7APIA

The s variant of human alpha1-antitrypsin, structure and implications for function and metabolism
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
339
structure length
339
Chain Sequence
HPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Proteinase inhibitor
molecule keywords ALPHA 1-ANTITRYPSIN
publication title The S variant of human alpha 1-antitrypsin, structure and implications for function and metabolism.
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 339
sequence length 339
ec nomenclature
pdb deposition date 1988-09-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.39.10 Mainly Beta Roll Alpha-1-antitrypsin; domain 1 Alpha-1-antitrypsin, domain 1 7apiA01
3.30.497.10 Alpha Beta 2-Layer Sandwich Antithrombin; Chain I, domain 2 Antithrombin, subunit I, domain 2 7apiA02
4AFXA 3NE4A 1UHGA 4YIAA 1E05I 4P0FA 4EB1L 1DVNA 1JVQI 1QLPA 2ARRA 4GA7A 2RIWA 2CEOA 4Y3KA 1BY7A 1SEKA 1E03I 1XU8A 4C41A 1ANTI 1DZGL 2PEEA 1DVMA 3LE2A 1DZHI 4AU2A 2HIJI 2B4XI 4G8OA 2ANTI 4G8RA 2XN5A 5EI0A 2H4QA 3NDDA 3B9FI 3F1SA 1EZXA 3KCGI 1JJOC 2ACHA 4AJUA 2BEHI 4C49A 4IF8A 3F5NA 3UT3A 3LW2A 7APIA 4R9IA 2WXZA 4Y40A 3CWLA 8APIA 4AU3A 2B5TI 2WXXA 1LK6I 1SNGA 3PZFA 3STOA 3Q03A 3T1PA 2ZV6A 1B3KA 2WY0C 1TB6I 1YXAA 2H4PA 3ZHAA 1OVAA 1OPHA 4ZK0A 3F02A 1JRRA 1SR5A 1DB2A 2HI9A 1LQ8A 1NQ9I 3DLWA 3PB1I 4ROBA 1ATUA 1HP7A 2WXZC 4BB2A 1HLEA 4AU4A 2OAYA 3OZQA 3NDAA 1R1LI 1KCTA 1T1FA 4AQHA 9APIA 1OVAC 3Q02A 5INWA 4AU3B 4PYWA 1JMOA 1E04I 4P0OA 2B4XL 3R4LA 1AS4A 2XN6A 2V95A 1IMVA 1XQJA 1OVAB 4DY7C 2VDYA 2GD4C 5C98A 1OYHL 1WZ9A 2WY1A 4DTEA 2BEHL 3EVJI 1MTPA 1A7CA 1OC0A 3CVMA 5HGCA 4EB1I 2OL2A 1M93B 3FGQA 3CAAA 2RIVA 5IO1A 2VH4A 9PAIA 2D26A 2WXYC 4RO9A 1JTIA 1K9OI 1XQGA 4AJTA 1DZGI 3NDFA 4DY0A 1LJ5A 1QMNA 1D5SA 4ZK3A 2VDXA 2ZNHA 4ROAA 1DZHL 2H4RA 4X30A 2ARQA 2HIJL 5CE0A 3EOXA 4IC0A 1PSIA 1C5GA 3H5CA 2QUGA 1BR8I 2DUTA 1ATHA 1C8OA 1JMJA 1OO8A 1AZXI 2XN3A 4RSQA 3DRMA 2XN7A 3DRUA 1QMBA 4CAAA 2PEFA 2R9YA 1ATTA 1OYHI 3CWMA 5BRRI 5CDZA 4KDSA 2WXWA 3DY0A 1F0CA 1IZ2A 3VVJA 5CDXA
