9APIA

The s variant of human alpha1-antitrypsin, structure and implications for function and metabolism
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
339
structure length
339
Chain Sequence
HPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Proteinase inhibitor
molecule keywords ALPHA 1-ANTITRYPSIN
publication title The S variant of human alpha 1-antitrypsin, structure and implications for function and metabolism.
pubmed doi rcsb
total genus 88
structure length 339
sequence length 339
ec nomenclature
pdb deposition date 1988-09-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.39.10 Mainly Beta Roll Alpha-1-antitrypsin; domain 1 Alpha-1-antitrypsin, domain 1 9apiA01
3.30.497.10 Alpha Beta 2-Layer Sandwich Antithrombin; Chain I, domain 2 Antithrombin, subunit I, domain 2 9apiA02
1ANTI 3CVMA 4PYWA 1JMOA 4YIAA 4BB2A 2H4PA 2OAYA 1LK6I 4C49A 4P0FA 1MTPA 4IF8A 2BEHI 1QMBA 8APIA 3H5CA 2CEOA 2D26A 2B5TI 2HI9A 1YXAA 1LQ8A 4Y3KA 3UT3A 4IC0A 3DY0A 3NE4A 3DLWA 1ATUA 1SR5A 1BY7A 1QMNA 1C5GA 4EB1I 1OYHL 2PEEA 1R1LI 4AU3A 1A7CA 1PSIA 1IZ2A 4R9IA 1DZHL 3Q03A 1K9OI 2WXZA 4GA7A 1SNGA 3DRUA 2WY0C 2XN5A 5CDXA 1EZXA 2QUGA 2GD4C 1DVNA 2BEHL 4G8RA 1E05I 1QLPA 2ARRA 3F1SA 1TB6I 2ZNHA 3Q02A 4ROBA 7APIA 3T1PA 2VH4A 4CAAA 4AU4A 3STOA 1LJ5A 2VDYA 3VVJA 5C98A 4ZK3A 2ANTI 1F0CA 1OPHA 2WXWA 3R4LA 4AJUA 2ACHA 1SEKA 1DZGI 4AJTA 2WY1A 3CAAA 1BR8I 4EB1L 3PZFA 2OL2A 2B4XI 1WZ9A 2XN3A 3NDDA 2PEFA 2ZV6A 1E03I 5HGCA 4RO9A 1OVAC 1JJOC 3F02A 1JVQI 2RIVA 5INWA 2XN7A 3NDFA 1HLEA 1XQGA 2H4QA 4AFXA 2ARQA 4RSQA 1D5SA 2H4RA 1XQJA 1KCTA 2R9YA 5EI0A 1IMVA 4AU2A 9APIA 3PB1I 4AQHA 1T1FA 1B3KA 1OO8A 2WXXA 1DZGL 1DB2A 1OYHI 4X30A 3LW2A 2RIWA 4Y40A 1M93B 4KDSA 3DRMA 2B4XL 5CDZA 2HIJI 2DUTA 3NDAA 3CWMA 1AZXI 3ZHAA 9PAIA 3KCGI 3CWLA 5CE0A 5IO1A 1C8OA 1NQ9I 1XU8A 2WXZC 3B9FI 2XN6A 3EOXA 1ATHA 1JTIA 4P0OA 4ROAA 4ZK0A 5BRRI 4G8OA 4DTEA 3OZQA 4C41A 4DY0A 4DY7C 1ATTA 1HP7A 3LE2A 1OC0A 1DVMA 2V95A 1AS4A 2WXYC 1OVAA 1OVAB 4AU3B 1JMJA 2HIJL 2VDXA 1E04I 1JRRA 3EVJI 3F5NA 1DZHI 1UHGA 3FGQA
