3FGQA 1DZHI 1UHGA 3DRMA 1BR8I 4EB1L 1BY7A 3EVJI 3NE4A 3LW2A 2XN7A 4AFXA 5EI0A 1LK6I 1LQ8A 2RIWA 4IC0A 1M93B 2XN6A 2GD4C 3DY0A 5CDZA 2XN5A 3KCGI 4ZK3A 1JJOC 1JVQI 2B4XL 4DY0A 4IF8A 1LJ5A 1PSIA 3F02A 1DZGL 3NDDA 1HP7A 1OYHL 4P0FA 2PEEA 2VDXA 2ARQA 3PB1I 4G8OA 2XN3A 1SR5A 1MTPA 1XQJA 3DLWA 1QMBA 2HI9A 1JMJA 5INWA 1D5SA 2H4PA 1IMVA 2OAYA 5CDXA 2DUTA 1QMNA 2HIJL 2ACHA 4PYWA 2WY0C 3LE2A 4AU4A 9PAIA 2QUGA 1C8OA 1ATHA 1XQGA 3F1SA 3OZQA 4ROBA 3CAAA 1E04I 4KDSA 1WZ9A 9APIA 1DB2A 8APIA 4X30A 4P0OA 1AZXI 3T1PA 4AQHA 2H4RA 3CWMA 3ZHAA 2H4QA 4Y3KA 3NDAA 2ZV6A 1OVAC 1ATUA 1AS4A 2BEHI 4AJUA 5CE0A 1OO8A 1DZHL 4EB1I 1K9OI 1ATTA 1DVMA 1R1LI 2RIVA 2CEOA 1SNGA 1SEKA 2WXXA 3H5CA 3Q03A 1XU8A 2D26A 1IZ2A 2B4XI 2VH4A 1DVNA 3STOA 4YIAA 4AU3B 1OPHA 1A7CA 2WY1A 2B5TI 4DTEA 1QLPA 4ZK0A 1EZXA 1KCTA 1DZGI 1TB6I 1OYHI 3NDFA 2PEFA 1JRRA 2WXZA
chains in the Genus database with same CATH superfamily
1E03I 2WXWA 4BB2A 5HGCA 4ROAA 1OC0A 4AU2A 1HLEA 4Y40A 1JTIA 4AU3A 4C41A 2R9YA 4RSQA 2VDYA 1C5GA 1E05I 3EOXA 3CVMA 4G8RA 1OVAB 1NQ9I 4CAAA 2ARRA 1F0CA 2HIJI 2ZNHA 3R4LA 3CWLA 1YXAA 4C49A 4DY7C 3Q02A 7APIA 5IO1A 2WXYC 4R9IA 5C98A 2ANTI 3B9FI 1OVAA 3PZFA 2V95A 5BRRI 3VVJA 1T1FA 1ANTI 4GA7A 1JMOA 4AJTA 3F5NA 1B3KA 2OL2A 2WXZC 3DRUA 4RO9A 2BEHL 3UT3A 3FGQA 1DZHI 1UHGA 3DRMA 1BR8I 4EB1L 1BY7A 3EVJI 3NE4A 3LW2A 2XN7A 4AFXA 5EI0A 1LK6I 1LQ8A 2RIWA 4IC0A 1M93B 2XN6A 2GD4C 3DY0A 5CDZA 2XN5A 3KCGI 4ZK3A 1JJOC 1JVQI 2B4XL 4DY0A 4IF8A 1LJ5A 1PSIA 3F02A 1DZGL 3NDDA 1HP7A 1OYHL 4P0FA 2PEEA 2VDXA 2ARQA 3PB1I 4G8OA 2XN3A 1SR5A 1MTPA 1XQJA 3DLWA 1QMBA 2HI9A 1JMJA 5INWA 1D5SA 2H4PA 1IMVA 2OAYA 5CDXA 2DUTA 1QMNA 2HIJL 2ACHA 4PYWA 2WY0C 3LE2A 4AU4A 9PAIA 2QUGA 1C8OA 1ATHA 1XQGA 3F1SA 3OZQA 4ROBA 3CAAA 1E04I 4KDSA 1WZ9A 9APIA 1DB2A 8APIA 4X30A 4P0OA 1AZXI 3T1PA 4AQHA 2H4RA 3CWMA 3ZHAA 2H4QA 4Y3KA 3NDAA 2ZV6A 1OVAC 1ATUA 1AS4A 2BEHI 4AJUA 5CE0A 1OO8A 1DZHL 4EB1I 1K9OI 1ATTA 1DVMA 1R1LI 2RIVA 2CEOA 1SNGA 1SEKA 2WXXA 3H5CA 3Q03A 1XU8A 2D26A 1IZ2A 2B4XI 2VH4A 1DVNA 3STOA 4YIAA 4AU3B 1OPHA 1A7CA 2WY1A 2B5TI 4DTEA 1QLPA 4ZK0A 1EZXA 1KCTA 1DZGI 1TB6I 1OYHI 3NDFA 2PEFA 1JRRA 2WXZA
chains in the Genus database with same CATH topology