chains in the Genus database with same CATH superfamily
4AFXA 3NE4A 1UHGA 4YIAA 1E05I 4P0FA 4EB1L 1DVNA 1JVQI 1QLPA 2ARRA 4GA7A 2RIWA 2CEOA 4Y3KA 1BY7A 1SEKA 1E03I 1XU8A 4C41A 1ANTI 1DZGL 2PEEA 1DVMA 3LE2A 1DZHI 4AU2A 2HIJI 2B4XI 4G8OA 2ANTI 4G8RA 2XN5A 5EI0A 2H4QA 3NDDA 3B9FI 3F1SA 1EZXA 3KCGI 1JJOC 2ACHA 4AJUA 2BEHI 4C49A 4IF8A 3F5NA 3UT3A 3LW2A 7APIA 4R9IA 2WXZA 4Y40A 3CWLA 8APIA 4AU3A 2B5TI 2WXXA 1LK6I 1SNGA 3PZFA 3STOA 3Q03A 3T1PA 2ZV6A 1B3KA 2WY0C 1TB6I 1YXAA 2H4PA 3ZHAA 1OVAA 1OPHA 4ZK0A 3F02A 1JRRA 1SR5A 1DB2A 2HI9A 1LQ8A 1NQ9I 3DLWA 3PB1I 4ROBA 1ATUA 1HP7A 2WXZC 4BB2A 1HLEA 4AU4A 2OAYA 3OZQA 3NDAA 1R1LI 1KCTA 1T1FA 4AQHA 9APIA 1OVAC 3Q02A 5INWA 4AU3B 4PYWA 1JMOA 1E04I 4P0OA 2B4XL 3R4LA 1AS4A 2XN6A 2V95A 1IMVA 1XQJA 1OVAB 4DY7C 2VDYA 2GD4C 5C98A 1OYHL 1WZ9A 2WY1A 4DTEA 2BEHL 3EVJI 1MTPA 1A7CA 1OC0A 3CVMA 5HGCA 4EB1I 2OL2A 1M93B 3FGQA 3CAAA 2RIVA 5IO1A 2VH4A 9PAIA 2D26A 2WXYC 4RO9A 1JTIA 1K9OI 1XQGA 4AJTA 1DZGI 3NDFA 4DY0A 1LJ5A 1QMNA 1D5SA 4ZK3A 2VDXA 2ZNHA 4ROAA 1DZHL 2H4RA 4X30A 2ARQA 2HIJL 5CE0A 3EOXA 4IC0A 1PSIA 1C5GA 3H5CA 2QUGA 1BR8I 2DUTA 1ATHA 1C8OA 1JMJA 1OO8A 1AZXI 2XN3A 4RSQA 3DRMA 2XN7A 3DRUA 1QMBA 4CAAA 2PEFA 2R9YA 1ATTA 1OYHI 3CWMA 5BRRI 5CDZA 4KDSA 2WXWA 3DY0A 1F0CA 1IZ2A 3VVJA 5CDXA
chains in the Genus database with same CATH topology
4AFXA 3NE4A 1UHGA 4YIAA 1E05I 4P0FA 4EB1L 1DVNA 1JVQI 1QLPA 2ARRA 4GA7A 2RIWA 2CEOA 4Y3KA 1BY7A 1SEKA 1E03I 1XU8A 4C41A 1ANTI 1DZGL 2PEEA 1DVMA 3LE2A 1DZHI 4AU2A 2HIJI 2B4XI 4G8OA 2ANTI 4G8RA 2XN5A 5EI0A 2H4QA 3NDDA 3B9FI 3F1SA 1EZXA 3KCGI 1JJOC 2ACHA 4AJUA 2BEHI 4C49A 4IF8A 3F5NA 3UT3A 3LW2A 7APIA 4R9IA 2WXZA 4Y40A 3CWLA 8APIA 4AU3A 2B5TI 2WXXA 1LK6I 1SNGA 3PZFA 3STOA 3Q03A 3T1PA 2ZV6A 1B3KA 2WY0C 1TB6I 1YXAA 2H4PA 3ZHAA 1OVAA 1OPHA 4ZK0A 3F02A 1JRRA 1SR5A 1DB2A 2HI9A 1LQ8A 1NQ9I 3DLWA 3PB1I 4ROBA 1ATUA 1HP7A 2WXZC 4BB2A 1HLEA 4AU4A 2OAYA 3OZQA 3NDAA 1R1LI 1KCTA 1T1FA 4AQHA 9APIA 1OVAC 3Q02A 5INWA 4AU3B 4PYWA 1JMOA 1E04I 4P0OA 2B4XL 3R4LA 1AS4A 2XN6A 2V95A 1IMVA 1XQJA 1OVAB 4DY7C 2VDYA 2GD4C 