chains in the Genus database with same CATH superfamily
1ANTI 3CVMA 4PYWA 1JMOA 4YIAA 4BB2A 2H4PA 2OAYA 1LK6I 4C49A 4P0FA 1MTPA 4IF8A 2BEHI 1QMBA 8APIA 3H5CA 2CEOA 2D26A 2B5TI 2HI9A 1YXAA 1LQ8A 4Y3KA 3UT3A 4IC0A 3DY0A 3NE4A 3DLWA 1ATUA 1SR5A 1BY7A 1QMNA 1C5GA 4EB1I 1OYHL 2PEEA 1R1LI 4AU3A 1A7CA 1PSIA 1IZ2A 4R9IA 1DZHL 3Q03A 1K9OI 2WXZA 4GA7A 1SNGA 3DRUA 2WY0C 2XN5A 5CDXA 1EZXA 2QUGA 2GD4C 1DVNA 2BEHL 4G8RA 1E05I 1QLPA 2ARRA 3F1SA 1TB6I 2ZNHA 3Q02A 4ROBA 7APIA 3T1PA 2VH4A 4CAAA 4AU4A 3STOA 1LJ5A 2VDYA 3VVJA 5C98A 4ZK3A 2ANTI 1F0CA 1OPHA 2WXWA 3R4LA 4AJUA 2ACHA 1SEKA 1DZGI 4AJTA 2WY1A 3CAAA 1BR8I 4EB1L 3PZFA 2OL2A 2B4XI 1WZ9A 2XN3A 3NDDA 2PEFA 2ZV6A 1E03I 5HGCA 4RO9A 1OVAC 1JJOC 3F02A 1JVQI 2RIVA 5INWA 2XN7A 3NDFA 1HLEA 1XQGA 2H4QA 4AFXA 2ARQA 4RSQA 1D5SA 2H4RA 1XQJA 1KCTA 2R9YA 5EI0A 1IMVA 4AU2A 9APIA 3PB1I 4AQHA 1T1FA 1B3KA 1OO8A 2WXXA 1DZGL 1DB2A 1OYHI 4X30A 3LW2A 2RIWA 4Y40A 1M93B 4KDSA 3DRMA 2B4XL 5CDZA 2HIJI 2DUTA 3NDAA 3CWMA 1AZXI 3ZHAA 9PAIA 3KCGI 3CWLA 5CE0A 5IO1A 1C8OA 1NQ9I 1XU8A 2WXZC 3B9FI 2XN6A 3EOXA 1ATHA 1JTIA 4P0OA 4ROAA 4ZK0A 5BRRI 4G8OA 4DTEA 3OZQA 4C41A 4DY0A 4DY7C 1ATTA 1HP7A 3LE2A 1OC0A 1DVMA 2V95A 1AS4A 2WXYC 1OVAA 1OVAB 4AU3B 1JMJA 2HIJL 2VDXA 1E04I 1JRRA 3EVJI 3F5NA 1DZHI 1UHGA 3FGQA
chains in the Genus database with same CATH topology
1ANTI 3CVMA 4PYWA 1JMOA 4YIAA 4BB2A 2H4PA 2OAYA 1LK6I 4C49A 4P0FA 1MTPA 4IF8A 2BEHI 1QMBA 8APIA 3H5CA 2CEOA 2D26A 2B5TI 2HI9A 1YXAA 1LQ8A 4Y3KA 3UT3A 4IC0A 3DY0A 3NE4A 3DLWA 1ATUA 1SR5A 1BY7A 1QMNA 1C5GA 4EB1I 1OYHL 2PEEA 1R1LI 4AU3A 1A7CA 1PSIA 1IZ2A 4R9IA 1DZHL 3Q03A 1K9OI 2WXZA 4GA7A 1SNGA 3DRUA 2WY0C 2XN5A 5CDXA 1EZXA 2QUGA 2GD4C 1DVNA 2BEHL 4G8RA 1E05I 1QLPA 2ARRA 3F1SA 1TB6I 2ZNHA 3Q02A 4ROBA 7APIA 3T1PA 2VH4A 4CAAA 4AU4A 3STOA 1LJ5A 2VDYA 3VVJA 5C98A 4ZK3A 2ANTI 1F0CA 1OPHA 2WXWA 3R4LA 4AJUA 2ACHA 1SEKA 1DZGI 4AJTA 2WY1A 3CAAA 1BR8I 4EB1L 3PZFA 2OL2A 2B4XI 1WZ9A 2XN3A 3NDDA 2PEFA 2ZV6A 1E03I 5HGCA 4RO9A 1OVAC 1JJOC 3F02A 1JVQI 2RIVA 5INWA 2XN7A 3NDFA 1HLEA 1XQGA 2H4QA 4AFXA 2ARQA 4RSQA 