5EI0A

Structure of rcl-cleaved vaspin (serpina12)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
Knots found
sequence length
373
structure length
372
Chain Sequence
KQRMAAKELARQNMDLGFKLLKKLAFYNPGRNIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLHEGFHYIIHELTQKTQDLKLSIGNTLFIDQRLQPQRKFLEDAKNFYSAETILTNFQNLEMAQKQINDFISQKTHGKINNLIENIDPGTVMLLANYIFFRARWKHEFDPNVTKEEDFFLEKNSSVKVPMMFRSGIYQVGYDDKLSCTILEIPYQKNITAIFILPDEGKLKHLEKGLQVDTFSRWKTLLSRRVVDVSVPRLHMTGTFDLKKTLSYIGVSKIFEEHGDLTKIAPHRSLKVGEAVHKAELKMDERGTEGAAGTGAQTLPETPLVVKIDKPYLLLIYSEKIPSVLFLGKIVNPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords Serpin A12
publication title Crystal structure of cleaved vaspin (serpinA12).
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 372
sequence length 373
chains with identical sequence E
other databases KnotProt 2.0: Artifct S -31 -31 -
ec nomenclature
pdb deposition date 2015-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00079 Serpin Serpin (serine protease inhibitor)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.39.10 Mainly Beta Roll Alpha-1-antitrypsin; domain 1 Alpha-1-antitrypsin, domain 1 5ei0A02
3.30.497.10 Alpha Beta 2-Layer Sandwich Antithrombin; Chain I, domain 2 Antithrombin, subunit I, domain 2 5ei0A01
3PB1I 1DZHL 1D5SA 4PYWA 2B4XL 2RIWA 1OO8A 4ROAA 3T1PA 1DZGL 2HI9A 5C98A 1TB6I 1MTPA 3CAAA 3NE4A 2ANTI 1IZ2A 1ATHA 1A7CA 2VH4A 2BEHI 2VDXA 3KCGI 2GD4C 4Y40A 1LQ8A 1BR8I 1WZ9A 3OZQA 4CAAA 3EOXA 1JTIA 1QMNA 4AU3A 4DY7C 1E05I 1E03I 2WXYC 1AS4A 1JMOA 3UT3A 3Q02A 2H4PA 4ROBA 5IO1A 1OVAA 1XQJA 3PZFA 1F0CA 1OVAC 3DRMA 4AQHA 1HLEA 1T1FA 2WY1A 3DY0A 1LJ5A 2V95A 3DLWA 3NDAA 4DY0A 1JRRA 2D26A 5CDZA 1PSIA 2RIVA 1JJOC 2R9YA 2XN3A 5BRRI 1B3KA 1HP7A 3FGQA 4Y3KA 1OPHA 4AU4A 3F02A 4ZK0A 2H4QA 1C5GA 4ZK3A 3NDDA 1QLPA 2B5TI 3R4LA 2DUTA 1OYHI 1QMBA 1DVMA 1LK6I 1SNGA 1IMVA 1KCTA 2HIJL 3F1SA 3H5CA 3STOA 4AU3B 7APIA 1DZHI 2B4XI 1R1LI 1DZGI 2ZV6A 2H4RA 5INWA 4BB2A 1XU8A 4EB1L 2ARQA 3LW2A 9PAIA 1UHGA 1AZXI 4C41A 4C49A 3EVJI 2CEOA 2XN6A 4IF8A 5HGCA 2ACHA 2QUGA 3ZHAA 4DTEA 1E04I 1ANTI 3DRUA 1BY7A 3Q03A 3CVMA 4R9IA 4AJTA 1NQ9I 2BEHL 