5IO1A

Crystal structure of recombinant human z alpha-1-antitrypsin
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
371
structure length
365
Chain Sequence
NKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDKKGCELEAIPRSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords Alpha-1-antitrypsin
publication title Molecular Mechanism of Z alpha 1-Antitrypsin Deficiency
pubmed doi rcsb
source organism Homo sapiens
total genus 100
structure length 365
sequence length 371
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00079 Serpin Serpin (serine protease inhibitor)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.39.10 Mainly Beta Roll Alpha-1-antitrypsin; domain 1 Alpha-1-antitrypsin, domain 1 5io1A02
3.30.497.10 Alpha Beta 2-Layer Sandwich Antithrombin; Chain I, domain 2 Antithrombin, subunit I, domain 2 5io1A01
2HIJL 1T1FA 2RIVA 1ATHA 2WY1A 4AJTA 3B9FI 4C41A 1C5GA 2RIWA 1E03I 2GD4C 2B4XL 1F0CA 2QUGA 1OVAB 2B4XI 4KDSA 1OYHI 4Y3KA 5CDZA 3PB1I 2ACHA 1LJ5A 3DRMA 2DUTA 3LE2A 3ZHAA 3VVJA 1MTPA 1DZGL 4IF8A 4PYWA 1BR8I 3F1SA 1JMJA 1LK6I 1DZGI 2ARQA 3LW2A 2WXWA 3STOA 4CAAA 1ATTA 3T1PA 2VH4A 4ZK3A 1JTIA 4AU3A 4X30A 1DZHI 2D26A 1M93B 4AFXA 2WXZA 4DY0A 2OAYA 1QMNA 5HGCA 2R9YA 2XN5A 2WXZC 2XN7A 5CDXA 2HIJI 5EI0A 2VDXA 2VDYA 1E04I 1JJOC 3CWMA 2HI9A 2ZNHA 4AU3B 5INWA 1DVNA 4EB1L 1XQJA 1YXAA 1AZXI 4P0OA 4EB1I 2XN3A 7APIA 5BRRI 1JVQI 3DLWA 5C98A 1PSIA 3Q03A 1OO8A 1JMOA 3FGQA 9APIA 3OZQA 2ZV6A 1OC0A 8APIA 4BB2A 4AU4A 2PEEA 3EVJI 2H4QA 3F02A 4YIAA 1K9OI 1R1LI 5CE0A 1ANTI 4C49A 1SEKA 3F5NA 4ROBA 2WXYC 1JRRA 1HP7A 2H4RA 3NDDA 1C8OA 2CEOA 1OVAA 1ATUA 4ROAA 1EZXA 4G8OA 2BEHL 9PAIA 2V95A 1OVAC 2B5TI 3H5CA 2BEHI 4AU2A 4RO9A 4GA7A 3KCGI 5IO1A 1IMVA 1TB6I 1QLPA 1DVMA 4DY7C 1DB2A 3DRUA 1A7CA 1E05I 1UHGA 3CWLA 3Q02A 3UT3A 1XQGA 3NDAA 1LQ8A 1OYHL 1OPHA 2ARRA 1NQ9I 1QMBA 3EOXA 4AQHA 1D5SA 1KCTA 1SNGA 1WZ9A 1HLEA 2H4PA 4R9IA 3CVMA 1IZ2A 2WY0C 3NE4A 4ZK0A 4IC0A 4RSQA 4P0FA 2ANTI 2OL2A 4DTEA 3NDFA 1AS4A 3R4LA 1B3KA 1XU8A 2WXXA 3CAAA 4G8RA 4AJUA 1DZHL 1SR5A 2PEFA 3DY0A 3PZFA 4Y40A 2XN6A 1BY7A