1D5SA 2H4RA 1XQJA 1KCTA 2R9YA 5EI0A 1IMVA 4AU2A 9APIA 3PB1I 4AQHA 1T1FA 1B3KA 1OO8A 2WXXA 1DZGL 1DB2A 1OYHI 4X30A 3LW2A 2RIWA 4Y40A 1M93B 4KDSA 3DRMA 2B4XL 5CDZA 2HIJI 2DUTA 3NDAA 3CWMA 1AZXI 3ZHAA 9PAIA 3KCGI 3CWLA 5CE0A 5IO1A 1C8OA 1NQ9I 1XU8A 2WXZC 3B9FI 2XN6A 3EOXA 1ATHA 1JTIA 4P0OA 4ROAA 4ZK0A 5BRRI 4G8OA 4DTEA 3OZQA 4C41A 4DY0A 4DY7C 1ATTA 1HP7A 3LE2A 1OC0A 1DVMA 2V95A 1AS4A 2WXYC 1OVAA 1OVAB 4AU3B 1JMJA 2HIJL 2VDXA 1E04I 1JRRA 3EVJI 3F5NA 1DZHI 1UHGA 3FGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ANT I;  3CVM A;  4PYW A;  1JMO A;  4YIA A;  4BB2 A;  2H4P A;  2OAY A;  1LK6 I;  4C49 A;  4P0F A;  1MTP A;  4IF8 A;  2BEH I;  1QMB A;  8API A;  3H5C A;  2CEO A;  2D26 A;  2B5T I;  2HI9 A;  1YXA A;  1LQ8 A;  4Y3K A;  3UT3 A;  4IC0 A;  3DY0 A;  3NE4 A;  3DLW A;  1ATU A;  1SR5 A;  1BY7 A;  1QMN A;  1C5G A;  4EB1 I;  1OYH L;  2PEE A;  1R1L I;  4AU3 A;  1A7C A;  1PSI A;  1IZ2 A;  4R9I A;  1DZH L;  3Q03 A;  1K9O I;  2WXZ A;  4GA7 A;  1SNG A;  3DRU A;  2WY0 C;  2XN5 A;  5CDX A;  1EZX A;  2QUG A;  2GD4 C;  1DVN A;  2BEH L;  4G8R A;  1E05 I;  1QLP A;  2ARR A;  3F1S A;  1TB6 I;  2ZNH A;  3Q02 A;  4ROB A;  7API A;  3T1P A;  2VH4 A;  4CAA A;  4AU4 A;  3STO A;  1LJ5 A;  2VDY A;  3VVJ A;  5C98 A;  4ZK3 A;  2ANT I;  1F0C A;  1OPH A;  2WXW A;  3R4L A;  4AJU A;  2ACH A;  1SEK A;  1DZG I;  4AJT A;  2WY1 A;  3CAA A;  1BR8 I;  4EB1 L;  3PZF A;  2OL2 A;  2B4X I;  1WZ9 A;  2XN3 A;  3NDD A;  2PEF A;  2ZV6 A;  1E03 I;  5HGC A;  4RO9 A;  1OVA C;  1JJO C;  3F02 A;  1JVQ I;  2RIV A;  5INW A;  2XN7 A;  3NDF A;  1HLE A;  1XQG A;  2H4Q A;  4AFX A;  2ARQ A;  4RSQ A;  1D5S A;  2H4R A;  1XQJ A;  1KCT A;  2R9Y A;  5EI0 A;  1IMV A;  4AU2 A;  9API A;  3PB1 I;  4AQH A;  1T1F A;  1B3K A;  1OO8 A;  2WXX A;  1DZG L;  1DB2 A;  1OYH I;  4X30 A;  3LW2 A;  2RIW A;  4Y40 A;  1M93 B;  4KDS A;  3DRM A;  2B4X L;  5CDZ A;  2HIJ I;  2DUT A;  3NDA A;  3CWM A;  1AZX I;  3ZHA A;  9PAI A;  3KCG I;  3CWL A;  5CE0 A;  5IO1 A;  1C8O A;  1NQ9 I;  1XU8 A;  2WXZ C;  3B9F I;  2XN6 A;  3EOX A;  1ATH A;  1JTI A;  4P0O A;  4ROA A;  4ZK0 A;  5BRR I;  4G8O A;  4DTE A;  3OZQ A;  4C41 A;  4DY0 A;  4DY7 C;  1ATT A;  1HP7 A;  3LE2 A;  1OC0 A;  1DVM A;  2V95 A;  1AS4 A;  2WXY C;  1OVA A;  1OVA B;  4AU3 B;  1JMJ A;  2HIJ L;  2VDX A;  1E04 I;  1JRR A;  3EVJ I;  3F5N A;  1DZH I;  1UHG A;  3FGQ A; 