2WXZA 2WXZC 4G8OA 2XN7A 5CE0A 2WXXA 1OYHL 3NDFA 4AU2A 4P0OA 1ATUA 8APIA 3CWLA 1OVAB 1JVQI 1XQGA 3F5NA 2OAYA 5EI0A 4RO9A 3VVJA 1DB2A 4G8RA 1DVNA 2ZNHA 4RSQA 1SEKA 4YIAA 2PEFA 4AJUA 1EZXA 2OL2A 9APIA 1ATTA 1JMJA 1OC0A 4IC0A 4X30A 2PEEA 1K9OI 4KDSA 2HIJI 2WY0C 2ARRA 3CWMA 1SR5A 2WXWA 2VDYA 2XN5A 1M93B 4EB1I 4GA7A 1C8OA 4P0FA 5CDXA 3LE2A 1YXAA 4AFXA 3B9FI
chains in the Genus database with same CATH superfamily
3PB1I 1DZHL 1D5SA 4PYWA 2B4XL 2RIWA 1OO8A 4ROAA 3T1PA 1DZGL 2HI9A 5C98A 1TB6I 1MTPA 3CAAA 3NE4A 2ANTI 1IZ2A 1ATHA 1A7CA 2VH4A 2BEHI 2VDXA 3KCGI 2GD4C 4Y40A 1LQ8A 1BR8I 1WZ9A 3OZQA 4CAAA 3EOXA 1JTIA 1QMNA 4AU3A 4DY7C 1E05I 1E03I 2WXYC 1AS4A 1JMOA 3UT3A 3Q02A 2H4PA 4ROBA 5IO1A 1OVAA 1XQJA 3PZFA 1F0CA 1OVAC 3DRMA 4AQHA 1HLEA 1T1FA 2WY1A 3DY0A 1LJ5A 2V95A 3DLWA 3NDAA 4DY0A 1JRRA 2D26A 5CDZA 1PSIA 2RIVA 1JJOC 2R9YA 2XN3A 5BRRI 1B3KA 1HP7A 3FGQA 4Y3KA 1OPHA 4AU4A 3F02A 4ZK0A 2H4QA 1C5GA 4ZK3A 3NDDA 1QLPA 2B5TI 3R4LA 2DUTA 1OYHI 1QMBA 1DVMA 1LK6I 1SNGA 1IMVA 1KCTA 2HIJL 3F1SA 3H5CA 3STOA 4AU3B 7APIA 1DZHI 2B4XI 1R1LI 1DZGI 2ZV6A 2H4RA 5INWA 4BB2A 1XU8A 4EB1L 2ARQA 3LW2A 9PAIA 1UHGA 1AZXI 4C41A 4C49A 3EVJI 2CEOA 2XN6A 4IF8A 5HGCA 2ACHA 2QUGA 3ZHAA 4DTEA 1E04I 1ANTI 3DRUA 1BY7A 3Q03A 3CVMA 4R9IA 4AJTA 1NQ9I 2BEHL 2WXZA 2WXZC 4G8OA 2XN7A 5CE0A 2WXXA 1OYHL 3NDFA 4AU2A 4P0OA 1ATUA 8APIA 3CWLA 1OVAB 1JVQI 1XQGA 3F5NA 2OAYA 5EI0A 4RO9A 3VVJA 1DB2A 4G8RA 1DVNA 2ZNHA 4RSQA 1SEKA 4YIAA 2PEFA 4AJUA 1EZXA 2OL2A 9APIA 1ATTA 1JMJA 1OC0A 4IC0A 4X30A 2PEEA 1K9OI 4KDSA 2HIJI 2WY0C 2ARRA 3CWMA 1SR5A 2WXWA 2VDYA 2XN5A 1M93B 4EB1I 4GA7A 1C8OA 4P0FA 5CDXA 3LE2A 1YXAA 4AFXA 3B9FI
chains in the Genus database with same CATH topology
3PB1I 1DZHL 1D5SA 4PYWA 2B4XL 2RIWA 1OO8A 4ROAA 3T1PA 1DZGL 2HI9A 5C98A 1TB6I 1MTPA 3CAAA 3NE4A 2ANTI 1IZ2A 1ATHA 1A7CA 2VH4A 2BEHI 2VDXA 3KCGI 2GD4C 4Y40A 1LQ8A 1BR8I 1WZ9A 3OZQA 4CAAA 3EOXA 1JTIA 1QMNA 4AU3A 4DY7C 1E05I 1E03I 2WXYC 1AS4A 1JMOA 3UT3A 3Q02A 2H4PA 4ROBA 5IO1A 1OVAA 1XQJA 3PZFA 1F0CA 1OVAC 3DRMA 4AQHA 1HLEA 1T1FA 2WY1A 3DY0A 1LJ5A 2V95A 3DLWA 3NDAA 4DY0A 1JRRA 2D26A 5CDZA 1PSIA 2RIVA 1JJOC 2R9YA 2XN3A 5BRRI 1B3KA 1HP7A 