8APIA

The s variant of human alpha1-antitrypsin, structure and implications for function and metabolism
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
340
structure length
340
Chain Sequence
DHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Proteinase inhibitor
molecule keywords ALPHA-1 ANTITRYPSIN (CHAIN A)
publication title The S variant of human alpha 1-antitrypsin, structure and implications for function and metabolism.
pubmed doi rcsb
total genus 95
structure length 340
sequence length 340
ec nomenclature
pdb deposition date 1988-09-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.39.10 Mainly Beta Roll Alpha-1-antitrypsin; domain 1 Alpha-1-antitrypsin, domain 1 8apiA01
3.30.497.10 Alpha Beta 2-Layer Sandwich Antithrombin; Chain I, domain 2 Antithrombin, subunit I, domain 2 8apiA02
1B3KA 4AJTA 2ZV6A 1JVQI 1QLPA 1JMJA 4KDSA 3DY0A 5C98A 1WZ9A 5HGCA 1OO8A 3NDDA 1E03I 3DRMA 2XN7A 7APIA 3KCGI 3PZFA 3NE4A 1DVNA 2WXZC 2QUGA 4R9IA 1YXAA 4C41A 2GD4C 2HIJI 2D26A 4AFXA 1OVAB 1ATTA 2BEHI 1OPHA 4DY7C 5INWA 1SR5A 2B4XL 4GA7A 5EI0A 2VDXA 3DLWA 2CEOA 2H4PA 1OVAA 3STOA 5CDXA 1DVMA 1BR8I 1XU8A 2VDYA 1SNGA 4IC0A 3OZQA 2WXWA 1K9OI 1SEKA 2RIVA 3CWMA 2ANTI 1QMBA 1IMVA 1XQJA 2HIJL 3EOXA 9APIA 2BEHL 2OAYA 2RIWA 3ZHAA 3CWLA 1R1LI 4AU3B 2OL2A 2WXYC 2B5TI 4RSQA 5BRRI 3F5NA 3PB1I 1UHGA 4X30A 4AU2A 4YIAA 1OYHI 4PYWA 1AZXI 1DZHI 1T1FA 1LJ5A 1KCTA 4AJUA 4CAAA 1C5GA 3H5CA 4AU3A 3F02A 3LW2A 4AQHA 4EB1I 3EVJI 3CAAA 1D5SA 1DZGI 1M93B 2DUTA 5CDZA 1ATUA 1HLEA 4Y3KA 1XQGA 3F1SA 1TB6I 3Q03A 4P0OA 4DTEA 3VVJA 1BY7A 1OVAC 1LK6I 2XN5A 4G8RA 1JTIA 1NQ9I 3UT3A 2R9YA 4ZK0A 3NDFA 4Y40A 4C49A 1QMNA 3DRUA 1ANTI 4BB2A 2XN6A 2ARRA 1OYHL 4ROBA 3T1PA 2H4QA 2ACHA 2VH4A 1DZHL 2V95A 1DB2A 1F0CA 2WXZA 8APIA 2ARQA 1IZ2A 1EZXA 1AS4A 1JJOC 1JMOA 4EB1L 1MTPA 1JRRA 2WXXA 1DZGL 1LQ8A 2PEFA 1E05I 2XN3A 3LE2A 3FGQA 2PEEA 3B9FI 3NDAA 1C8OA 1ATHA 3CVMA 4G8OA 2WY1A 4RO9A 2H4RA 5IO1A 4ZK3A 4DY0A 4P0FA 5CE0A 9PAIA 2ZNHA 1OC0A 4AU4A 4ROAA 4IF8A 3R4LA 2HI9A 2B4XI 1E04I 3Q02A 2WY0C 1PSIA 1HP7A 1A7CA