5C98A 1OYHL 1WZ9A 2WY1A 4DTEA 2BEHL 3EVJI 1MTPA 1A7CA 1OC0A 3CVMA 5HGCA 4EB1I 2OL2A 1M93B 3FGQA 3CAAA 2RIVA 5IO1A 2VH4A 9PAIA 2D26A 2WXYC 4RO9A 1JTIA 1K9OI 1XQGA 4AJTA 1DZGI 3NDFA 4DY0A 1LJ5A 1QMNA 1D5SA 4ZK3A 2VDXA 2ZNHA 4ROAA 1DZHL 2H4RA 4X30A 2ARQA 2HIJL 5CE0A 3EOXA 4IC0A 1PSIA 1C5GA 3H5CA 2QUGA 1BR8I 2DUTA 1ATHA 1C8OA 1JMJA 1OO8A 1AZXI 2XN3A 4RSQA 3DRMA 2XN7A 3DRUA 1QMBA 4CAAA 2PEFA 2R9YA 1ATTA 1OYHI 3CWMA 5BRRI 5CDZA 4KDSA 2WXWA 3DY0A 1F0CA 1IZ2A 3VVJA 5CDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AFX A;  3NE4 A;  1UHG A;  4YIA A;  1E05 I;  4P0F A;  4EB1 L;  1DVN A;  1JVQ I;  1QLP A;  2ARR A;  4GA7 A;  2RIW A;  2CEO A;  4Y3K A;  1BY7 A;  1SEK A;  1E03 I;  1XU8 A;  4C41 A;  1ANT I;  1DZG L;  2PEE A;  1DVM A;  3LE2 A;  1DZH I;  4AU2 A;  2HIJ I;  2B4X I;  4G8O A;  2ANT I;  4G8R A;  2XN5 A;  5EI0 A;  2H4Q A;  3NDD A;  3B9F I;  3F1S A;  1EZX A;  3KCG I;  1JJO C;  2ACH A;  4AJU A;  2BEH I;  4C49 A;  4IF8 A;  3F5N A;  3UT3 A;  3LW2 A;  7API A;  4R9I A;  2WXZ A;  4Y40 A;  3CWL A;  8API A;  4AU3 A;  2B5T I;  2WXX A;  1LK6 I;  1SNG A;  3PZF A;  3STO A;  3Q03 A;  3T1P A;  2ZV6 A;  1B3K A;  2WY0 C;  1TB6 I;  1YXA A;  2H4P A;  3ZHA A;  1OVA A;  1OPH A;  4ZK0 A;  3F02 A;  1JRR A;  1SR5 A;  1DB2 A;  2HI9 A;  1LQ8 A;  1NQ9 I;  3DLW A;  3PB1 I;  4ROB A;  1ATU A;  1HP7 A;  2WXZ C;  4BB2 A;  1HLE A;  4AU4 A;  2OAY A;  3OZQ A;  3NDA A;  1R1L I;  1KCT A;  1T1F A;  4AQH A;  9API A;  1OVA C;  3Q02 A;  5INW A;  4AU3 B;  4PYW A;  1JMO A;  1E04 I;  4P0O A;  2B4X L;  3R4L A;  1AS4 A;  2XN6 A;  2V95 A;  1IMV A;  1XQJ A;  1OVA B;  4DY7 C;  2VDY A;  2GD4 C;  5C98 A;  1OYH L;  1WZ9 A;  2WY1 A;  4DTE A;  2BEH L;  3EVJ I;  1MTP A;  1A7C A;  1OC0 A;  3CVM A;  5HGC A;  4EB1 I;  2OL2 A;  1M93 B;  3FGQ A;  3CAA A;  2RIV A;  5IO1 A;  2VH4 A;  9PAI A;  2D26 A;  2WXY C;  4RO9 A;  1JTI A;  1K9O I;  1XQG A;  4AJT A;  1DZG I;  3NDF A;  4DY0 A;  1LJ5 A;  1QMN A;  1D5S A;  4ZK3 A;  2VDX A;  2ZNH A;  4ROA A;  1DZH L;  2H4R A;  4X30 A;  2ARQ A;  2HIJ L;  5CE0 A;  3EOX A;  4IC0 A;  1PSI A;  1C5G A;  3H5C A;  2QUG A;  1BR8 I;  2DUT A;  1ATH A;  1C8O A;  1JMJ A;  1OO8 A;  1AZX I;  2XN3 A;  4RSQ A;  3DRM A;  2XN7 A;  3DRU A;  1QMB A;  4CAA A;  2PEF A;  2R9Y A;  1ATT A;  1OYH I;  3CWM A;  5BRR I;  5CDZ A;  4KDS A;  2WXW A;  3DY0 A;  1F0C A;  1IZ2 A;  3VVJ A;  5CDX A; 