3FGQA 4Y3KA 1OPHA 4AU4A 3F02A 4ZK0A 2H4QA 1C5GA 4ZK3A 3NDDA 1QLPA 2B5TI 3R4LA 2DUTA 1OYHI 1QMBA 1DVMA 1LK6I 1SNGA 1IMVA 1KCTA 2HIJL 3F1SA 3H5CA 3STOA 4AU3B 7APIA 1DZHI 2B4XI 1R1LI 1DZGI 2ZV6A 2H4RA 5INWA 4BB2A 1XU8A 4EB1L 2ARQA 3LW2A 9PAIA 1UHGA 1AZXI 4C41A 4C49A 3EVJI 2CEOA 2XN6A 4IF8A 5HGCA 2ACHA 2QUGA 3ZHAA 4DTEA 1E04I 1ANTI 3DRUA 1BY7A 3Q03A 3CVMA 4R9IA 4AJTA 1NQ9I 2BEHL 2WXZA 2WXZC 4G8OA 2XN7A 5CE0A 2WXXA 1OYHL 3NDFA 4AU2A 4P0OA 1ATUA 8APIA 3CWLA 1OVAB 1JVQI 1XQGA 3F5NA 2OAYA 5EI0A 4RO9A 3VVJA 1DB2A 4G8RA 1DVNA 2ZNHA 4RSQA 1SEKA 4YIAA 2PEFA 4AJUA 1EZXA 2OL2A 9APIA 1ATTA 1JMJA 1OC0A 4IC0A 4X30A 2PEEA 1K9OI 4KDSA 2HIJI 2WY0C 2ARRA 3CWMA 1SR5A 2WXWA 2VDYA 2XN5A 1M93B 4EB1I 4GA7A 1C8OA 4P0FA 5CDXA 3LE2A 1YXAA 4AFXA 3B9FI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PB1 I;  1DZH L;  1D5S A;  4PYW A;  2B4X L;  2RIW A;  1OO8 A;  4ROA A;  3T1P A;  1DZG L;  2HI9 A;  5C98 A;  1TB6 I;  1MTP A;  3CAA A;  3NE4 A;  2ANT I;  1IZ2 A;  1ATH A;  1A7C A;  2VH4 A;  2BEH I;  2VDX A;  3KCG I;  2GD4 C;  4Y40 A;  1LQ8 A;  1BR8 I;  1WZ9 A;  3OZQ A;  4CAA A;  3EOX A;  1JTI A;  1QMN A;  4AU3 A;  4DY7 C;  1E05 I;  1E03 I;  2WXY C;  1AS4 A;  1JMO A;  3UT3 A;  3Q02 A;  2H4P A;  4ROB A;  5IO1 A;  1OVA A;  1XQJ A;  3PZF A;  1F0C A;  1OVA C;  3DRM A;  4AQH A;  1HLE A;  1T1F A;  2WY1 A;  3DY0 A;  1LJ5 A;  2V95 A;  3DLW A;  3NDA A;  4DY0 A;  1JRR A;  2D26 A;  5CDZ A;  1PSI A;  2RIV A;  1JJO C;  2R9Y A;  2XN3 A;  5BRR I;  1B3K A;  1HP7 A;  3FGQ A;  4Y3K A;  1OPH A;  4AU4 A;  3F02 A;  4ZK0 A;  2H4Q A;  1C5G A;  4ZK3 A;  3NDD A;  1QLP A;  2B5T I;  3R4L A;  2DUT A;  1OYH I;  1QMB A;  1DVM A;  1LK6 I;  1SNG A;  1IMV A;  1KCT A;  2HIJ L;  3F1S A;  3H5C A;  3STO A;  4AU3 B;  7API A;  1DZH I;  2B4X I;  1R1L I;  1DZG I;  2ZV6 A;  2H4R A;  5INW A;  4BB2 A;  1XU8 A;  4EB1 L;  2ARQ A;  3LW2 A;  9PAI A;  1UHG A;  1AZX I;  4C41 A;  4C49 A;  3EVJ I;  2CEO A;  2XN6 A;  4IF8 A;  5HGC A;  2ACH A;  2QUG A;  3ZHA A;  4DTE A;  1E04 I;  1ANT I;  3DRU A;  1BY7 A;  3Q03 A;  3CVM A;  4R9I A;  4AJT A;  1NQ9 I;  2BEH L;  2WXZ A;  2WXZ C;  4G8O A;  2XN7 A;  5CE0 A;  2WXX A;  1OYH L;  