chains in the Genus database with same CATH superfamily
1B3KA 4AJTA 2ZV6A 1JVQI 1QLPA 1JMJA 4KDSA 3DY0A 5C98A 1WZ9A 5HGCA 1OO8A 3NDDA 1E03I 3DRMA 2XN7A 7APIA 3KCGI 3PZFA 3NE4A 1DVNA 2WXZC 2QUGA 4R9IA 1YXAA 4C41A 2GD4C 2HIJI 2D26A 4AFXA 1OVAB 1ATTA 2BEHI 1OPHA 4DY7C 5INWA 1SR5A 2B4XL 4GA7A 5EI0A 2VDXA 3DLWA 2CEOA 2H4PA 1OVAA 3STOA 5CDXA 1DVMA 1BR8I 1XU8A 2VDYA 1SNGA 4IC0A 3OZQA 2WXWA 1K9OI 1SEKA 2RIVA 3CWMA 2ANTI 1QMBA 1IMVA 1XQJA 2HIJL 3EOXA 9APIA 2BEHL 2OAYA 2RIWA 3ZHAA 3CWLA 1R1LI 4AU3B 2OL2A 2WXYC 2B5TI 4RSQA 5BRRI 3F5NA 3PB1I 1UHGA 4X30A 4AU2A 4YIAA 1OYHI 4PYWA 1AZXI 1DZHI 1T1FA 1LJ5A 1KCTA 4AJUA 4CAAA 1C5GA 3H5CA 4AU3A 3F02A 3LW2A 4AQHA 4EB1I 3EVJI 3CAAA 1D5SA 1DZGI 1M93B 2DUTA 5CDZA 1ATUA 1HLEA 4Y3KA 1XQGA 3F1SA 1TB6I 3Q03A 4P0OA 4DTEA 3VVJA 1BY7A 1OVAC 1LK6I 2XN5A 4G8RA 1JTIA 1NQ9I 3UT3A 2R9YA 4ZK0A 3NDFA 4Y40A 4C49A 1QMNA 3DRUA 1ANTI 4BB2A 2XN6A 2ARRA 1OYHL 4ROBA 3T1PA 2H4QA 2ACHA 2VH4A 1DZHL 2V95A 1DB2A 1F0CA 2WXZA 8APIA 2ARQA 1IZ2A 1EZXA 1AS4A 1JJOC 1JMOA 4EB1L 1MTPA 1JRRA 2WXXA 1DZGL 1LQ8A 2PEFA 1E05I 2XN3A 3LE2A 3FGQA 2PEEA 3B9FI 3NDAA 1C8OA 1ATHA 3CVMA 4G8OA 2WY1A 4RO9A 2H4RA 5IO1A 4ZK3A 4DY0A 4P0FA 5CE0A 9PAIA 2ZNHA 1OC0A 4AU4A 4ROAA 4IF8A 3R4LA 2HI9A 2B4XI 1E04I 3Q02A 2WY0C 1PSIA 1HP7A 1A7CA
chains in the Genus database with same CATH topology
1B3KA 4AJTA 2ZV6A 1JVQI 1QLPA 1JMJA 4KDSA 3DY0A 5C98A 1WZ9A 5HGCA 1OO8A 3NDDA 1E03I 3DRMA 2XN7A 7APIA 3KCGI 3PZFA 3NE4A 1DVNA 2WXZC 2QUGA 4R9IA 1YXAA 4C41A 2GD4C 2HIJI 2D26A 4AFXA 1OVAB 1ATTA 2BEHI 1OPHA 4DY7C 5INWA 1SR5A 2B4XL 4GA7A 5EI0A 2VDXA 3DLWA 2CEOA 2H4PA 1OVAA 3STOA 5CDXA 1DVMA 1BR8I 1XU8A 2VDYA 1SNGA 4IC0A 3OZQA 2WXWA 1K9OI 1SEKA 2RIVA 3CWMA 2ANTI 1QMBA 1IMVA 1XQJA 2HIJL 3EOXA 9APIA 2BEHL 2OAYA 2RIWA 3ZHAA 3CWLA 1R1LI 4AU3B 2OL2A 2WXYC 2B5TI 4RSQA 5BRRI 3F5NA 3PB1I 1UHGA 4X30A 4AU2A 4YIAA 1OYHI 4PYWA 1AZXI 1DZHI 1T1FA 1LJ5A 1KCTA 4AJUA 4CAAA 1C5GA 3H5CA 4AU3A 3F02A 3LW2A 4AQHA 4EB1I 3EVJI 3CAAA 1D5SA 1DZGI 1M93B 2DUTA 5CDZA 1ATUA 1HLEA 4Y3KA 1XQGA 3F1SA 1TB6I 3Q03A 4P0OA 4DTEA 3VVJA 