chains in the Genus database with same CATH superfamily
2HIJL 1T1FA 2RIVA 1ATHA 2WY1A 4AJTA 3B9FI 4C41A 1C5GA 2RIWA 1E03I 2GD4C 2B4XL 1F0CA 2QUGA 1OVAB 2B4XI 4KDSA 1OYHI 4Y3KA 5CDZA 3PB1I 2ACHA 1LJ5A 3DRMA 2DUTA 3LE2A 3ZHAA 3VVJA 1MTPA 1DZGL 4IF8A 4PYWA 1BR8I 3F1SA 1JMJA 1LK6I 1DZGI 2ARQA 3LW2A 2WXWA 3STOA 4CAAA 1ATTA 3T1PA 2VH4A 4ZK3A 1JTIA 4AU3A 4X30A 1DZHI 2D26A 1M93B 4AFXA 2WXZA 4DY0A 2OAYA 1QMNA 5HGCA 2R9YA 2XN5A 2WXZC 2XN7A 5CDXA 2HIJI 5EI0A 2VDXA 2VDYA 1E04I 1JJOC 3CWMA 2HI9A 2ZNHA 4AU3B 5INWA 1DVNA 4EB1L 1XQJA 1YXAA 1AZXI 4P0OA 4EB1I 2XN3A 7APIA 5BRRI 1JVQI 3DLWA 5C98A 1PSIA 3Q03A 1OO8A 1JMOA 3FGQA 9APIA 3OZQA 2ZV6A 1OC0A 8APIA 4BB2A 4AU4A 2PEEA 3EVJI 2H4QA 3F02A 4YIAA 1K9OI 1R1LI 5CE0A 1ANTI 4C49A 1SEKA 3F5NA 4ROBA 2WXYC 1JRRA 1HP7A 2H4RA 3NDDA 1C8OA 2CEOA 1OVAA 1ATUA 4ROAA 1EZXA 4G8OA 2BEHL 9PAIA 2V95A 1OVAC 2B5TI 3H5CA 2BEHI 4AU2A 4RO9A 4GA7A 3KCGI 5IO1A 1IMVA 1TB6I 1QLPA 1DVMA 4DY7C 1DB2A 3DRUA 1A7CA 1E05I 1UHGA 3CWLA 3Q02A 3UT3A 1XQGA 3NDAA 1LQ8A 1OYHL 1OPHA 2ARRA 1NQ9I 1QMBA 3EOXA 4AQHA 1D5SA 1KCTA 1SNGA 1WZ9A 1HLEA 2H4PA 4R9IA 3CVMA 1IZ2A 2WY0C 3NE4A 4ZK0A 4IC0A 4RSQA 4P0FA 2ANTI 2OL2A 4DTEA 3NDFA 1AS4A 3R4LA 1B3KA 1XU8A 2WXXA 3CAAA 4G8RA 4AJUA 1DZHL 1SR5A 2PEFA 3DY0A 3PZFA 4Y40A 2XN6A 1BY7A
chains in the Genus database with same CATH topology
2HIJL 1T1FA 2RIVA 1ATHA 2WY1A 4AJTA 3B9FI 4C41A 1C5GA 2RIWA 1E03I 2GD4C 2B4XL 1F0CA 2QUGA 1OVAB 2B4XI 4KDSA 1OYHI 4Y3KA 5CDZA 3PB1I 2ACHA 1LJ5A 3DRMA 2DUTA 3LE2A 3ZHAA 3VVJA 1MTPA 1DZGL 4IF8A 4PYWA 1BR8I 3F1SA 1JMJA 1LK6I 1DZGI 2ARQA 3LW2A 2WXWA 3STOA 4CAAA 1ATTA 3T1PA 2VH4A 4ZK3A 1JTIA 4AU3A 4X30A 1DZHI 2D26A 1M93B 4AFXA 2WXZA 4DY0A 2OAYA 1QMNA 5HGCA 2R9YA 2XN5A 2WXZC 2XN7A 5CDXA 2HIJI 5EI0A 2VDXA 2VDYA 1E04I 1JJOC 3CWMA 2HI9A 2ZNHA 4AU3B 5INWA 1DVNA 4EB1L 1XQJA 1YXAA 1AZXI 4P0OA 4EB1I 2XN3A 7APIA 5BRRI 1JVQI 3DLWA 5C98A 1PSIA 3Q03A 1OO8A 1JMOA 3FGQA 9APIA 3OZQA 2ZV6A 1OC0A 8APIA 4BB2A 4AU4A 2PEEA 3EVJI 2H4QA 3F02A 4YIAA 1K9OI 1R1LI 5CE0A 1ANTI 4C49A 1SEKA 3F5NA 4ROBA 2WXYC 