#chains in the Genus database with same CATH topology
 1ANT I;  3CVM A;  4PYW A;  1JMO A;  4YIA A;  4BB2 A;  2H4P A;  2OAY A;  1LK6 I;  4C49 A;  4P0F A;  1MTP A;  4IF8 A;  2BEH I;  1QMB A;  8API A;  3H5C A;  2CEO A;  2D26 A;  2B5T I;  2HI9 A;  1YXA A;  1LQ8 A;  4Y3K A;  3UT3 A;  4IC0 A;  3DY0 A;  3NE4 A;  3DLW A;  1ATU A;  1SR5 A;  1BY7 A;  1QMN A;  1C5G A;  4EB1 I;  1OYH L;  2PEE A;  1R1L I;  4AU3 A;  1A7C A;  1PSI A;  1IZ2 A;  4R9I A;  1DZH L;  3Q03 A;  1K9O I;  2WXZ A;  4GA7 A;  1SNG A;  3DRU A;  2WY0 C;  2XN5 A;  5CDX A;  1EZX A;  2QUG A;  2GD4 C;  1DVN A;  2BEH L;  4G8R A;  1E05 I;  1QLP A;  2ARR A;  3F1S A;  1TB6 I;  2ZNH A;  3Q02 A;  4ROB A;  7API A;  3T1P A;  2VH4 A;  4CAA A;  4AU4 A;  3STO A;  1LJ5 A;  2VDY A;  3VVJ A;  5C98 A;  4ZK3 A;  2ANT I;  1F0C A;  1OPH A;  2WXW A;  3R4L A;  4AJU A;  2ACH A;  1SEK A;  1DZG I;  4AJT A;  2WY1 A;  3CAA A;  1BR8 I;  4EB1 L;  3PZF A;  2OL2 A;  2B4X I;  1WZ9 A;  2XN3 A;  3NDD A;  2PEF A;  2ZV6 A;  1E03 I;  5HGC A;  4RO9 A;  1OVA C;  1JJO C;  3F02 A;  1JVQ I;  2RIV A;  5INW A;  2XN7 A;  3NDF A;  1HLE A;  1XQG A;  2H4Q A;  4AFX A;  2ARQ A;  4RSQ A;  1D5S A;  2H4R A;  1XQJ A;  1KCT A;  2R9Y A;  5EI0 A;  1IMV A;  4AU2 A;  9API A;  3PB1 I;  4AQH A;  1T1F A;  1B3K A;  1OO8 A;  2WXX A;  1DZG L;  1DB2 A;  1OYH I;  4X30 A;  3LW2 A;  2RIW A;  4Y40 A;  1M93 B;  4KDS A;  3DRM A;  2B4X L;  5CDZ A;  2HIJ I;  2DUT A;  3NDA A;  3CWM A;  1AZX I;  3ZHA A;  9PAI A;  3KCG I;  3CWL A;  5CE0 A;  5IO1 A;  1C8O A;  1NQ9 I;  1XU8 A;  2WXZ C;  3B9F I;  2XN6 A;  3EOX A;  1ATH A;  1JTI A;  4P0O A;  4ROA A;  4ZK0 A;  5BRR I;  4G8O A;  4DTE A;  3OZQ A;  4C41 A;  4DY0 A;  4DY7 C;  1ATT A;  1HP7 A;  3LE2 A;  1OC0 A;  1DVM A;  2V95 A;  1AS4 A;  2WXY C;  1OVA A;  1OVA B;  4AU3 B;  1JMJ A;  2HIJ L;  2VDX A;  1E04 I;  1JRR A;  3EVJ I;  3F5N A;  1DZH I;  1UHG A;  3FGQ A; 