1BY7A 1OVAC 1LK6I 2XN5A 4G8RA 1JTIA 1NQ9I 3UT3A 2R9YA 4ZK0A 3NDFA 4Y40A 4C49A 1QMNA 3DRUA 1ANTI 4BB2A 2XN6A 2ARRA 1OYHL 4ROBA 3T1PA 2H4QA 2ACHA 2VH4A 1DZHL 2V95A 1DB2A 1F0CA 2WXZA 8APIA 2ARQA 1IZ2A 1EZXA 1AS4A 1JJOC 1JMOA 4EB1L 1MTPA 1JRRA 2WXXA 1DZGL 1LQ8A 2PEFA 1E05I 2XN3A 3LE2A 3FGQA 2PEEA 3B9FI 3NDAA 1C8OA 1ATHA 3CVMA 4G8OA 2WY1A 4RO9A 2H4RA 5IO1A 4ZK3A 4DY0A 4P0FA 5CE0A 9PAIA 2ZNHA 1OC0A 4AU4A 4ROAA 4IF8A 3R4LA 2HI9A 2B4XI 1E04I 3Q02A 2WY0C 1PSIA 1HP7A 1A7CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B3K A;  4AJT A;  2ZV6 A;  1JVQ I;  1QLP A;  1JMJ A;  4KDS A;  3DY0 A;  5C98 A;  1WZ9 A;  5HGC A;  1OO8 A;  3NDD A;  1E03 I;  3DRM A;  2XN7 A;  7API A;  3KCG I;  3PZF A;  3NE4 A;  1DVN A;  2WXZ C;  2QUG A;  4R9I A;  1YXA A;  4C41 A;  2GD4 C;  2HIJ I;  2D26 A;  4AFX A;  1OVA B;  1ATT A;  2BEH I;  1OPH A;  4DY7 C;  5INW A;  1SR5 A;  2B4X L;  4GA7 A;  5EI0 A;  2VDX A;  3DLW A;  2CEO A;  2H4P A;  1OVA A;  3STO A;  5CDX A;  1DVM A;  1BR8 I;  1XU8 A;  2VDY A;  1SNG A;  4IC0 A;  3OZQ A;  2WXW A;  1K9O I;  1SEK A;  2RIV A;  3CWM A;  2ANT I;  1QMB A;  1IMV A;  1XQJ A;  2HIJ L;  3EOX A;  9API A;  2BEH L;  2OAY A;  2RIW A;  3ZHA A;  3CWL A;  1R1L I;  4AU3 B;  2OL2 A;  2WXY C;  2B5T I;  4RSQ A;  5BRR I;  3F5N A;  3PB1 I;  1UHG A;  4X30 A;  4AU2 A;  4YIA A;  1OYH I;  4PYW A;  1AZX I;  1DZH I;  1T1F A;  1LJ5 A;  1KCT A;  4AJU A;  4CAA A;  1C5G A;  3H5C A;  4AU3 A;  3F02 A;  3LW2 A;  4AQH A;  4EB1 I;  3EVJ I;  3CAA A;  1D5S A;  1DZG I;  1M93 B;  2DUT A;  5CDZ A;  1ATU A;  1HLE A;  4Y3K A;  1XQG A;  3F1S A;  1TB6 I;  3Q03 A;  4P0O A;  4DTE A;  3VVJ A;  1BY7 A;  1OVA C;  1LK6 I;  2XN5 A;  4G8R A;  1JTI A;  1NQ9 I;  3UT3 A;  2R9Y A;  4ZK0 A;  3NDF A;  4Y40 A;  4C49 A;  1QMN A;  3DRU A;  1ANT I;  4BB2 A;  2XN6 A;  2ARR A;  1OYH L;  4ROB A;  3T1P A;  2H4Q A;  2ACH A;  2VH4 A;  1DZH L;  2V95 A;  1DB2 A;  1F0C A;  2WXZ A;  8API A;  2ARQ A;  1IZ2 A;  1EZX A;  1AS4 A;  1JJO C;  1JMO A;  4EB1 L;  1MTP A;  1JRR A;  2WXX A;  1DZG L;  1LQ8 A;  2PEF A;  1E05 I;  2XN3 A;  3LE2 A;  3FGQ A;  2PEE A;  3B9F I;  3NDA A;  1C8O A;  1ATH A;  3CVM A;  4G8O A;  2WY1 A;  4RO9 A;  2H4R A;  5IO1 A;  4ZK3 A;  4DY0 A;  4P0F A;  5CE0 A;  9PAI A;  2ZNH A;  1OC0 A;  4AU4 A;  4ROA A;  4IF8 A;  3R4L A;  2HI9 A;  2B4X I;  1E04 I;  3Q02 A;  2WY0 C;  1PSI A;  1HP7 A;  1A7C A; 