#chains in the Genus database with same CATH topology
 4AFX A;  3NE4 A;  1UHG A;  4YIA A;  1E05 I;  4P0F A;  4EB1 L;  1DVN A;  1JVQ I;  1QLP A;  2ARR A;  4GA7 A;  2RIW A;  2CEO A;  4Y3K A;  1BY7 A;  1SEK A;  1E03 I;  1XU8 A;  4C41 A;  1ANT I;  1DZG L;  2PEE A;  1DVM A;  3LE2 A;  1DZH I;  4AU2 A;  2HIJ I;  2B4X I;  4G8O A;  2ANT I;  4G8R A;  2XN5 A;  5EI0 A;  2H4Q A;  3NDD A;  3B9F I;  3F1S A;  1EZX A;  3KCG I;  1JJO C;  2ACH A;  4AJU A;  2BEH I;  4C49 A;  4IF8 A;  3F5N A;  3UT3 A;  3LW2 A;  7API A;  4R9I A;  2WXZ A;  4Y40 A;  3CWL A;  8API A;  4AU3 A;  2B5T I;  2WXX A;  1LK6 I;  1SNG A;  3PZF A;  3STO A;  3Q03 A;  3T1P A;  2ZV6 A;  1B3K A;  2WY0 C;  1TB6 I;  1YXA A;  2H4P A;  3ZHA A;  1OVA A;  1OPH A;  4ZK0 A;  3F02 A;  1JRR A;  1SR5 A;  1DB2 A;  2HI9 A;  1LQ8 A;  1NQ9 I;  3DLW A;  3PB1 I;  4ROB A;  1ATU A;  1HP7 A;  2WXZ C;  4BB2 A;  1HLE A;  4AU4 A;  2OAY A;  3OZQ A;  3NDA A;  1R1L I;  1KCT A;  1T1F A;  4AQH A;  9API A;  1OVA C;  3Q02 A;  5INW A;  4AU3 B;  4PYW A;  1JMO A;  1E04 I;  4P0O A;  2B4X L;  3R4L A;  1AS4 A;  2XN6 A;  2V95 A;  1IMV A;  1XQJ A;  1OVA B;  4DY7 C;  2VDY A;  2GD4 C;  5C98 A;  1OYH L;  1WZ9 A;  2WY1 A;  4DTE A;  2BEH L;  3EVJ I;  1MTP A;  1A7C A;  1OC0 A;  3CVM A;  5HGC A;  4EB1 I;  2OL2 A;  1M93 B;  3FGQ A;  3CAA A;  2RIV A;  5IO1 A;  2VH4 A;  9PAI A;  2D26 A;  2WXY C;  4RO9 A;  1JTI A;  1K9O I;  1XQG A;  4AJT A;  1DZG I;  3NDF A;  4DY0 A;  1LJ5 A;  1QMN A;  1D5S A;  4ZK3 A;  2VDX A;  2ZNH A;  4ROA A;  1DZH L;  2H4R A;  4X30 A;  2ARQ A;  2HIJ L;  5CE0 A;  3EOX A;  4IC0 A;  1PSI A;  1C5G A;  3H5C A;  2QUG A;  1BR8 I;  2DUT A;  1ATH A;  1C8O A;  1JMJ A;  1OO8 A;  1AZX I;  2XN3 A;  4RSQ A;  3DRM A;  2XN7 A;  3DRU A;  1QMB A;  4CAA A;  2PEF A;  2R9Y A;  1ATT A;  1OYH I;  3CWM A;  5BRR I;  5CDZ A;  4KDS A;  2WXW A;  3DY0 A;  1F0C A;  1IZ2 A;  3VVJ A;  5CDX A; 