#chains in the Genus database with same CATH homology
 1ANT I;  3CVM A;  4PYW A;  1JMO A;  4YIA A;  4BB2 A;  2H4P A;  2OAY A;  1LK6 I;  4C49 A;  4P0F A;  1MTP A;  4IF8 A;  2BEH I;  1QMB A;  8API A;  3H5C A;  2CEO A;  2D26 A;  2B5T I;  2HI9 A;  1YXA A;  1LQ8 A;  4Y3K A;  3UT3 A;  4IC0 A;  3DY0 A;  3NE4 A;  3DLW A;  1ATU A;  1SR5 A;  1BY7 A;  1QMN A;  1C5G A;  4EB1 I;  1OYH L;  2PEE A;  1R1L I;  4AU3 A;  1A7C A;  1PSI A;  1IZ2 A;  4R9I A;  1DZH L;  3Q03 A;  1K9O I;  2WXZ A;  4GA7 A;  1SNG A;  3DRU A;  2WY0 C;  2XN5 A;  5CDX A;  1EZX A;  2QUG A;  2GD4 C;  1DVN A;  2BEH L;  4G8R A;  1E05 I;  1QLP A;  2ARR A;  3F1S A;  1TB6 I;  2ZNH A;  3Q02 A;  4ROB A;  7API A;  3T1P A;  2VH4 A;  4CAA A;  4AU4 A;  3STO A;  1LJ5 A;  2VDY A;  3VVJ A;  5C98 A;  4ZK3 A;  2ANT I;  1F0C A;  1OPH A;  2WXW A;  3R4L A;  4AJU A;  2ACH A;  1SEK A;  1DZG I;  4AJT A;  2WY1 A;  3CAA A;  1BR8 I;  4EB1 L;  3PZF A;  2OL2 A;  2B4X I;  1WZ9 A;  2XN3 A;  3NDD A;  2PEF A;  2ZV6 A;  1E03 I;  5HGC A;  4RO9 A;  1OVA C;  1JJO C;  3F02 A;  1JVQ I;  2RIV A;  5INW A;  2XN7 A;  3NDF A;  1HLE A;  1XQG A;  2H4Q A;  4AFX A;  2ARQ A;  4RSQ A;  1D5S A;  2H4R A;  1XQJ A;  1KCT A;  2R9Y A;  5EI0 A;  1IMV A;  4AU2 A;  9API A;  3PB1 I;  4AQH A;  1T1F A;  1B3K A;  1OO8 A;  2WXX A;  1DZG L;  1DB2 A;  1OYH I;  4X30 A;  3LW2 A;  2RIW A;  4Y40 A;  1M93 B;  4KDS A;  3DRM A;  2B4X L;  5CDZ A;  2HIJ I;  2DUT A;  3NDA A;  3CWM A;  1AZX I;  3ZHA A;  9PAI A;  3KCG I;  3CWL A;  5CE0 A;  5IO1 A;  1C8O A;  1NQ9 I;  1XU8 A;  2WXZ C;  3B9F I;  2XN6 A;  3EOX A;  1ATH A;  1JTI A;  4P0O A;  4ROA A;  4ZK0 A;  5BRR I;  4G8O A;  4DTE A;  3OZQ A;  4C41 A;  4DY0 A;  4DY7 C;  1ATT A;  1HP7 A;  3LE2 A;  1OC0 A;  1DVM A;  2V95 A;  1AS4 A;  2WXY C;  1OVA A;  1OVA B;  4AU3 B;  1JMJ A;  2HIJ L;  2VDX A;  1E04 I;  1JRR A;  3EVJ I;  3F5N A;  1DZH I;  1UHG A;  3FGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...