1JRRA 1HP7A 2H4RA 3NDDA 1C8OA 2CEOA 1OVAA 1ATUA 4ROAA 1EZXA 4G8OA 2BEHL 9PAIA 2V95A 1OVAC 2B5TI 3H5CA 2BEHI 4AU2A 4RO9A 4GA7A 3KCGI 5IO1A 1IMVA 1TB6I 1QLPA 1DVMA 4DY7C 1DB2A 3DRUA 1A7CA 1E05I 1UHGA 3CWLA 3Q02A 3UT3A 1XQGA 3NDAA 1LQ8A 1OYHL 1OPHA 2ARRA 1NQ9I 1QMBA 3EOXA 4AQHA 1D5SA 1KCTA 1SNGA 1WZ9A 1HLEA 2H4PA 4R9IA 3CVMA 1IZ2A 2WY0C 3NE4A 4ZK0A 4IC0A 4RSQA 4P0FA 2ANTI 2OL2A 4DTEA 3NDFA 1AS4A 3R4LA 1B3KA 1XU8A 2WXXA 3CAAA 4G8RA 4AJUA 1DZHL 1SR5A 2PEFA 3DY0A 3PZFA 4Y40A 2XN6A 1BY7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HIJ L;  1T1F A;  2RIV A;  1ATH A;  2WY1 A;  4AJT A;  3B9F I;  4C41 A;  1C5G A;  2RIW A;  1E03 I;  2GD4 C;  2B4X L;  1F0C A;  2QUG A;  1OVA B;  2B4X I;  4KDS A;  1OYH I;  4Y3K A;  5CDZ A;  3PB1 I;  2ACH A;  1LJ5 A;  3DRM A;  2DUT A;  3LE2 A;  3ZHA A;  3VVJ A;  1MTP A;  1DZG L;  4IF8 A;  4PYW A;  1BR8 I;  3F1S A;  1JMJ A;  1LK6 I;  1DZG I;  2ARQ A;  3LW2 A;  2WXW A;  3STO A;  4CAA A;  1ATT A;  3T1P A;  2VH4 A;  4ZK3 A;  1JTI A;  4AU3 A;  4X30 A;  1DZH I;  2D26 A;  1M93 B;  4AFX A;  2WXZ A;  4DY0 A;  2OAY A;  1QMN A;  5HGC A;  2R9Y A;  2XN5 A;  2WXZ C;  2XN7 A;  5CDX A;  2HIJ I;  5EI0 A;  2VDX A;  2VDY A;  1E04 I;  1JJO C;  3CWM A;  2HI9 A;  2ZNH A;  4AU3 B;  5INW A;  1DVN A;  4EB1 L;  1XQJ A;  1YXA A;  1AZX I;  4P0O A;  4EB1 I;  2XN3 A;  7API A;  5BRR I;  1JVQ I;  3DLW A;  5C98 A;  1PSI A;  3Q03 A;  1OO8 A;  1JMO A;  3FGQ A;  9API A;  3OZQ A;  2ZV6 A;  1OC0 A;  8API A;  4BB2 A;  4AU4 A;  2PEE A;  3EVJ I;  2H4Q A;  3F02 A;  4YIA A;  1K9O I;  1R1L I;  5CE0 A;  1ANT I;  4C49 A;  1SEK A;  3F5N A;  4ROB A;  2WXY C;  1JRR A;  1HP7 A;  2H4R A;  3NDD A;  1C8O A;  2CEO A;  1OVA A;  1ATU A;  4ROA A;  1EZX A;  4G8O A;  2BEH L;  9PAI A;  2V95 A;  1OVA C;  2B5T I;  3H5C A;  2BEH I;  4AU2 A;  4RO9 A;  4GA7 A;  3KCG I;  5IO1 A;  1IMV A;  1TB6 I;  1QLP A;  1DVM A;  4DY7 C;  1DB2 A;  3DRU A;  1A7C A;  1E05 I;  1UHG A;  3CWL A;  3Q02 A;  3UT3 A;  1XQG A;  3NDA A;  1LQ8 A;  1OYH L;  1OPH A;  2ARR A;  1NQ9 I;  1QMB A;  3EOX A;  4AQH A;  1D5S A;  