1E03I 2WXWA 4BB2A 5HGCA 4ROAA 1OC0A 4AU2A 1HLEA 4Y40A 1JTIA 4AU3A 4C41A 2R9YA 4RSQA 2VDYA 1C5GA 1E05I 3EOXA 3CVMA 4G8RA 1OVAB 1NQ9I 4CAAA 2ARRA 1F0CA 2HIJI 2ZNHA 3R4LA 3CWLA 1YXAA 4C49A 4DY7C 3Q02A 7APIA 5IO1A 2WXYC 4R9IA 5C98A 2ANTI 3B9FI 1OVAA 3PZFA 2V95A 5BRRI 3VVJA 1T1FA 1ANTI 4GA7A 1JMOA 4AJTA 3F5NA 1B3KA 2OL2A 2WXZC 3DRUA 4RO9A 2BEHL 3UT3A 3FGQA 1DZHI 1UHGA 3DRMA 1BR8I 4EB1L 1BY7A 3EVJI 3NE4A 3LW2A 2XN7A 4AFXA 5EI0A 1LK6I 1LQ8A 2RIWA 4IC0A 1M93B 2XN6A 2GD4C 3DY0A 5CDZA 2XN5A 3KCGI 4ZK3A 1JJOC 1JVQI 2B4XL 4DY0A 4IF8A 1LJ5A 1PSIA 3F02A 1DZGL 3NDDA 1HP7A 1OYHL 4P0FA 2PEEA 2VDXA 2ARQA 3PB1I 4G8OA 2XN3A 1SR5A 1MTPA 1XQJA 3DLWA 1QMBA 2HI9A 1JMJA 5INWA 1D5SA 2H4PA 1IMVA 2OAYA 5CDXA 2DUTA 1QMNA 2HIJL 2ACHA 4PYWA 2WY0C 3LE2A 4AU4A 9PAIA 2QUGA 1C8OA 1ATHA 1XQGA 3F1SA 3OZQA 4ROBA 3CAAA 1E04I 4KDSA 1WZ9A 9APIA 1DB2A 8APIA 4X30A 4P0OA 1AZXI 3T1PA 4AQHA 2H4RA 3CWMA 3ZHAA 2H4QA 4Y3KA 3NDAA 2ZV6A 1OVAC 1ATUA 1AS4A 2BEHI 4AJUA 5CE0A 1OO8A 1DZHL 4EB1I 1K9OI 1ATTA 1DVMA 1R1LI 2RIVA 2CEOA 1SNGA 1SEKA 2WXXA 3H5CA 3Q03A 1XU8A 2D26A 1IZ2A 2B4XI 2VH4A 1DVNA 3STOA 4YIAA 4AU3B 1OPHA 1A7CA 2WY1A 2B5TI 4DTEA 1QLPA 4ZK0A 1EZXA 1KCTA 1DZGI 1TB6I 1OYHI 3NDFA 2PEFA 1JRRA 2WXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E03 I;  2WXW A;  4BB2 A;  5HGC A;  4ROA A;  1OC0 A;  4AU2 A;  1HLE A;  4Y40 A;  1JTI A;  4AU3 A;  4C41 A;  2R9Y A;  4RSQ A;  2VDY A;  1C5G A;  1E05 I;  3EOX A;  3CVM A;  4G8R A;  1OVA B;  1NQ9 I;  4CAA A;  2ARR A;  1F0C A;  2HIJ I;  2ZNH A;  3R4L A;  3CWL A;  1YXA A;  4C49 A;  4DY7 C;  3Q02 A;  7API A;  5IO1 A;  2WXY C;  4R9I A;  5C98 A;  2ANT I;  3B9F I;  1OVA A;  3PZF A;  2V95 A;  5BRR I;  3VVJ A;  1T1F A;  1ANT I;  4GA7 A;  1JMO A;  4AJT A;  3F5N A;  1B3K A;  2OL2 A;  2WXZ C;  3DRU A;  4RO9 A;  2BEH L;  3UT3 A;  3FGQ A;  1DZH I;  1UHG A;  3DRM A;  1BR8 I;  4EB1 L;  1BY7 A;  3EVJ I;  3NE4 A;  3LW2 A;  2XN7 A;  4AFX A;  5EI0 A;  1LK6 I;  1LQ8 A;  2RIW A;  4IC0 A;  1M93 B;  2XN6 A;  2GD4 C;  3DY0 A;  5CDZ A;  2XN5 A;  3KCG I;  4ZK3 A;  1JJO C;  1JVQ I;  2B4X L;  4DY0 A;  4IF8 A;  1LJ5 A;  1PSI A;  3F02 A;  1DZG L;  3NDD A;  1HP7 A;  1OYH L;  4P0F A;  2PEE A;  2VDX A;  2ARQ A;  3PB1 I;  4G8O A;  2XN3 A;  1SR5 A;  1MTP A;  1XQJ A;  3DLW A;  1QMB A;  2HI9 A;  1JMJ A;  5INW A;  1D5S A;  2H4P A;  1IMV A;  2OAY A;  5CDX A;  2DUT A;  1QMN A;  