#chains in the Genus database with same CATH homology
 4AFX A;  3NE4 A;  1UHG A;  4YIA A;  1E05 I;  4P0F A;  4EB1 L;  1DVN A;  1JVQ I;  1QLP A;  2ARR A;  4GA7 A;  2RIW A;  2CEO A;  4Y3K A;  1BY7 A;  1SEK A;  1E03 I;  1XU8 A;  4C41 A;  1ANT I;  1DZG L;  2PEE A;  1DVM A;  3LE2 A;  1DZH I;  4AU2 A;  2HIJ I;  2B4X I;  4G8O A;  2ANT I;  4G8R A;  2XN5 A;  5EI0 A;  2H4Q A;  3NDD A;  3B9F I;  3F1S A;  1EZX A;  3KCG I;  1JJO C;  2ACH A;  4AJU A;  2BEH I;  4C49 A;  4IF8 A;  3F5N A;  3UT3 A;  3LW2 A;  7API A;  4R9I A;  2WXZ A;  4Y40 A;  3CWL A;  8API A;  4AU3 A;  2B5T I;  2WXX A;  1LK6 I;  1SNG A;  3PZF A;  3STO A;  3Q03 A;  3T1P A;  2ZV6 A;  1B3K A;  2WY0 C;  1TB6 I;  1YXA A;  2H4P A;  3ZHA A;  1OVA A;  1OPH A;  4ZK0 A;  3F02 A;  1JRR A;  1SR5 A;  1DB2 A;  2HI9 A;  1LQ8 A;  1NQ9 I;  3DLW A;  3PB1 I;  4ROB A;  1ATU A;  1HP7 A;  2WXZ C;  4BB2 A;  1HLE A;  4AU4 A;  2OAY A;  3OZQ A;  3NDA A;  1R1L I;  1KCT A;  1T1F A;  4AQH A;  9API A;  1OVA C;  3Q02 A;  5INW A;  4AU3 B;  4PYW A;  1JMO A;  1E04 I;  4P0O A;  2B4X L;  3R4L A;  1AS4 A;  2XN6 A;  2V95 A;  1IMV A;  1XQJ A;  1OVA B;  4DY7 C;  2VDY A;  2GD4 C;  5C98 A;  1OYH L;  1WZ9 A;  2WY1 A;  4DTE A;  2BEH L;  3EVJ I;  1MTP A;  1A7C A;  1OC0 A;  3CVM A;  5HGC A;  4EB1 I;  2OL2 A;  1M93 B;  3FGQ A;  3CAA A;  2RIV A;  5IO1 A;  2VH4 A;  9PAI A;  2D26 A;  2WXY C;  4RO9 A;  1JTI A;  1K9O I;  1XQG A;  4AJT A;  1DZG I;  3NDF A;  4DY0 A;  1LJ5 A;  1QMN A;  1D5S A;  4ZK3 A;  2VDX A;  2ZNH A;  4ROA A;  1DZH L;  2H4R A;  4X30 A;  2ARQ A;  2HIJ L;  5CE0 A;  3EOX A;  4IC0 A;  1PSI A;  1C5G A;  3H5C A;  2QUG A;  1BR8 I;  2DUT A;  1ATH A;  1C8O A;  1JMJ A;  1OO8 A;  1AZX I;  2XN3 A;  4RSQ A;  3DRM A;  2XN7 A;  3DRU A;  1QMB A;  4CAA A;  2PEF A;  2R9Y A;  1ATT A;  1OYH I;  3CWM A;  5BRR I;  5CDZ A;  4KDS A;  2WXW A;  3DY0 A;  1F0C A;  1IZ2 A;  3VVJ A;  5CDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...