1KCT A;  1SNG A;  1WZ9 A;  1HLE A;  2H4P A;  4R9I A;  3CVM A;  1IZ2 A;  2WY0 C;  3NE4 A;  4ZK0 A;  4IC0 A;  4RSQ A;  4P0F A;  2ANT I;  2OL2 A;  4DTE A;  3NDF A;  1AS4 A;  3R4L A;  1B3K A;  1XU8 A;  2WXX A;  3CAA A;  4G8R A;  4AJU A;  1DZH L;  1SR5 A;  2PEF A;  3DY0 A;  3PZF A;  4Y40 A;  2XN6 A;  1BY7 A; 
#chains in the Genus database with same CATH topology
 2HIJ L;  1T1F A;  2RIV A;  1ATH A;  2WY1 A;  4AJT A;  3B9F I;  4C41 A;  1C5G A;  2RIW A;  1E03 I;  2GD4 C;  2B4X L;  1F0C A;  2QUG A;  1OVA B;  2B4X I;  4KDS A;  1OYH I;  4Y3K A;  5CDZ A;  3PB1 I;  2ACH A;  1LJ5 A;  3DRM A;  2DUT A;  3LE2 A;  3ZHA A;  3VVJ A;  1MTP A;  1DZG L;  4IF8 A;  4PYW A;  1BR8 I;  3F1S A;  1JMJ A;  1LK6 I;  1DZG I;  2ARQ A;  3LW2 A;  2WXW A;  3STO A;  4CAA A;  1ATT A;  3T1P A;  2VH4 A;  4ZK3 A;  1JTI A;  4AU3 A;  4X30 A;  1DZH I;  2D26 A;  1M93 B;  4AFX A;  2WXZ A;  4DY0 A;  2OAY A;  1QMN A;  5HGC A;  2R9Y A;  2XN5 A;  2WXZ C;  2XN7 A;  5CDX A;  2HIJ I;  5EI0 A;  2VDX A;  2VDY A;  1E04 I;  1JJO C;  3CWM A;  2HI9 A;  2ZNH A;  4AU3 B;  5INW A;  1DVN A;  4EB1 L;  1XQJ A;  1YXA A;  1AZX I;  4P0O A;  4EB1 I;  2XN3 A;  7API A;  5BRR I;  1JVQ I;  3DLW A;  5C98 A;  1PSI A;  3Q03 A;  1OO8 A;  1JMO A;  3FGQ A;  9API A;  3OZQ A;  2ZV6 A;  1OC0 A;  8API A;  4BB2 A;  4AU4 A;  2PEE A;  3EVJ I;  2H4Q A;  3F02 A;  4YIA A;  1K9O I;  1R1L I;  5CE0 A;  1ANT I;  4C49 A;  1SEK A;  3F5N A;  4ROB A;  2WXY C;  1JRR A;  1HP7 A;  2H4R A;  3NDD A;  1C8O A;  2CEO A;  1OVA A;  1ATU A;  4ROA A;  1EZX A;  4G8O A;  2BEH L;  9PAI A;  2V95 A;  1OVA C;  2B5T I;  3H5C A;  2BEH I;  4AU2 A;  4RO9 A;  4GA7 A;  3KCG I;  5IO1 A;  1IMV A;  1TB6 I;  1QLP A;  1DVM A;  4DY7 C;  1DB2 A;  3DRU A;  1A7C A;  1E05 I;  1UHG A;  3CWL A;  3Q02 A;  3UT3 A;  1XQG A;  3NDA A;  1LQ8 A;  1OYH L;  1OPH A;  2ARR A;  1NQ9 I;  1QMB A;  3EOX A;  4AQH A;  1D5S A;  1KCT A;  1SNG A;  1WZ9 A;  1HLE A;  2H4P A;  4R9I A;  3CVM A;  1IZ2 A;  2WY0 C;  3NE4 A;  4ZK0 A;  4IC0 A;  4RSQ A;  4P0F A;  2ANT I;  2OL2 A;  4DTE A;  3NDF A;  1AS4 A;  3R4L A;  1B3K A;  1XU8 A;  2WXX A;  3CAA A;  4G8R A;  4AJU A;  1DZH L;  1SR5 A;  2PEF A;  3DY0 A;  3PZF A;  4Y40 A;  2XN6 A;  1BY7 A; 