3NDF A;  4AU2 A;  4P0O A;  1ATU A;  8API A;  3CWL A;  1OVA B;  1JVQ I;  1XQG A;  3F5N A;  2OAY A;  5EI0 A;  4RO9 A;  3VVJ A;  1DB2 A;  4G8R A;  1DVN A;  2ZNH A;  4RSQ A;  1SEK A;  4YIA A;  2PEF A;  4AJU A;  1EZX A;  2OL2 A;  9API A;  1ATT A;  1JMJ A;  1OC0 A;  4IC0 A;  4X30 A;  2PEE A;  1K9O I;  4KDS A;  2HIJ I;  2WY0 C;  2ARR A;  3CWM A;  1SR5 A;  2WXW A;  2VDY A;  2XN5 A;  1M93 B;  4EB1 I;  4GA7 A;  1C8O A;  4P0F A;  5CDX A;  3LE2 A;  1YXA A;  4AFX A;  3B9F I; 
#chains in the Genus database with same CATH topology
 3PB1 I;  1DZH L;  1D5S A;  4PYW A;  2B4X L;  2RIW A;  1OO8 A;  4ROA A;  3T1P A;  1DZG L;  2HI9 A;  5C98 A;  1TB6 I;  1MTP A;  3CAA A;  3NE4 A;  2ANT I;  1IZ2 A;  1ATH A;  1A7C A;  2VH4 A;  2BEH I;  2VDX A;  3KCG I;  2GD4 C;  4Y40 A;  1LQ8 A;  1BR8 I;  1WZ9 A;  3OZQ A;  4CAA A;  3EOX A;  1JTI A;  1QMN A;  4AU3 A;  4DY7 C;  1E05 I;  1E03 I;  2WXY C;  1AS4 A;  1JMO A;  3UT3 A;  3Q02 A;  2H4P A;  4ROB A;  5IO1 A;  1OVA A;  1XQJ A;  3PZF A;  1F0C A;  1OVA C;  3DRM A;  4AQH A;  1HLE A;  1T1F A;  2WY1 A;  3DY0 A;  1LJ5 A;  2V95 A;  3DLW A;  3NDA A;  4DY0 A;  1JRR A;  2D26 A;  5CDZ A;  1PSI A;  2RIV A;  1JJO C;  2R9Y A;  2XN3 A;  5BRR I;  1B3K A;  1HP7 A;  3FGQ A;  4Y3K A;  1OPH A;  4AU4 A;  3F02 A;  4ZK0 A;  2H4Q A;  1C5G A;  4ZK3 A;  3NDD A;  1QLP A;  2B5T I;  3R4L A;  2DUT A;  1OYH I;  1QMB A;  1DVM A;  1LK6 I;  1SNG A;  1IMV A;  1KCT A;  2HIJ L;  3F1S A;  3H5C A;  3STO A;  4AU3 B;  7API A;  1DZH I;  2B4X I;  1R1L I;  1DZG I;  2ZV6 A;  2H4R A;  5INW A;  4BB2 A;  1XU8 A;  4EB1 L;  2ARQ A;  3LW2 A;  9PAI A;  1UHG A;  1AZX I;  4C41 A;  4C49 A;  3EVJ I;  2CEO A;  2XN6 A;  4IF8 A;  5HGC A;  2ACH A;  2QUG A;  3ZHA A;  4DTE A;  1E04 I;  1ANT I;  3DRU A;  1BY7 A;  3Q03 A;  3CVM A;  4R9I A;  4AJT A;  1NQ9 I;  2BEH L;  2WXZ A;  2WXZ C;  4G8O A;  2XN7 A;  5CE0 A;  2WXX A;  1OYH L;  3NDF A;  4AU2 A;  4P0O A;  1ATU A;  8API A;  3CWL A;  1OVA B;  1JVQ I;  1XQG A;  3F5N A;  2OAY A;  5EI0 A;  4RO9 A;  3VVJ A;  1DB2 A;  4G8R A;  1DVN A;  2ZNH A;  4RSQ A;  1SEK A;  4YIA A;  2PEF A;  4AJU A;  1EZX A;  2OL2 A;  9API A;  1ATT A;  1JMJ A;  1OC0 A;  4IC0 A;  4X30 A;  2PEE A;  1K9O I;  4KDS A;  2HIJ I;  2WY0 C;  2ARR A;  3CWM A;  1SR5 A;  2WXW A;  2VDY A;  2XN5 A;  1M93 B;  4EB1 I;  4GA7 A;  1C8O A;  4P0F A;  5CDX A;  3LE2 A;  1YXA A;  4AFX A;  3B9F I; 