2HIJ L;  2ACH A;  4PYW A;  2WY0 C;  3LE2 A;  4AU4 A;  9PAI A;  2QUG A;  1C8O A;  1ATH A;  1XQG A;  3F1S A;  3OZQ A;  4ROB A;  3CAA A;  1E04 I;  4KDS A;  1WZ9 A;  9API A;  1DB2 A;  8API A;  4X30 A;  4P0O A;  1AZX I;  3T1P A;  4AQH A;  2H4R A;  3CWM A;  3ZHA A;  2H4Q A;  4Y3K A;  3NDA A;  2ZV6 A;  1OVA C;  1ATU A;  1AS4 A;  2BEH I;  4AJU A;  5CE0 A;  1OO8 A;  1DZH L;  4EB1 I;  1K9O I;  1ATT A;  1DVM A;  1R1L I;  2RIV A;  2CEO A;  1SNG A;  1SEK A;  2WXX A;  3H5C A;  3Q03 A;  1XU8 A;  2D26 A;  1IZ2 A;  2B4X I;  2VH4 A;  1DVN A;  3STO A;  4YIA A;  4AU3 B;  1OPH A;  1A7C A;  2WY1 A;  2B5T I;  4DTE A;  1QLP A;  4ZK0 A;  1EZX A;  1KCT A;  1DZG I;  1TB6 I;  1OYH I;  3NDF A;  2PEF A;  1JRR A;  2WXZ A; 
#chains in the Genus database with same CATH topology
 1E03 I;  2WXW A;  4BB2 A;  5HGC A;  4ROA A;  1OC0 A;  4AU2 A;  1HLE A;  4Y40 A;  1JTI A;  4AU3 A;  4C41 A;  2R9Y A;  4RSQ A;  2VDY A;  1C5G A;  1E05 I;  3EOX A;  3CVM A;  4G8R A;  1OVA B;  1NQ9 I;  4CAA A;  2ARR A;  1F0C A;  2HIJ I;  2ZNH A;  3R4L A;  3CWL A;  1YXA A;  4C49 A;  4DY7 C;  3Q02 A;  7API A;  5IO1 A;  2WXY C;  4R9I A;  5C98 A;  2ANT I;  3B9F I;  1OVA A;  3PZF A;  2V95 A;  5BRR I;  3VVJ A;  1T1F A;  1ANT I;  4GA7 A;  1JMO A;  4AJT A;  3F5N A;  1B3K A;  2OL2 A;  2WXZ C;  3DRU A;  4RO9 A;  2BEH L;  3UT3 A;  3FGQ A;  1DZH I;  1UHG A;  3DRM A;  1BR8 I;  4EB1 L;  1BY7 A;  3EVJ I;  3NE4 A;  3LW2 A;  2XN7 A;  4AFX A;  5EI0 A;  1LK6 I;  1LQ8 A;  2RIW A;  4IC0 A;  1M93 B;  2XN6 A;  2GD4 C;  3DY0 A;  5CDZ A;  2XN5 A;  3KCG I;  4ZK3 A;  1JJO C;  1JVQ I;  2B4X L;  4DY0 A;  4IF8 A;  1LJ5 A;  1PSI A;  3F02 A;  1DZG L;  3NDD A;  1HP7 A;  1OYH L;  4P0F A;  2PEE A;  2VDX A;  2ARQ A;  3PB1 I;  4G8O A;  2XN3 A;  1SR5 A;  1MTP A;  1XQJ A;  3DLW A;  1QMB A;  2HI9 A;  1JMJ A;  5INW A;  1D5S A;  2H4P A;  1IMV A;  2OAY A;  5CDX A;  2DUT A;  1QMN A;  2HIJ L;  2ACH A;  4PYW A;  2WY0 C;  3LE2 A;  4AU4 A;  9PAI A;  2QUG A;  1C8O A;  1ATH A;  1XQG A;  3F1S A;  3OZQ A;  4ROB A;  3CAA A;  1E04 I;  4KDS A;  1WZ9 A;  9API A;  1DB2 A;  8API A;  4X30 A;  4P0O A;  1AZX I;  3T1P A;  4AQH A;  2H4R A;  3CWM A;  3ZHA A;  2H4Q A;  4Y3K A;  3NDA A;  2ZV6 A;  1OVA C;  1ATU A;  1AS4 A;  2BEH I;  4AJU A;  5CE0 A;  1OO8 A;  1DZH L;  4EB1 I;  1K9O I;  1ATT A;  1DVM A;  1R1L I;  2RIV A;  2CEO A;  1SNG A;  1SEK A;  2WXX A;  3H5C A;  3Q03 A;  1XU8 A;  2D26 A;  1IZ2 A;  2B4X I;  2VH4 A;  1DVN A;  3STO A;  4YIA A;  4AU3 B;  1OPH A;  1A7C A;  2WY1 A;  2B5T I;  4DTE A;  1QLP A;  4ZK0 A;  1EZX A;  1KCT A;  1DZG I;  1TB6 I;  1OYH I;  3NDF A;  2PEF A;  1JRR A;  2WXZ A; 