#chains in the Genus database with same CATH homology
 2HIJ L;  1T1F A;  2RIV A;  1ATH A;  2WY1 A;  4AJT A;  3B9F I;  4C41 A;  1C5G A;  2RIW A;  1E03 I;  2GD4 C;  2B4X L;  1F0C A;  2QUG A;  1OVA B;  2B4X I;  4KDS A;  1OYH I;  4Y3K A;  5CDZ A;  3PB1 I;  2ACH A;  1LJ5 A;  3DRM A;  2DUT A;  3LE2 A;  3ZHA A;  3VVJ A;  1MTP A;  1DZG L;  4IF8 A;  4PYW A;  1BR8 I;  3F1S A;  1JMJ A;  1LK6 I;  1DZG I;  2ARQ A;  3LW2 A;  2WXW A;  3STO A;  4CAA A;  1ATT A;  3T1P A;  2VH4 A;  4ZK3 A;  1JTI A;  4AU3 A;  4X30 A;  1DZH I;  2D26 A;  1M93 B;  4AFX A;  2WXZ A;  4DY0 A;  2OAY A;  1QMN A;  5HGC A;  2R9Y A;  2XN5 A;  2WXZ C;  2XN7 A;  5CDX A;  2HIJ I;  5EI0 A;  2VDX A;  2VDY A;  1E04 I;  1JJO C;  3CWM A;  2HI9 A;  2ZNH A;  4AU3 B;  5INW A;  1DVN A;  4EB1 L;  1XQJ A;  1YXA A;  1AZX I;  4P0O A;  4EB1 I;  2XN3 A;  7API A;  5BRR I;  1JVQ I;  3DLW A;  5C98 A;  1PSI A;  3Q03 A;  1OO8 A;  1JMO A;  3FGQ A;  9API A;  3OZQ A;  2ZV6 A;  1OC0 A;  8API A;  4BB2 A;  4AU4 A;  2PEE A;  3EVJ I;  2H4Q A;  3F02 A;  4YIA A;  1K9O I;  1R1L I;  5CE0 A;  1ANT I;  4C49 A;  1SEK A;  3F5N A;  4ROB A;  2WXY C;  1JRR A;  1HP7 A;  2H4R A;  3NDD A;  1C8O A;  2CEO A;  1OVA A;  1ATU A;  4ROA A;  1EZX A;  4G8O A;  2BEH L;  9PAI A;  2V95 A;  1OVA C;  2B5T I;  3H5C A;  2BEH I;  4AU2 A;  4RO9 A;  4GA7 A;  3KCG I;  5IO1 A;  1IMV A;  1TB6 I;  1QLP A;  1DVM A;  4DY7 C;  1DB2 A;  3DRU A;  1A7C A;  1E05 I;  1UHG A;  3CWL A;  3Q02 A;  3UT3 A;  1XQG A;  3NDA A;  1LQ8 A;  1OYH L;  1OPH A;  2ARR A;  1NQ9 I;  1QMB A;  3EOX A;  4AQH A;  1D5S A;  1KCT A;  1SNG A;  1WZ9 A;  1HLE A;  2H4P A;  4R9I A;  3CVM A;  1IZ2 A;  2WY0 C;  3NE4 A;  4ZK0 A;  4IC0 A;  4RSQ A;  4P0F A;  2ANT I;  2OL2 A;  4DTE A;  3NDF A;  1AS4 A;  3R4L A;  1B3K A;  1XU8 A;  2WXX A;  3CAA A;  4G8R A;  4AJU A;  1DZH L;  1SR5 A;  2PEF A;  3DY0 A;  3PZF A;  4Y40 A;  2XN6 A;  1BY7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...