#chains in the Genus database with same CATH topology
 1B3K A;  4AJT A;  2ZV6 A;  1JVQ I;  1QLP A;  1JMJ A;  4KDS A;  3DY0 A;  5C98 A;  1WZ9 A;  5HGC A;  1OO8 A;  3NDD A;  1E03 I;  3DRM A;  2XN7 A;  7API A;  3KCG I;  3PZF A;  3NE4 A;  1DVN A;  2WXZ C;  2QUG A;  4R9I A;  1YXA A;  4C41 A;  2GD4 C;  2HIJ I;  2D26 A;  4AFX A;  1OVA B;  1ATT A;  2BEH I;  1OPH A;  4DY7 C;  5INW A;  1SR5 A;  2B4X L;  4GA7 A;  5EI0 A;  2VDX A;  3DLW A;  2CEO A;  2H4P A;  1OVA A;  3STO A;  5CDX A;  1DVM A;  1BR8 I;  1XU8 A;  2VDY A;  1SNG A;  4IC0 A;  3OZQ A;  2WXW A;  1K9O I;  1SEK A;  2RIV A;  3CWM A;  2ANT I;  1QMB A;  1IMV A;  1XQJ A;  2HIJ L;  3EOX A;  9API A;  2BEH L;  2OAY A;  2RIW A;  3ZHA A;  3CWL A;  1R1L I;  4AU3 B;  2OL2 A;  2WXY C;  2B5T I;  4RSQ A;  5BRR I;  3F5N A;  3PB1 I;  1UHG A;  4X30 A;  4AU2 A;  4YIA A;  1OYH I;  4PYW A;  1AZX I;  1DZH I;  1T1F A;  1LJ5 A;  1KCT A;  4AJU A;  4CAA A;  1C5G A;  3H5C A;  4AU3 A;  3F02 A;  3LW2 A;  4AQH A;  4EB1 I;  3EVJ I;  3CAA A;  1D5S A;  1DZG I;  1M93 B;  2DUT A;  5CDZ A;  1ATU A;  1HLE A;  4Y3K A;  1XQG A;  3F1S A;  1TB6 I;  3Q03 A;  4P0O A;  4DTE A;  3VVJ A;  1BY7 A;  1OVA C;  1LK6 I;  2XN5 A;  4G8R A;  1JTI A;  1NQ9 I;  3UT3 A;  2R9Y A;  4ZK0 A;  3NDF A;  4Y40 A;  4C49 A;  1QMN A;  3DRU A;  1ANT I;  4BB2 A;  2XN6 A;  2ARR A;  1OYH L;  4ROB A;  3T1P A;  2H4Q A;  2ACH A;  2VH4 A;  1DZH L;  2V95 A;  1DB2 A;  1F0C A;  2WXZ A;  8API A;  2ARQ A;  1IZ2 A;  1EZX A;  1AS4 A;  1JJO C;  1JMO A;  4EB1 L;  1MTP A;  1JRR A;  2WXX A;  1DZG L;  1LQ8 A;  2PEF A;  1E05 I;  2XN3 A;  3LE2 A;  3FGQ A;  2PEE A;  3B9F I;  3NDA A;  1C8O A;  1ATH A;  3CVM A;  4G8O A;  2WY1 A;  4RO9 A;  2H4R A;  5IO1 A;  4ZK3 A;  4DY0 A;  4P0F A;  5CE0 A;  9PAI A;  2ZNH A;  1OC0 A;  4AU4 A;  4ROA A;  4IF8 A;  3R4L A;  2HI9 A;  2B4X I;  1E04 I;  3Q02 A;  2WY0 C;  1PSI A;  1HP7 A;  1A7C A; 