#chains in the Genus database with same CATH homology
 1E03 I;  2WXW A;  4BB2 A;  5HGC A;  4ROA A;  1OC0 A;  4AU2 A;  1HLE A;  4Y40 A;  1JTI A;  4AU3 A;  4C41 A;  2R9Y A;  4RSQ A;  2VDY A;  1C5G A;  1E05 I;  3EOX A;  3CVM A;  4G8R A;  1OVA B;  1NQ9 I;  4CAA A;  2ARR A;  1F0C A;  2HIJ I;  2ZNH A;  3R4L A;  3CWL A;  1YXA A;  4C49 A;  4DY7 C;  3Q02 A;  7API A;  5IO1 A;  2WXY C;  4R9I A;  5C98 A;  2ANT I;  3B9F I;  1OVA A;  3PZF A;  2V95 A;  5BRR I;  3VVJ A;  1T1F A;  1ANT I;  4GA7 A;  1JMO A;  4AJT A;  3F5N A;  1B3K A;  2OL2 A;  2WXZ C;  3DRU A;  4RO9 A;  2BEH L;  3UT3 A;  3FGQ A;  1DZH I;  1UHG A;  3DRM A;  1BR8 I;  4EB1 L;  1BY7 A;  3EVJ I;  3NE4 A;  3LW2 A;  2XN7 A;  4AFX A;  5EI0 A;  1LK6 I;  1LQ8 A;  2RIW A;  4IC0 A;  1M93 B;  2XN6 A;  2GD4 C;  3DY0 A;  5CDZ A;  2XN5 A;  3KCG I;  4ZK3 A;  1JJO C;  1JVQ I;  2B4X L;  4DY0 A;  4IF8 A;  1LJ5 A;  1PSI A;  3F02 A;  1DZG L;  3NDD A;  1HP7 A;  1OYH L;  4P0F A;  2PEE A;  2VDX A;  2ARQ A;  3PB1 I;  4G8O A;  2XN3 A;  1SR5 A;  1MTP A;  1XQJ A;  3DLW A;  1QMB A;  2HI9 A;  1JMJ A;  5INW A;  1D5S A;  2H4P A;  1IMV A;  2OAY A;  5CDX A;  2DUT A;  1QMN A;  2HIJ L;  2ACH A;  4PYW A;  2WY0 C;  3LE2 A;  4AU4 A;  9PAI A;  2QUG A;  1C8O A;  1ATH A;  1XQG A;  3F1S A;  3OZQ A;  4ROB A;  3CAA A;  1E04 I;  4KDS A;  1WZ9 A;  9API A;  1DB2 A;  8API A;  4X30 A;  4P0O A;  1AZX I;  3T1P A;  4AQH A;  2H4R A;  3CWM A;  3ZHA A;  2H4Q A;  4Y3K A;  3NDA A;  2ZV6 A;  1OVA C;  1ATU A;  1AS4 A;  2BEH I;  4AJU A;  5CE0 A;  1OO8 A;  1DZH L;  4EB1 I;  1K9O I;  1ATT A;  1DVM A;  1R1L I;  2RIV A;  2CEO A;  1SNG A;  1SEK A;  2WXX A;  3H5C A;  3Q03 A;  1XU8 A;  2D26 A;  1IZ2 A;  2B4X I;  2VH4 A;  1DVN A;  3STO A;  4YIA A;  4AU3 B;  1OPH A;  1A7C A;  2WY1 A;  2B5T I;  4DTE A;  1QLP A;  4ZK0 A;  1EZX A;  1KCT A;  1DZG I;  1TB6 I;  1OYH I;  3NDF A;  2PEF A;  1JRR A;  2WXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...