#chains in the Genus database with same CATH homology
 3PB1 I;  1DZH L;  1D5S A;  4PYW A;  2B4X L;  2RIW A;  1OO8 A;  4ROA A;  3T1P A;  1DZG L;  2HI9 A;  5C98 A;  1TB6 I;  1MTP A;  3CAA A;  3NE4 A;  2ANT I;  1IZ2 A;  1ATH A;  1A7C A;  2VH4 A;  2BEH I;  2VDX A;  3KCG I;  2GD4 C;  4Y40 A;  1LQ8 A;  1BR8 I;  1WZ9 A;  3OZQ A;  4CAA A;  3EOX A;  1JTI A;  1QMN A;  4AU3 A;  4DY7 C;  1E05 I;  1E03 I;  2WXY C;  1AS4 A;  1JMO A;  3UT3 A;  3Q02 A;  2H4P A;  4ROB A;  5IO1 A;  1OVA A;  1XQJ A;  3PZF A;  1F0C A;  1OVA C;  3DRM A;  4AQH A;  1HLE A;  1T1F A;  2WY1 A;  3DY0 A;  1LJ5 A;  2V95 A;  3DLW A;  3NDA A;  4DY0 A;  1JRR A;  2D26 A;  5CDZ A;  1PSI A;  2RIV A;  1JJO C;  2R9Y A;  2XN3 A;  5BRR I;  1B3K A;  1HP7 A;  3FGQ A;  4Y3K A;  1OPH A;  4AU4 A;  3F02 A;  4ZK0 A;  2H4Q A;  1C5G A;  4ZK3 A;  3NDD A;  1QLP A;  2B5T I;  3R4L A;  2DUT A;  1OYH I;  1QMB A;  1DVM A;  1LK6 I;  1SNG A;  1IMV A;  1KCT A;  2HIJ L;  3F1S A;  3H5C A;  3STO A;  4AU3 B;  7API A;  1DZH I;  2B4X I;  1R1L I;  1DZG I;  2ZV6 A;  2H4R A;  5INW A;  4BB2 A;  1XU8 A;  4EB1 L;  2ARQ A;  3LW2 A;  9PAI A;  1UHG A;  1AZX I;  4C41 A;  4C49 A;  3EVJ I;  2CEO A;  2XN6 A;  4IF8 A;  5HGC A;  2ACH A;  2QUG A;  3ZHA A;  4DTE A;  1E04 I;  1ANT I;  3DRU A;  1BY7 A;  3Q03 A;  3CVM A;  4R9I A;  4AJT A;  1NQ9 I;  2BEH L;  2WXZ A;  2WXZ C;  4G8O A;  2XN7 A;  5CE0 A;  2WXX A;  1OYH L;  3NDF A;  4AU2 A;  4P0O A;  1ATU A;  8API A;  3CWL A;  1OVA B;  1JVQ I;  1XQG A;  3F5N A;  2OAY A;  5EI0 A;  4RO9 A;  3VVJ A;  1DB2 A;  4G8R A;  1DVN A;  2ZNH A;  4RSQ A;  1SEK A;  4YIA A;  2PEF A;  4AJU A;  1EZX A;  2OL2 A;  9API A;  1ATT A;  1JMJ A;  1OC0 A;  4IC0 A;  4X30 A;  2PEE A;  1K9O I;  4KDS A;  2HIJ I;  2WY0 C;  2ARR A;  3CWM A;  1SR5 A;  2WXW A;  2VDY A;  2XN5 A;  1M93 B;  4EB1 I;  4GA7 A;  1C8O A;  4P0F A;  5CDX A;  3LE2 A;  1YXA A;  4AFX A;  3B9F I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...