#chains in the Genus database with same CATH homology
 1B3K A;  4AJT A;  2ZV6 A;  1JVQ I;  1QLP A;  1JMJ A;  4KDS A;  3DY0 A;  5C98 A;  1WZ9 A;  5HGC A;  1OO8 A;  3NDD A;  1E03 I;  3DRM A;  2XN7 A;  7API A;  3KCG I;  3PZF A;  3NE4 A;  1DVN A;  2WXZ C;  2QUG A;  4R9I A;  1YXA A;  4C41 A;  2GD4 C;  2HIJ I;  2D26 A;  4AFX A;  1OVA B;  1ATT A;  2BEH I;  1OPH A;  4DY7 C;  5INW A;  1SR5 A;  2B4X L;  4GA7 A;  5EI0 A;  2VDX A;  3DLW A;  2CEO A;  2H4P A;  1OVA A;  3STO A;  5CDX A;  1DVM A;  1BR8 I;  1XU8 A;  2VDY A;  1SNG A;  4IC0 A;  3OZQ A;  2WXW A;  1K9O I;  1SEK A;  2RIV A;  3CWM A;  2ANT I;  1QMB A;  1IMV A;  1XQJ A;  2HIJ L;  3EOX A;  9API A;  2BEH L;  2OAY A;  2RIW A;  3ZHA A;  3CWL A;  1R1L I;  4AU3 B;  2OL2 A;  2WXY C;  2B5T I;  4RSQ A;  5BRR I;  3F5N A;  3PB1 I;  1UHG A;  4X30 A;  4AU2 A;  4YIA A;  1OYH I;  4PYW A;  1AZX I;  1DZH I;  1T1F A;  1LJ5 A;  1KCT A;  4AJU A;  4CAA A;  1C5G A;  3H5C A;  4AU3 A;  3F02 A;  3LW2 A;  4AQH A;  4EB1 I;  3EVJ I;  3CAA A;  1D5S A;  1DZG I;  1M93 B;  2DUT A;  5CDZ A;  1ATU A;  1HLE A;  4Y3K A;  1XQG A;  3F1S A;  1TB6 I;  3Q03 A;  4P0O A;  4DTE A;  3VVJ A;  1BY7 A;  1OVA C;  1LK6 I;  2XN5 A;  4G8R A;  1JTI A;  1NQ9 I;  3UT3 A;  2R9Y A;  4ZK0 A;  3NDF A;  4Y40 A;  4C49 A;  1QMN A;  3DRU A;  1ANT I;  4BB2 A;  2XN6 A;  2ARR A;  1OYH L;  4ROB A;  3T1P A;  2H4Q A;  2ACH A;  2VH4 A;  1DZH L;  2V95 A;  1DB2 A;  1F0C A;  2WXZ A;  8API A;  2ARQ A;  1IZ2 A;  1EZX A;  1AS4 A;  1JJO C;  1JMO A;  4EB1 L;  1MTP A;  1JRR A;  2WXX A;  1DZG L;  1LQ8 A;  2PEF A;  1E05 I;  2XN3 A;  3LE2 A;  3FGQ A;  2PEE A;  3B9F I;  3NDA A;  1C8O A;  1ATH A;  3CVM A;  4G8O A;  2WY1 A;  4RO9 A;  2H4R A;  5IO1 A;  4ZK3 A;  4DY0 A;  4P0F A;  5CE0 A;  9PAI A;  2ZNH A;  1OC0 A;  4AU4 A;  4ROA A;  4IF8 A;  3R4L A;  2HI9 A;  2B4X I;  1E04 I;  3Q02 A;  2WY0 C;  1PSI A;  1HP7 A;  1A7C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...